Wikipedia:Today's featured article/August 2024
| << | Today's featured articles for August 2024 | >> | ||||
|---|---|---|---|---|---|---|
| Su | Mo | Tu | We | Th | Fr | Sa |
| 1 | 2 | 3 | ||||
| 4 | 5 | 6 | 7 | 8 | 9 | 10 |
| 11 | 12 | 13 | 14 | 15 | 16 | 17 |
| 18 | 19 | 20 | 21 | 22 | 23 | 24 |
| 25 | 26 | 27 | 28 | 29 | 30 | 31 |
August 1
TheHomeric Hymnsare a collection of thirty-three ancient Greekhymnsand oneepigram.They praise deities of theGreek pantheonand retell mythological stories, such as theabduction of Persephoneand the seduction ofAnchisesbyAphrodite.In antiquity, the hymns were generally attributed to the poetHomer:modern scholarship has established that they vary widely in date. Performances of the hymns may have taken place atsympotic banquets,religious festivals and royal courts. They may originally have been performed by singers accompanying themselves on alyre.The hymns influencedAlexandrianand Roman poets, and both pagan and early Christian literature. They were first published in print byDemetrios Chalkokondylesin 1488–1489, whileGeorge Chapmanmade the first English translation of them in 1624. They have since influenced, among others,Handel,Goethe,Shelley,TennysonandCavafy.Their influence has also been traced in the novels ofJames JoyceandNeil Gaiman,and in the films ofAlfred Hitchcock.(Full article...)
August 2
Charles Edward(1884–1954) was at various times aBritish prince,the last rulingduke of Saxe-Coburg and Gothain Germany, and aNazipolitician. Brought up in the United Kingdom, he was selected to succeed to the throne ofSaxe-Coburg and Gothain 1899 because he was deemed young enough to be re-educated as a German. He marriedPrincess Victoria Adelaide of Schleswig-Holsteinand the couple had five children. Charles Edward was a conservative ruler with an interest in art and technology. During the First World War, he supported the German Empire but was deposed during theGerman Revolution.During the 1920s, Charles Edward became a moral and financial supporter of violent far-rightparamilitarygroups, joining the Nazi Party in 1933. He was given multiple positions, including leader of theGerman Red Cross,and acted as an unofficial diplomat. After the war, he was interned for a period and given a minor conviction by adenazificationcourt, dying of cancer in 1954. (Full article...)
August 3
Free and Candid Disquisitionsis an anonymously published 1749pamphletwritten and compiled byJohn Jones,a Welsh clergyman of theChurch of England.The work promoted a series of reforms to the church and theBook of Common Prayerthat Jones hoped would allow the moreProtestantand independentDissentersto be reintegrated into the church. Jones's proposals included shortening the Sundayliturgies,removingCatholicritual influences, and providing improvedhymnsandpsalms.Several responding texts were written, both lauding and criticizing Jones's work. While the proposals were not accepted by the Church of England, Jones's suggested alterations to the prayer book and advocacy of privately published liturgies influenced several Dissenterliturgical textsand early editions of the AmericanEpiscopal Church's prayer book. The pamphlet remained a major influence on proposed liturgical changes in the Church of England until the 19th-centuryTractarian movement.(Full article...)
August 4
TheAston Martin Rapideis an executivesports saloon carthat was produced by the British carmakerAston Martinbetween 2010 and 2020. Development of the car commenced in 2005, and after about two months, aconcept car,called the Rapide, was completed and displayed at theNorth American International Auto Show in 2006.In 2009, three years after the concept's unveiling, the production version debuted at theInternational Motor Show Germany.Official manufacture of the car began on 7 May 2010, atMagna Steyr's facility inGraz,Austria, but production was shifted toGaydon, Warwickshire,in 2012 after Aston Martin received funding from theBritish government.Over its production run, the Rapide received two major updates, with the introduction of the Rapide S(pictured)in 2013 and the Rapide AMR in 2018. Abattery electricversion of the Rapide, called the Rapide E, was introduced in 2018 but Aston Martin announced in 2020 that it would not beseries produced.(Full article...)
