VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q100478508 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010624.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q100478508‏
024 ‎‡a 0000-0002-1311-351X‏ ‎‡2 orcid‏
024 ‎‡a 0000-0001-8632-3633‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q100478508‏
100 0 ‎‡a Dorothy J Becker‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Dorothy J Becker‏ ‎‡c onderzoeker‏ ‎‡9 nl‏
670 ‎‡a Author's 1-deamino-8-D-arginine vasopressin in the treatment of central diabetes insipidus in childhood‏
670 ‎‡a Author's A focus on blood glucose monitoring: relation to glycemic control and determinants of frequency‏
670 ‎‡a Author's A sero-epidemiologic study of nondiabetic first-degree relatives of IDDM cases‏
670 ‎‡a Author's Abnormal alpha cell hypoglycemic recognition in children with insulin dependent diabetes mellitus‏
670 ‎‡a Author's Abnormal alpha cell hypoglycemic recognition in children with insulin dependent diabetes mellitus (IDDM)‏
670 ‎‡a Author's Abnormal T-cell reactivities in childhood inflammatory demyelinating disease and type 1 diabetes.‏
670 ‎‡a Author's Age and sex variations in glucose tolerance and insulin responses: parallels with cardiovascular risk‏
670 ‎‡a Author's All-cause mortality trends in a large population-based cohort with long-standing childhood-onset type 1 diabetes: the Allegheny County type 1 diabetes registry‏
670 ‎‡a Author's Analyses on possible heterogeneity of IDDM based on presence of islet cell cytoplasmic antibody at diagnosis‏
670 ‎‡a Author's Antibodies to oxidized LDL and LDL-containing immune complexes as risk factors for coronary artery disease in diabetes mellitus‏
670 ‎‡a Author's Antibodies to oxidized LDL predict coronary artery disease in type 1 diabetes: a nested case-control study from the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Antigen-based therapy with glutamic acid decarboxylase (GAD) vaccine in patients with recent-onset type 1 diabetes: a randomised double-blind trial‏
670 ‎‡a Author's Are predictors of coronary heart disease and lower-extremity arterial disease in type 1 diabetes the same? A prospective study‏
670 ‎‡a Author's Assessment of AlbuSure and its usefulness in identifying IDDM subjects at increased risk for developing clinical diabetic nephropathy‏
670 ‎‡a Author's Association between family history, early growth and the risk of beta cell autoimmunity in children at risk for type 1 diabetes‏
670 ‎‡a Author's Associations of HbA1c with the timing of C-peptide responses during the oral glucose tolerance test at the diagnosis of type 1 diabetes‏
670 ‎‡a Author's Autoantibodies Directed Toward a Novel IA-2 Variant Protein Enhance Prediction of Type 1 Diabetes‏
670 ‎‡a Author's Autoimmune islet destruction in spontaneous type 1 diabetes is not beta-cell exclusive.‏
670 ‎‡a Author's Autoimmunity and genetics contribute to the risk of insulin-dependent diabetes mellitus in families: islet cell antibodies and HLA DQ heterodimers‏
670 ‎‡a Author's B-lymphocyte depletion with rituximab and β-cell function: two-year results‏
670 ‎‡a Author's Breastfeeding patterns of mothers with type 1 diabetes: results from an infant feeding trial‏
670 ‎‡a Author's Brief report: trajectories of glycemic control over early to middle adolescence‏
670 ‎‡a Author's Can management strategies alter the course of diabetic nephropathy?‏
670 ‎‡a Author's Cardiovascular disease and arterial calcification in insulin-dependent diabetes mellitus: interrelations and risk factor profiles. Pittsburgh Epidemiology of Diabetes Complications Study-V‏
670 ‎‡a Author's Cause-specific mortality trends in a large population-based cohort with long-standing childhood-onset type 1 diabetes‏
670 ‎‡a Author's Celiac Autoimmunity Is Associated With Lower Blood Pressure and Renal Risk in Type 1 Diabetes‏
670 ‎‡a Author's Changes in glycaemic control and risk of coronary artery disease in type 1 diabetes mellitus: findings from the Pittsburgh Epidemiology of Diabetes Complications Study (EDC).‏
670 ‎‡a Author's Changing impact of modifiable risk factors on the incidence of major outcomes of type 1 diabetes: the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Changing Prevalence of Overweight Children and Adolescents at Onset of Insulin-Treated Diabetes‏
670 ‎‡a Author's Characteristics of slow progression to diabetes in multiple islet autoantibody-positive individuals from five longitudinal cohorts: the SNAIL study.‏
670 ‎‡a Author's Characterization of Somatostatin Specific Binding in Plasma Cell Membranes of Human Placenta‏
670 ‎‡a Author's Characterizing sudden death and dead-in-bed syndrome in Type 1 diabetes: analysis from two childhood-onset Type 1 diabetes registries.‏
670 ‎‡a Author's Choice of urine sample predictive of microalbuminuria in patients with insulin-dependent diabetes mellitus‏
670 ‎‡a Author's Clustering of premature mortality in 1,761 insulin-dependent diabetics and their family members‏
670 ‎‡a Author's Co-stimulation modulation with abatacept in patients with recent-onset type 1 diabetes: a randomised, double-blind, placebo-controlled trial‏
670 ‎‡a Author's Coexistence of type 1 and type 2 diabetes mellitus: "double" diabetes?‏
670 ‎‡a Author's Cognitive adaptation theory as a predictor of adjustment to emerging adulthood for youth with and without type 1 diabetes‏
670 ‎‡a Author's Combined analysis of GAD65 and ICA512‏
670 ‎‡a Author's Combined analysis of GAD65 and ICA512(IA-2) autoantibodies in organ and non-organ-specific autoimmune diseases confers high specificity for insulin-dependent diabetes mellitus‏
670 ‎‡a Author's Comparison of adolescents with and without diabetes on indices of psychosocial functioning for three years‏
670 ‎‡a Author's Comparison of Physiologic and Pharmacologic Assessment of Growth Hormone Secretion‏
670 ‎‡a Author's Condom use, pregnancy, and STDs in adolescent females with and without type 1 diabetes.‏
670 ‎‡a Author's Contribution of diabetes duration before puberty to development of microvascular complications in IDDM subjects‏
670 ‎‡a Author's Coronary artery disease in IDDM. Gender differences in risk factors but not risk‏
670 ‎‡a Author's Coronary calcium in adults with type 1 diabetes: a stronger correlate of clinical coronary artery disease in men than in women‏
670 ‎‡a Author's Correlates of insulin antibodies in newly diagnosed children with insulin-dependent diabetes before insulin therapy‏
670 ‎‡a Author's Costimulation modulation with abatacept in patients with recent-onset type 1 diabetes: follow-up 1 year after cessation of treatment‏
670 ‎‡a Author's Cross-sectional and longitudinal relationship of sodium-lithium countertransport to insulin, obesity and blood pressure in healthy perimenopausal women‏
670 ‎‡a Author's Cumulative glycemic exposure and microvascular complications in insulin-dependent diabetes mellitus. The glycemic threshold revisited‏
670 ‎‡a Author's Cyclosporin therapy for prevention and cure of IDDM. Epidemiological perspective of benefits and risks‏
670 ‎‡a Author's Cytoplasmic islet cell antibodies remain valuable in defining risk of progression to type 1 diabetes in subjects with other islet autoantibodies.‏
670 ‎‡a Author's Demonstration of a dawn phenomenon in normal adolescents‏
670 ‎‡a Author's Detection of symptoms by adolescents and young adults with type 1 diabetes during experimental induction of mild hypoglycemia: role of hormonal and psychological variables.‏
670 ‎‡a Author's Diabetes complications and glycemic control. The Pittsburgh Prospective Insulin-Dependent Diabetes Cohort Study Status Report after 5 yr of IDDM‏
670 ‎‡a Author's Diabetic autonomic neuropathy and cardiovascular risk. Pittsburgh Epidemiology of Diabetes Complications Study III‏
670 ‎‡a Author's Diabetic nephropathy in adolescence: appearance during improved glycemic control‏
670 ‎‡a Author's Diabetic retinopathy in Mauriac's syndrome. Paradoxical deterioration with improved metabolic control‏
670 ‎‡a Author's Diet of adolescents with and without diabetes: Trading candy for potato chips?‏
670 ‎‡a Author's Differences between blacks and whites in the epidemiology of insulin-dependent diabetes mellitus in Allegheny County, Pennsylvania‏