August 5
Alice of Champagne(c. 1193– 1246) was the eldest daughter of QueenIsabella I of Jerusalemand CountHenry II of Champagne.In 1210, Alice married her stepbrother KingHugh I of Cyprus,receiving theCounty of Jaffaasdowry.After her husband's death in 1218, she assumed the regency for their infant son, KingHenry I.Her attempts to bolster her claim toChampagneandBriein France failed. Due to a debate with her unclePhilip of Ibelin,she left Cyprus in 1223. In exile, she marriedBohemond,theheir apparentto thePrincipality of Antiochand theCounty of Tripoli,but their marriage wasannulled.In 1229, she unsuccessfully laid claim to the Kingdom of Jerusalem against the absentConrad II.In 1240, she marriedRaoul of Nesleand the High Court of Jerusalem proclaimed them regents for Conrad in 1243, although their power was nominal. Raoul left the kingdom, and Alice, before the end of the year. Alice retained the regency until her death in 1246. (Full article...)
August 6
Existenceis the state of having being orreality.It is often contrasted withessence,since one can understand the essential features of something without knowing whether it exists.Ontologystudies existence and differentiates between singular existence of individual entities and general existence ofconceptsoruniversals.Entities present in space and time have concrete existence, in contrast to abstract entities, like numbers and sets. Other distinctions are betweenpossible,contingent,andnecessaryexistence and betweenphysicalandmentalexistence. Some philosophers talk of degrees of existence but the more common view is that an entity either exists or not, with no intermediary states. It is controversial whether existence can be understood as apropertyofindividual objectsand, if so, whether there arenonexistent objects.The concept of existence has a long history and played a role in theancient periodinpre-Socratic,Hindu,Buddhist,andDaoist philosophy.(Full article...)
August 7
Blackrocks Breweryis acraft breweryinMarquette, Michigan,United States. Taking the name from a local landmark, former pharmaceutical salesmen David Manson and Andy Langlois opened Blackrocks in 2010. They originally brewed their products in the basement of a Victorian-style house(pictured),and the building's two other floors were used as ataproom.By 2013, persistent high demand for Blackrocks' beer led Manson and Langlois to expand their brewing capacity, including the purchase and conversion of a former Coca-Cola bottling plant. In the early 2020s, they expanded Blackrocks' taproom into an adjacent property, which doubled its available indoor area. Blackrocks produced 12,687 barrels of beer in 2023, up about 11 percent from the year prior, and they are the largest craft brewery in Michigan'sUpper Peninsula.Their most popular beer is 51K, anAmerican IPAnamed for a localski marathon.(Full article...)
August 8
Albert Stanley, 1st Baron Ashfield(8 August 1874 – 4 November 1948), was the managing director and chairman of theUnderground Electric Railways Company of London(UERL) from 1910 to 1933, and the chairman of theLondon Passenger Transport Board(LPTB) from 1933 to 1947. At a young age, he held senior positions in the tramway systems of Detroit and New Jersey. In 1907 he was recruited by the UERL, where he integrated the company's management and used advertising and public relations to improve profits. As managing director of the UERL from 1910, he led the take-over of competing companies and operations to form Combine, an integrated transport operation. He wasMember of ParliamentforAshton-under-Lynefrom 1916 to 1920 andPresident of the Board of Tradebetween 1916 and 1919. He returned to the UERL and then chaired it and its successor the LPTB during the organisation's greatest period of expansion between the two world wars, making it an exemplar of the best form of public administration. (Full article...)
August 9
St Melangell's Churchis a Grade Ilistedmedieval building in the former village of Pennant Melangell, in the Tanat Valley,Powys,Wales. Built over aBronze Ageburial ground, the church was founded around the 8th century to commemorate the reputed grave ofMelangell,ahermitandabbesswho founded a convent andsanctuaryin the area. The current church was built in the 12th century and has been renovated several times, including major restoration work in the 19th and 20th centuries. Archaeological excavation in the 20th century uncovered prehistoric and early medieval activity. The church contains the reconstructed shrine to Melangell, considered the oldest survivingRomanesqueshrine innorthern Europeand which was a majorpilgrimagesite in medieval Wales. The interior of the church holds a 15th-centuryrood screendepicting Melangell's legend, two 14th-centuryeffigies,paintings, andliturgicalfittings. (Full article...)