670 ‎‡a Author's Disease progression among 446 children with newly diagnosed type 1 diabetes located in Scandinavia, Europe, and North America during the last 27 yr‏
670 ‎‡a Author's Diurnal glucose--dependent fluctuations in glycosylated hemoglobin levels in insulin-dependent diabetes‏
670 ‎‡a Author's Early adolescent relationship predictors of emerging adult outcomes: youth with and without type 1 diabetes‏
670 ‎‡a Author's Early and late C-peptide responses during oral glucose tolerance testing are oppositely predictive of type 1 diabetes in autoantibody-positive individuals‏
670 ‎‡a Author's Early feeding and risk of type 1 diabetes: experiences from the Trial to Reduce Insulin-dependent diabetes mellitus in the Genetically at Risk (TRIGR).‏
670 ‎‡a Author's Editorial Tribute: Mark A. Sperling, MD, Editor-in-Chief, Pediatric Diabetes 2000-2017‏
670 ‎‡a Author's Effect of Hydrolyzed Infant Formula vs Conventional Formula on Risk of Type 1 Diabetes: The TRIGR Randomized Clinical Trial‏
670 ‎‡a Author's Effects of enhanced conventional therapy on metabolic control in children with insulin-dependent diabetes mellitus‏
670 ‎‡a Author's Effects of improved glycemic control on microalbuminuria in adolescents with insulin-dependent diabetes mellitus‏
670 ‎‡a Author's Electroencephalographic changes in diabetic ketosis in children with newly and previously diagnosed insulin-dependent diabetes mellitus‏
670 ‎‡a Author's Emerging adults with type 1 diabetes: a comparison to peers without diabetes‏
670 ‎‡a Author's Employment patterns among parents of children with insulin-dependent diabetes mellitus (IDDM)‏
670 ‎‡a Author's Employment spectrum of IDDM‏
670 ‎‡a Author's Epidemiological correlates of diabetic neuropathy. Report from Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Epidemiology, pathophysiology, and prognostic implications of cystic fibrosis-related diabetes: a technical review‏
670 ‎‡a Author's Evidence for heterogeneous pathogenesis of insulin-treated diabetes in black and white children‏
670 ‎‡a Author's Evolution of the Pittsburgh studies of the epidemiology of insulin-dependent diabetes mellitus. Pittsburgh Diabetes Epidemiology and Etiology Research Group‏
670 ‎‡a Author's Excess BMI Accelerates Islet Autoimmunity in Older Children and Adolescents‏
670 ‎‡a Author's Excess BMI in Childhood: A Modifiable Risk Factor for Type 1 Diabetes Development?‏
670 ‎‡a Author's Factors affecting glycosylated hemoglobin values in children with insulin-dependent diabetes‏
670 ‎‡a Author's Factors associated with avoidance of severe complications after 25 yr of IDDM. Pittsburgh Epidemiology of Diabetes Complications Study I.‏
670 ‎‡a Author's Familial and sporadic insulin-dependent diabetes: evidence for heterogeneous etiologies?‏
670 ‎‡a Author's Familial insulin-dependent diabetes mellitus and hemipancreatectomy‏
670 ‎‡a Author's Families with children with diabetes: implications of parent stress for parent and child health‏
670 ‎‡a Author's Featured Article: Trajectories of Glycemic Control Over Adolescence and Emerging Adulthood: An 11-Year Longitudinal Study of Youth With Type 1 Diabetes‏
670 ‎‡a Author's Friendship and romantic relationships among emerging adults with and without type 1 diabetes‏
670 ‎‡a Author's Future intervention trials in type 1 diabetes‏
670 ‎‡a Author's Glucagon responses to hypoglycemia in children and adolescents with IDDM‏
670 ‎‡a Author's Glucose control in Rwandan youth with type 1 diabetes following establishment of systematic, HbA1c based, care and education‏
670 ‎‡a Author's Glucose tolerance in siblings of type 1 diabetic patients: relationship to HLA status‏
670 ‎‡a Author's Glycemia (or, in women, estimated glucose disposal rate) predict lower extremity arterial disease events in type 1 diabetes‏
670 ‎‡a Author's Glycosylated haemoglobin in children with insulin-dependent diabetes mellitus‏
670 ‎‡a Author's Glycosylated hemoglobin: a screening test for diabetes mellitus?‏
670 ‎‡a Author's Growth differences between North American and European children at risk for type 1 diabetes‏
670 ‎‡a Author's Growth hormone therapy and tumor recurrence. Findings in children with brain neoplasms and hypopituitarism‏
670 ‎‡a Author's Growth hormone therapy for patients with Turner's syndrome‏
670 ‎‡a Author's Health insurance and the financial impact of IDDM in families with a child with IDDM.‏
670 ‎‡a Author's Health, life, and automobile insurance characteristics in adults with IDDM.‏
670 ‎‡a Author's Height at diagnosis of insulin dependent diabetes in patients and their non-diabetic family members‏
670 ‎‡a Author's HLA-DRB1*15:01-DQA1*01:02-DQB1*06:02 Haplotype Protects Autoantibody-Positive Relatives From Type 1 Diabetes Throughout the Stages of Disease Progression‏
670 ‎‡a Author's HLA heterogeneity of insulin-dependent diabetes mellitus at diagnosis. The Pittsburgh IDDM study‏
670 ‎‡a Author's Hormonal, metabolic, and neuroradiologic abnormalities associated with septo-optic dysplasia‏
670 ‎‡a Author's Human insulin use and hypoglycaemia: insights from the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Humoral autoimmunity against the extracellular domain of the neuroendocrine autoantigen IA-2 heightens the risk of type 1 diabetes‏
670 ‎‡a Author's Hydrolyzed infant formula and early β-cell autoimmunity: a randomized clinical trial‏
670 ‎‡a Author's Hypertension as a risk factor for diabetic neuropathy: a prospective study‏
670 ‎‡a Author's Hypoglycemia: a complication of diabetes therapy in children‏
670 ‎‡a Author's Hypoplasia of the pancreas in a patient with type I diabetes mellitus‏
670 ‎‡a Author's Impact of a preconception counseling program for teens with type 1 diabetes (READY-Girls) on patient-provider interaction, resource utilization, and cost‏
670 ‎‡a Author's Impact of Age and Antibody Type on Progression From Single to Multiple Autoantibodies in Type 1 Diabetes Relatives‏
670 ‎‡a Author's Impaired counterregulatory hormone responses to hypoglycemia in children and adolescents with new onset IDDM‏
670 ‎‡a Author's Incidence of ESRD and survival after renal replacement therapy in patients with type 1 diabetes: a report from the Allegheny County Registry‏
670 ‎‡a Author's Increased Expression of Monocyte CD11b (Mac-1) in Overweight Recent-Onset Type 1 Diabetic Children‏
670 ‎‡a Author's Infant feeding and autoimmune diabetes.‏
670 ‎‡a Author's Infant Feeding and Timing of Complementary Foods in the Development of Type 1 Diabetes.‏
670 ‎‡a Author's Insulin as a predictor of coronary heart disease: interaction with apolipoprotein E phenotype. A report from the Multiple Risk Factor Intervention Trial‏
670 ‎‡a Author's Insulin-dependent diabetes mellitus mortality. The risk of cigarette smoking‏
670 ‎‡a Author's Insulin-dependent diabetes mellitus, physical activity, and death‏
670 ‎‡a Author's Insulin resistance-related factors, but not glycemia, predict coronary artery disease in type 1 diabetes: 10-year follow-up data from the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Intensive diabetes therapy in childhood: is it achievable? Is it desirable? Is it safe?‏
670 ‎‡a Author's Interleukin-1 antagonism in type 1 diabetes of recent onset: two multicentre, randomised, double-blind, placebo-controlled trials‏
670 ‎‡a Author's Introducing the Endotype Concept to Address the Challenge of Disease Heterogeneity in Type 1 Diabetes‏
670 ‎‡a Author's ISPAD Clinical Practice Consensus Guidelines 2014. Management of cystic fibrosis-related diabetes in children and adolescents‏
670 ‎‡a Author's ISPAD Clinical Practice Consensus Guidelines 2018: Management of cystic fibrosis-related diabetes in children and adolescents‏
670 ‎‡a Author's Knowledge, attitudes and behaviors related to sexuality and family planning in adolescent women with and without diabetes‏
670 ‎‡a Author's Large-scale prospective T cell function assays in shipped, unfrozen blood samples: experiences from the multicenter TRIGR trial‏
670 ‎‡a Author's Leptin before and after insulin therapy in children with new-onset type 1 diabetes‏