August 10
Phoolan Devi(1963–2001) was an Indiandacoit(bandit) who later became amember of parliament(MP). She was a woman of theMallah subcastewho grew up in poverty in thestateofUttar Pradesh.After marrying aged eleven and being sexually abused, she joined a gang of dacoits who robbed higher-caste villages and held up trains. When she became its leader, she evaded capture by the authorities, making her a heroine for theOther Backward Classes.She was chargedin absentiafor the 1981 Behmai massacre, in which twentyThakurmen were executed, allegedly on her command. Afterwards, calls to apprehend her were amplified. She surrendered two years later and spent eleven years inGwaliorprison awaiting trial. She was released in 1994 after the charges against her were set aside and she became an MP for theSamajwadi Party.Her global fame had grown after the release of the controversial filmBandit Queen,of which she did not approve. In 2001, she was assassinated outside her home in New Delhi. (Full article...)
August 11
T2was atorpedo boatof theRoyal Yugoslav Navy.Originally a250t-class torpedo boatof theAustro-Hungarian Navy,commissioned on 11 August 1914 as77T,she saw active service during World War I, performingconvoy,patrol, escort,minesweepingandminelayingtasks,anti-submarine operations,andshore bombardmentmissions. Present in theBocche di Cattaroduringthe short-lived mutinyby Austro-Hungarian sailors in early February 1918, members of her crew raised thered flagbut took no other mutinous actions. The boat was part of the escort force for the Austro-HungariandreadnoughtSzent Istvánwhen that ship was sunk byItaliantorpedo boats in June 1918. FollowingAustria-Hungary's defeat in 1918, the boat was allocated to the Navy of theKingdom of Serbs, Croats and Slovenes,which became the Royal Yugoslav Navy in 1921, and was renamedT2.During theinterwar period,Yugoslav naval activity was limited by reduced budgets. Worn out after twenty-five years of service,T2wasscrappedin 1939.(This articleis part of afeatured topic:Ships of the Royal Yugoslav Navy.)
August 12
Worldsis the debut studio album by Americanelectronic musicproducerPorter Robinson,released on August 12, 2014, byAstralwerks.Initially known for his heavier bass-centric production, Robinson became increasingly dissatisfied with theelectronic dance music(EDM) genre, believing it limited his artistic expression. Following the release of his 2012 single "Language",Robinson decided to prioritize aesthetic and emotional qualities in his work, taking inspiration from media that evoked nostalgia for his childhood and integrating elements taken fromanime,films, and sounds from 1990s video games. The album was promoted with four singles and later a tour(pictured)in North America and Europe.Worldswas well-received by most critics, who praised it as innovative and forecasted a promising career for Robinson, though others felt the record lacked coherence or was unexciting. The album has been retrospectively noted for its impact on the EDM scene. (Full article...)
August 13
The nationalflag of Japanis a white rectangular flag with a large red disc (representing the sun) in the center. It is officially calledNisshōkiin Japanese, but more commonly known as theHinomaru.Although considered thede factoflag, it was designated as Japan's national flag on August 13, 1999. In early Japanese history, theHinomarumotif was used on flags ofdaimyosandsamurai.During theMeiji Restorationboth the sun disc and theRising Sun Ensignwere symbols in theJapanese empire.Use of theHinomaruwas restricted during theAmerican occupationafterWorld War II,but this was later relaxed. The flag is not frequently displayed due to its past association with nationalism. There is no requirement to fly the flag on any national holiday or special events. If used the flag may be flown from sunrise until sunset, although businesses and schools are permitted to fly the flag from opening to closing. (Full article...)
August 14
Hudson Volcanois avolcanoin the rugged mountains of southern Chile. Lying in theSouthern Volcanic Zoneof theAndes,it was formed by thesubductionof the oceanicNazca Plateunder the continentalSouth American Plate.Hudson has the form of a 10-kilometre-wide (6-mile) volcaniccalderafilled with ice. The volcano has erupted numerous times in the past 2.5 million years forming widespreadtephradeposits, and is the most active volcano in the region. Four large eruptions have taken place in the past 20,000 years: 17,300–17,440before present(BP), 7,750 BP, 4,200 BP, and in 1991. The 7,750 BP eruption was among the most intense volcanic eruptions in South America during theHolocene,devastated the local ecosystem and may have caused substantial shifts in human settlement and lifestyle. During the 1991 eruption,volcanic ashcovered a large area in Chile and Argentina, and was deposited as far as Antarctica. The last eruption was in 2011. (Full article...)
August 15
TheiMac G3,originally released as the iMac, is a series ofpersonal computerssold byApple Computerfrom 1998 to 2003. FollowingSteve Jobs's return to the financially troubled company that he co-founded, he aggressively restructured its offerings. The iMac was envisioned as Apple's new inexpensive and consumer-friendly desktop product, focused on easy connection to the Internet. Apple's head of designJony Iveand his team created a striking teardrop-shapedall-in-onedesign based around acathode-ray tubedisplay, shrouded in translucent colored plastic. The iMac eschewed legacy technologies likeserial portsandfloppy-diskdrives in favor ofCD-ROMsandUSB ports.Selling more than six million units, the iMac was a commercial success for Apple, helping to save it from bankruptcy whilst influencing the look of future computers and consumer products. The original model was revised several times and was succeeded by theiMac G4andeMac.(Full article...)
August 16
Snookeris acue sportplayed on a rectangularbilliards tablecovered with a green cloth calledbaize,with sixpockets.First played byBritish Armyofficers stationed in India circa 1875, the game uses twenty-two balls(pictured)– a whitecue ball,fifteen red balls, and six other balls collectively called "the colours". Using asnooker cue,individual players (or teams) take turns to strike the cue ball topotthe other balls in a predefined sequence, accumulating points for each successful pot and for eachfoulcommitted by the opposing player/team. An individualframeof snooker is won by the player or team that has scored the most points. A snookermatchends when a player/team has won a predetermined number of frames. The standard rules of snooker were first established in 1919. As aprofessional sport,snooker is governed by theWorld Professional Billiards and Snooker Association.Top players of many nationalities compete in regular tournaments around the world, earning millions of pounds on theWorld Snooker Tour.(Full article...)
August 17
On December 8, 1963,Pan Am Flight 214crashed nearElkton, Maryland,killing all 81 crew and passengers. Flight 214 had originated atIsla Verde International AirportinSan Juan,flying toFriendship AirportnearBaltimore,and then took off forPhiladelphia.The crash wasPan Am's first fatal accident with theBoeing707-121,which it had introduced to its fleet five years earlier. An investigation by theCivil Aeronautics Boardconcluded that the probable cause of the crash was alightning strikethat had ignited fuel vapors in one of the aircraft's fuel tanks, causing an explosion that destroyed the left wing. The exact manner of ignition was never determined, but the investigation increased awareness of how lightning can damage aircraft, leading to new regulations. The crash also led to research into the safety of several types of aviation fuel and into ways of changing the design of aircraft fuel systems to make them safer in the event of lightning strikes. (Full article...)
August 18
Kesis a fictional character in thescience fictiontelevision showStar Trek: Voyager,played byJennifer Lien.Kes joins the crew of the starshipUSSVoyagerin the pilot episode, opening anaeroponicsgarden and working as amedical assistant.She is a member of atelepathicalien species with a life span of only nine years. She leaves the ship in thefourth seasonafter her powers threaten to destroy it. She reappears in an episode in thesixth seasonand features inStar Trek: Voyagernovels and short stories.Voyager'screators intended Kes to provide audiences with a different perspective on time. Although Kes is portrayed as fragile and innocent, she is also shown as having hidden strength and maturity.Voyager'sproducers reluctantly fired Lien after her personal issues affected her reliability on set. Kes was a fan favorite character whileVoyagerwas airing, although critics reacted more negatively, finding her boring and without a clear purpose. Lien was praised for her performance. (Full article...)