670 ‎‡a Author's Lipid and blood pressure treatment goals for type 1 diabetes: 10-year incidence data from the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Lipoprotein(a) concentration shows little relationship to IDDM complications in the Pittsburgh Epidemiology of Diabetes Complications Study cohort‏
670 ‎‡a Author's Long-term effects of the booster-enhanced READY-Girls preconception counseling program on intentions and behaviors for family planning in teens with diabetes‏
670 ‎‡a Author's Low-Dose Anti-Thymocyte Globulin‏
670 ‎‡a Author's Low-Dose Anti-Thymocyte Globulin (ATG) Preserves β-Cell Function and Improves HbA in New-Onset Type 1 Diabetes‏
670 ‎‡a Author's Low-Dose Anti-Thymocyte Globulin Preserves C-Peptide, Reduces HbA1c, and Increases Regulatory to Conventional T-Cell Ratios in New-Onset Type 1 Diabetes: Two-Year Clinical Trial Data‏
670 ‎‡a Author's Measuring diabetic neuropathy. Assessment and comparison of clinical examination and quantitative sensory testing‏
670 ‎‡a Author's Measuring subclinical neuropathy: does it relate to clinical neuropathy? Pittsburgh epidemiology of diabetes complications study-V‏
670 ‎‡a Author's Mother-daughter dyadic approach for starting preconception counseling at puberty in girls with diabetes‏
670 ‎‡a Author's Motor vehicle accidents and IDDM‏
670 ‎‡a Author's Multivariate analyses of the risk of insulin-dependent diabetes mellitus for siblings of insulin-dependent diabetic patients‏
670 ‎‡a Author's Need for genetic education for type 1 diabetes‏
670 ‎‡a Author's Neuronal T-cell autoreactivity is amplified in overweight children with new-onset insulin-requiring diabetes.‏
670 ‎‡a Author's Obesity, islet cell autoimmunity, and cardiovascular risk factors in youth at onset of type 1 autoimmune diabetes‏
670 ‎‡a Author's Older age of childhood type 1 diabetes onset is associated with islet autoantibody positivity >30 years later: the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Operationalizing and Examining Family Planning Vigilance in Adult Women With Type 1 Diabetes‏
670 ‎‡a Author's Parent and adolescent distribution of responsibility for diabetes self-care: links to health outcomes‏
670 ‎‡a Author's Peptide dose, MHC affinity, and target self-antigen expression are critical for effective immunotherapy of nonobese diabetic mouse prediabetes‏
670 ‎‡a Author's Persistent C-peptide levels and microvascular complications in childhood onset type 1 diabetes of long duration‏
670 ‎‡a Author's Persistent T cell anergy in human type 1 diabetes.‏
670 ‎‡a Author's Phosphate replacement during treatment of diabetic ketosis. Effects on calcium and phosphorus homeostasis‏
670 ‎‡a Author's Physical activity, insulin sensitivity, and the lipoprotein profile in young adults: the Beaver County Study‏
670 ‎‡a Author's PHYSICIANS' SELF-PERCEPTIONS OF CARE FOR EMERGING ADULTS WITH TYPE 1 DIABETES.‏
670 ‎‡a Author's Pittsburgh Epidemiology of Diabetes Complications Study. Measuring diabetic neuropathy follow-up study results‏
670 ‎‡a Author's Pittsburgh Insulin-Dependent Diabetes Mellitus Morbidity and Mortality Study: physical activity and diabetic complications‏
670 ‎‡a Author's Plasma catecholamine responses to hypoglycemia in children and adolescents with IDDM‏
670 ‎‡a Author's Plasma insulin and lipoprotein concentrations: an atherogenic association?‏
670 ‎‡a Author's Poisson regression modeling of temporal variation in incidence of childhood insulin-dependent diabetes mellitus in Allegheny County, Pennsylvania, and Wielkopolska, Poland, 1970-1985.‏
670 ‎‡a Author's Predictors of metabolic control among adolescents with diabetes: a 4-year longitudinal study‏
670 ‎‡a Author's Predictors of microalbuminuria in individuals with IDDM. Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Prevalence and incidence of clinically recognized cases of Type 1 diabetes in children and adolescents in Rwanda, Africa.‏
670 ‎‡a Author's Prevalence of complications in IDDM by sex and duration. Pittsburgh Epidemiology of Diabetes Complications Study II‏
670 ‎‡a Author's Progression to insulin-requiring diabetes in seronegative prediabetic subjects: the role of two HLA-DQ high-risk haplotypes‏
670 ‎‡a Author's Progressive erosion of β-cell function precedes the onset of hyperglycemia in the NOD mouse model of type 1 diabetes‏
670 ‎‡a Author's Progressive retinopathy with improved control in diabetic dwarfism‏
670 ‎‡a Author's Progressive retinopathy with improved control in diabetic dwarfism (Mauriac's syndrome)‏
670 ‎‡a Author's Proteinuria in children with insulin-dependent diabetes: relationship to duration of disease, metabolic control, and retinal changes‏
670 ‎‡a Author's Psychosocial correlates of glycemic control: the Pittsburgh Epidemiology of Diabetes Complications‏
670 ‎‡a Author's Psychosocial correlates of glycemic control: the Pittsburgh Epidemiology of Diabetes Complications (EDC) Study‏
670 ‎‡a Author's Psychosocial predictors of diabetes risk factors and complications: An 11-year follow-up‏
670 ‎‡a Author's Randomized efficacy trial of early preconception counseling for diabetic teens (READY-girls).‏
670 ‎‡a Author's Regional cerebral blood flow during hypoglycaemia in children with IDDM‏
670 ‎‡a Author's Regional differences in milk and complementary feeding patterns in infants participating in an international nutritional type 1 diabetes prevention trial‏
670 ‎‡a Author's Relation of parent knowledge to glycemic control among emerging adults with type 1 diabetes: a mediational model‏
670 ‎‡a Author's Relation of stressful life events to metabolic control among adolescents with diabetes: 5-year longitudinal study‏
670 ‎‡a Author's Relations of behavioral autonomy to health outcomes among emerging adults with and without type 1 diabetes‏
670 ‎‡a Author's Relationship of adiponectin and leptin with autoimmunity in children with new-onset type 1 diabetes: a pilot study‏
670 ‎‡a Author's Relationships and health among emerging adults with and without Type 1 diabetes.‏
670 ‎‡a Author's Residual beta-cell function in children with IDDM: reproducibility of testing and factors influencing insulin secretory reserve‏
670 ‎‡a Author's Rituximab, B-Lymphocyte Depletion, and Preservation of Beta-Cell Function‏
670 ‎‡a Author's Screening, staging, and naming of presymptomatic type 1 diabetes.‏
670 ‎‡a Author's Sex differences in diabetes‏
670 ‎‡a Author's Sex differences in secondary attack rate of IDDM to siblings of probands through older ages. Pittsburgh Etiology of IDDM Study‏
670 ‎‡a Author's Sex differences in the coronary heart disease risk profile: a possible role for insulin. The Beaver County Study‏
670 ‎‡a Author's Sexual dimorphism in insulin sensitivity in adolescents with insulin-dependent diabetes mellitus.‏
670 ‎‡a Author's Single Islet Autoantibody at Diagnosis of Clinical Type 1 Diabetes is Associated With Older Age and Insulin Resistance‏
670 ‎‡a Author's Sodium-lithium countertransport activity is decreased after weight loss in healthy obese men.‏
670 ‎‡a Author's Spontaneous whole blood platelet aggregation, hematological variables and complications in insulin-dependent diabetes mellitus: the Pittsburgh Epidemiology of Diabetes Complications Study‏
670 ‎‡a Author's Subclinical atherosclerosis and estimated glucose disposal rate as predictors of mortality in type 1 diabetes‏
670 ‎‡a Author's T cells of multiple sclerosis patients target a common environmental peptide that causes encephalitis in mice‏
670 ‎‡a Author's Targeting of pancreatic glia in type 1 diabetes.‏
670 ‎‡a Author's The 30-year natural history of type 1 diabetes complications: the Pittsburgh Epidemiology of Diabetes Complications Study experience‏
670 ‎‡a Author's The association between a family history of type 2 diabetes and coronary artery disease in a type 1 diabetes population‏
670 ‎‡a Author's The association of waist/hip ratio with diabetes complications in an adult IDDM population‏
670 ‎‡a Author's The cardiovascular risk profile of adolescents with insulin-dependent diabetes mellitus‏
670 ‎‡a Author's The changing course of diabetic nephropathy: low-density lipoprotein cholesterol and blood pressure correlate with regression of proteinuria.‏