August 19
TheBattle of Winwickwas fought on 19 August 1648 between a ScottishRoyalistarmy and aParliamentarianarmy during theSecond English Civil War.The Scottish army invaded north-west England and was attacked and defeated atPrestonon 17 August. The surviving Royalists fled south, closely pursued. Two days later, hungry, cold, soaking wet, exhausted and short of drypowder,they turned to fight atWinwick.Parliamentarian infantry launched a full-scale assault which resulted in more than three hours of furious but indecisive close-quarters fighting. The Parliamentarians fell back, pinned the Scots in place with their cavalry and sent their infantry on a circuitousflank march.When the Scots saw this force appear on their right flank they broke and fled. Parliamentarian cavalry pursued, killing many. The surviving Scottish infantry surrendered either atWinwick church(pictured)or in nearbyWarrington;their cavalry on 24 August atUttoxeter.Winwick was the last battle of the war. (Full article...)
August 20
Outer Wildsis a 2019action-adventure video gamedeveloped by Mobius Digital and published byAnnapurna Interactive.The game follows the player character as they explore aplanetary systemstuck in a 22-minutetime loopthat resets after the sun goessupernovaand destroys the system. Through repeated attempts they investigate alien ruins to discover their history and the cause of the time loop. The game began development in 2012 as the master'sthesisof director Alex Beachum(pictured),and became a commercial project in 2015. It was released forWindows,theXbox One,and thePlayStation 4in 2019, for thePlayStation 5and theXbox Series X/Sin 2022, and for theNintendo Switchin 2023. It was positively received, with most critics acclaiming its design and some criticizing the uneven difficulty of gameplay and pursuing the game's mysteries. An expansion,Echoes of the Eye,was released in 2021.Outer Wildswon in multiple categories at award shows, includingBest Gameat the16th British Academy Games Awards.(Full article...)
August 21
TheTurabay dynastywas a family ofBedouinemirs who governed the district ofLajjunin northernPalestineduringOttomanrule in the 16th–17th centuries. The family's forebears had served as chiefs ofJezreel ValleyduringMamlukrule in the late 15th century. During the Ottomanconquest of the regionin 1516–1517, the family aided Ottoman sultanSelim I.The Ottomans kept them as guardians of the strategicVia MarisandDamascus–Jerusalemhighways and rewarded them withtax farms.Although in the 17th century several of theiremirslived in towns, the Turabays largely remained nomads, camping with their tribesmen nearCaesareain the winters and the plain ofAcrein the summers. The eastward migration of their tribesmen to theJordan Valley,Ottoman centralization, and falling tax revenues brought about their political decline and they were permanently stripped of office in 1677. Descendants of the family continue to live in the area. (Full article...)
August 22
Total Recallis a 1990 Americanscience-fictionaction film directed byPaul Verhoeven(pictured).Based ona 1966 short storybyPhilip K. Dick,the film starsArnold Schwarzenegger,Rachel Ticotin,Sharon Stone,Ronny Cox,andMichael Ironside.It tells the story of Douglas Quaid (Schwarzenegger) and the shadow organization that tries to prevent him from recovering memories of his past as aMartiansecret agent. Schwarzenegger convincedCarolco Picturesto develop the film with him as the star, after the project had lingered indevelopment hellat multiple studios over sixteen years. The film wasone of the most expensive ever madeat the time, and became thefifth-highest-grossing film of the year.Reviewers liked its themes of identity and questioning reality, but criticized content perceived as vulgar and violent. Thepractical special effectswere well received, earning the film anAcademy Award,and the score byJerry Goldsmithhas been praised as one of his best works. (Full article...)