670 ‎‡a Author's The Dawn Phenomenon: Comparison between Normal and Insulin-Dependent Diabetic Adolescents‏
670 ‎‡a Author's The development of Type 1‏
670 ‎‡a Author's The development of Type 1 (insulin-dependent) diabetes mellitus: two contrasting presentations‏
670 ‎‡a Author's The effect of age on insulin sensitivity and insulin secretion in first-degree relatives of type 1 diabetic patients: a population analysis‏
670 ‎‡a Author's The effect of cyproheptadine and human growth hormone on adrenocortical function in children with hypopituitarism‏
670 ‎‡a Author's The effects of water deprivation and water loading during treatment with 1-deamino-8-D-arginine vasopressin in central diabetes insipidus in childhood‏
670 ‎‡a Author's [The epidemiology and etiology of insulin dependent diabetes mellitus in the child]‏
670 ‎‡a Author's The epidemiology of diabetes complications study. IV. Correlates of diabetic background and proliferative retinopathy‏
670 ‎‡a Author's The impact of the apolipoprotein E polymorphism on the lipoprotein profile in insulin-dependent diabetes: the Pittsburgh Epidemiology of Diabetes Complications Study IX.‏
670 ‎‡a Author's The interface between epidemiology and molecular biology in the search for the causes of insulin-dependent diabetes mellitus‏
670 ‎‡a Author's The investigation of age at onset as a risk factor for mortality in persons with insulin-dependent diabetes mellitus using Cox proportional hazards models‏
670 ‎‡a Author's The natural history of diabetes complications: the Pittsburgh studies‏
670 ‎‡a Author's The Pathological Evolution of Glucose Response Curves During the Progression to Type 1 Diabetes in the TrialNet Pathway to Prevention Study‏
670 ‎‡a Author's The Pittsburgh Insulin-Dependent Diabetes Mellitus‏
670 ‎‡a Author's The Pittsburgh Insulin-Dependent Diabetes Mellitus (IDDM) Morbidity and Mortality Study: case-control analyses of risk factors for mortality‏
670 ‎‡a Author's The Pittsburgh insulin-dependent diabetes mellitus (IDDM) morbidity and mortality study. Mortality results‏
670 ‎‡a Author's The Pittsburgh Insulin-Dependent Diabetes Mellitus (IDDM) study. HLA antigens and haplotypes as risk factors for the development of IDDM in IDDM patients and their siblings‏
670 ‎‡a Author's The progression of retinopathy over 2 years: the Pittsburgh Epidemiology of Diabetes Complications‏
670 ‎‡a Author's The progression of retinopathy over 2 years: the Pittsburgh Epidemiology of Diabetes Complications (EDC) Study‏
670 ‎‡a Author's The Role of Age and Excess Body Mass Index in Progression to Type 1 Diabetes in At-Risk Adults‏
670 ‎‡a Author's The role of friendship in the lives of male and female adolescents: does diabetes make a difference?‏
670 ‎‡a Author's The shape of the glucose concentration curve during an oral glucose tolerance test predicts risk for type 1 diabetes‏
670 ‎‡a Author's The TRIGR Trial: Testing the Potential Link between Weaning Diet and Type 1 Diabetes‏
670 ‎‡a Author's Therapeutic controversy: prevention and treatment of diabetes in children‏
670 ‎‡a Author's Thyroid autoimmunity in children with features of both type 1 and type 2 diabetes.‏
670 ‎‡a Author's Transfer from pediatric to adult health care: effects on diabetes outcomes.‏
670 ‎‡a Author's Trials without placebo controls in pre-IDDM: a complex and difficult issue‏
670 ‎‡a Author's Type 1 diabetes intervention trials‏
670 ‎‡a Author's Type I diabetes and multiple sclerosis patients target islet plus central nervous system autoantigens; nonimmunized nonobese diabetic mice can develop autoimmune encephalitis.‏
670 ‎‡a Author's Unmitigated communion and health among adolescents with and without diabetes: the mediating role of eating disturbances‏
670 ‎‡a Author's Use of vitamin D supplements during infancy in an international feeding trial‏
909 ‎‡a (orcid) 000000021311351x‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000186323633‏ ‎‡9 1‏
919 ‎‡a combinedanalysisofgad65andica512‏ ‎‡A Combined analysis of GAD65 and ICA512‏ ‎‡9 1‏