August 23
In 1993,about 350 documents were forgedby Lawrence X. Cusack III. These papers were supposedly from, or related to,John F. Kennedy.Some of them alleged that Kennedy had a secret first marriage and dealings with organized crime, had bribedFBI directorJ. Edgar Hoover,and paidhush moneytoMarilyn Monroe.Cusack, son of a lawyer who had dealings with Monroe's family, claimed to have found the papers in the firm's files. He sold them for between six and seven million dollars. One of the buyers suggested showing them toSeymour Hersh,who was writingThe Dark Side of Camelot(1997). Hersh began incorporating them into his book and proposed a television documentary. Checks by the networks uncovered flaws in the forgeries. These included the use of aZIP Codein a paper dated two years before the ZIP Code was introduced, and the use of atypeballthat had not yet been invented. Cusack was convicted offraud,sentenced to nearly ten years in prison and ordered to refund the money to the buyers. (Full article...)
August 24
Anna Lee Fisher(born August 24, 1949) is an Americanchemist,emergency physicianand formerNASAastronaut who was the first mother to fly in space. Fisher became an astronaut candidate withNASA Astronaut Group 8and joined theAstronaut Officefor the development of theCanadarmand the testing of payload bay door contingency spacewalk procedures. She was assigned to thesearch and rescuehelicopters for four Space Shuttle missions, then involved in the verification of flight software at theShuttle Avionics Integration Laboratoryand supported vehicle integration and payload testing atKennedy Space Center.She flew into space onSpace ShuttleDiscoveryfor theSTS-51-Amission and used the Canadarm to retrieve two satellites in incorrect orbits. Fisher then worked on procedures and training issues for the International Space Station (ISS), was acapsule communicator(CAPCOM) and the lead CAPCOM for ISSExpedition 33,and was involved in developing the display for the Orion spacecraft. (Full article...)
August 25
The24th Waffen Mountain Division of the SSKarstjägerwas a Germanmountain infantrydivision of theWaffen-SS,the armed wing of theNazi Partythat served alongside, but was never formally part of, theGerman armed forcesduring World War II. Formed on 18 July 1944 from abattalion,it was understrength and was soon reduced to abrigade.Its main task was fightingpartisanson the rugged frontiers ofYugoslavia,Italy,andAustria,and it consisted mainly ofethnic Germansfrom Yugoslavia and Italy. It also disarmed Italian troops and protected ethnic German communities in Italy in the wake of theItalian surrender.Members of the division were implicated in the 25 August 1944 murder of 33 people in the village of Torlano nearNimisin Italy, and 22 other major crimes. At the post-warNuremberg trials,the Waffen-SS was declared to be a criminal organisation due to its major involvement in war crimes and crimes against humanity. (Full article...)
August 26
Theblack-throated loon(Gavia arctica) is amigratoryaquatic bird that primarily breeds in freshwater lakes in northern Europe and Asia. It winters along sheltered, ice-free coasts of the northern Atlantic and Pacific oceans. Firstformally describedbyCarl Linnaeusin 1758, it is about 70 centimetres (28 in) long and can weigh from 1.3 to 3.4 kilograms (2.9 to 7.5 lb). In breeding plumage, it has mostly black upperparts, a grey head and hindneck, white and black sides, mostly white underparts and flanks, and a mostly black throat. The loon builds an oval-shaped nest about 23 centimetres (9.1 in) across, in vegetation on or near the breeding lake. It usually lays two eggs, brown-green with dark splotches. Chicks are fed a diet of small fish and invertebrates, contrasting with the mostly fish diet of the adult. Overall, the population of this loon is declining, but the species is notthreatened.It is protected under theMigratory Bird Treaty Act of 1918and theAfrican-Eurasian Waterbird Agreement.(Full article...)
August 27
Nadezhda Stasova(1822–1895) was an educator and one of the earliest leaders of theRussian women's movement.She was born into a noble and wealthy family; TsarAlexander I of Russiawas her godfather, and she received extensive private tutoring as a child. In adulthood, she dedicated herself to women's empowerment. Along withAnna FilosofovaandMaria Trubnikova,she founded and led several organizations designed to promote women's cultural and economic independence, including a publishing cooperative. In a decades-long effort, they successfully pushed government officials to allow higher education for women, although continual opposition sometimes limited or even reversed their successes. Stasova eventually became the lead organizer of theBestuzhev Coursesfor women in 1878, but a decade later was forced to resign under political pressure. She continued her work on women's issues right up until her death in 1895, mentoring and inspiring younger feminists. (Full article...)
August 28
Bäckadräktenis Sweden's first unisexfolk costume,designed in 2022 by musicianFredy Clue(pictured)and textile designer Ida Björs. Their mission was to encourage wider participation in folk traditions by providing an outfit that is not restricted to any gender or geographic region. The design merges elements traditionally considered either male or female and borrows heavily from older folk costumes. The release generated international press attention and discussions on social media, much of the latter about the relationship betweenfolk artsand gender. Many welcomed the design, saying it provides an opportunity fornon-binarySwedes to be more involved in folk culture. Others reacted negatively, resisting the social change they see as associated with it. Clue released asewing patternin 2023 and started taking custom orders by 2024, encouraging users to modify as they see fit, saying: "The real work continues with us learning to listen to oneself and others." (Full article...)
August 29
TheCross Templeis a formerplace of worshipinFangshan, Beijing.Built as a Buddhist temple, it may have seen Christian use during theTang dynasty(618–907). The temple was used by Buddhists during theLiao dynasty(916–1125) and by Christians during theYuan dynasty(1271–1368), returned to Buddhist use during theMing dynasty(1368–1644), and was sold in 1911. Its first modern mention was in 1919. The Cross Temple was damaged during theCultural Revolutionbut recognised as a national-level protected site in 2006. Some scholars consider it to be the only place of worship of theChurch of the East(also known as Nestorian Christianity) discovered in China. In the early 20th century, two stone blocks carved with crosses were discovered, one of which had an inscription inSyriac;they are presently on display atNanjing Museum.Today, the site features two ancient steles(one pictured)dating to the Liao and Yuan dynasties, some groundwork and the bases of several pillars. (Full article...)
August 30
Segundo Romance(Second Romance) is the tenthstudio albumby Mexican singerLuis Miguel(pictured),released on 30 August 1994 throughWEA Latina.Like Miguel's 1991 albumRomance,Segundo Romancecomprisescover versionsofboleros(Latin ballads). It was produced by Miguel withJuan Carlos Calderón,Kiko CibrianandArmando Manzanero,and recorded in early 1994 at theRecord PlantinLos Angeles.Miguel promoted the album with tours in the United States and Latin America from August to December 1994. Four singles were released: "El Día Que Me Quieras","La Media Vuelta","Todo y Nada ", and" Delirio ". The former two reached the top of theBillboardHot Latin Songschart in the United States.Segundo Romancereceived positive reviews frommusic criticsand it won theGrammy Award for Best Latin Pop Performance.By 1995,Segundo Romancehad sold more than 4.5 million copies, achieved multi-platinumstatus in many Latin American countries and Spain, and was certified platinum in the United States. (Full article...)
August 31
Rachelle Ann Go(born August 31, 1986) is a Filipino singer and actress. Known primarily for her work intheater,she has starred in musicals onBroadwayand in theWest End.She began her career as a pop artist in her native country, winning the television talent showSearch for a Starin 2003. She has since released six albums. Go started her theater career in the Philippines, playing the lead roles ofArielinThe Little Mermaid(2011) andJane PorterinTarzan(2013). Her international breakthrough came when she was cast asGigi Van Tranhin the West End revival ofMiss Saigonin 2014. She gained further recognition for her portrayal ofEliza Schuylerin the original 2017 West End production ofHamilton.Go has also playedFantinein various stagings and tours ofLes Misérables.Outside of music, she has had roles in the television seriesDiva(2010),Nita Negrita(2011),Biritera(2012), andIndio(2013).(This articleis part of afeatured topic:Overview of Rachelle Ann Go.)