919 ‎‡a cognitiveadaptationtheoryasapredictorofadjustmenttoemergingadulthoodforyouthwithandwithouttype1diabetes‏ ‎‡A Cognitive adaptation theory as a predictor of adjustment to emerging adulthood for youth with and without type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a breastfeedingpatternsofmotherswithtype1diabetesresultsfromaninfantfeedingtrial‏ ‎‡A Breastfeeding patterns of mothers with type 1 diabetes: results from an infant feeding trial‏ ‎‡9 1‏
919 ‎‡a useofvitamin500supplementsduringinfancyinaninternationalfeedingtrial‏ ‎‡A Use of vitamin D supplements during infancy in an international feeding trial‏ ‎‡9 1‏
919 ‎‡a unmitigatedcommunionandhealthamongadolescentswithandwithoutdiabetesthemediatingroleofeatingdisturbances‏ ‎‡A Unmitigated communion and health among adolescents with and without diabetes: the mediating role of eating disturbances‏ ‎‡9 1‏
919 ‎‡a briefreporttrajectoriesofglycemiccontroloverearlytomiddleadolescence‏ ‎‡A Brief report: trajectories of glycemic control over early to middle adolescence‏ ‎‡9 1‏
919 ‎‡a canmanagementstrategiesalterthecourseofdiabeticnephropathy‏ ‎‡A Can management strategies alter the course of diabetic nephropathy?‏ ‎‡9 1‏
919 ‎‡a type1diabetesandmultiplesclerosispatientstargetisletpluscentralnervoussystemautoantigensnonimmunizednonobesediabeticmicecandevelopautoimmuneencephalitis‏ ‎‡A Type I diabetes and multiple sclerosis patients target islet plus central nervous system autoantigens; nonimmunized nonobese diabetic mice can develop autoimmune encephalitis.‏ ‎‡9 1‏
919 ‎‡a type1diabetesinterventiontrials‏ ‎‡A Type 1 diabetes intervention trials‏ ‎‡9 1‏
919 ‎‡a cardiovasculardiseaseandarterialcalcificationininsulindependentdiabetesmellitusinterrelationsandriskfactorprofilespittsburghepidemiologyofdiabetescomplicationsstudy5‏ ‎‡A Cardiovascular disease and arterial calcification in insulin-dependent diabetes mellitus: interrelations and risk factor profiles. Pittsburgh Epidemiology of Diabetes Complications Study-V‏ ‎‡9 1‏
919 ‎‡a trialswithoutplacebocontrolsinpreiddmacomplexanddifficultissue‏ ‎‡A Trials without placebo controls in pre-IDDM: a complex and difficult issue‏ ‎‡9 1‏
919 ‎‡a transferfrompediatrictoadulthealthcareeffectsondiabetesoutcomes‏ ‎‡A Transfer from pediatric to adult health care: effects on diabetes outcomes.‏ ‎‡9 1‏
919 ‎‡a thyroidautoimmunityinchildrenwithfeaturesofbothtype1andtype2diabetes‏ ‎‡A Thyroid autoimmunity in children with features of both type 1 and type 2 diabetes.‏ ‎‡9 1‏
919 ‎‡a causespecificmortalitytrendsinalargepopulationbasedcohortwithlongstandingchildhoodonsettype1diabetes‏ ‎‡A Cause-specific mortality trends in a large population-based cohort with long-standing childhood-onset type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a therapeuticcontroversypreventionandtreatmentofdiabetesinchildren‏ ‎‡A Therapeutic controversy: prevention and treatment of diabetes in children‏ ‎‡9 1‏
919 ‎‡a trigrtrialtestingthepotentiallinkbetweenweaningdietandtype1diabetes‏ ‎‡A The TRIGR Trial: Testing the Potential Link between Weaning Diet and Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a shapeoftheglucoseconcentrationcurveduringanoralglucosetolerancetestpredictsriskfortype1diabetes‏ ‎‡A The shape of the glucose concentration curve during an oral glucose tolerance test predicts risk for type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a roleoffriendshipinthelivesofmaleandfemaleadolescentsdoesdiabetesmakeadifference‏ ‎‡A The role of friendship in the lives of male and female adolescents: does diabetes make a difference?‏ ‎‡9 1‏
919 ‎‡a roleofageandexcessbodymassindexinprogressiontotype1diabetesinatriskadults‏ ‎‡A The Role of Age and Excess Body Mass Index in Progression to Type 1 Diabetes in At-Risk Adults‏ ‎‡9 1‏
919 ‎‡a progressionofretinopathyover2yearsthepittsburghepidemiologyofdiabetescomplicationsedcstudy‏ ‎‡A The progression of retinopathy over 2 years: the Pittsburgh Epidemiology of Diabetes Complications (EDC) Study‏ ‎‡9 1‏
919 ‎‡a progressionofretinopathyover2yearsthepittsburghepidemiologyofdiabetescomplications‏ ‎‡A The progression of retinopathy over 2 years: the Pittsburgh Epidemiology of Diabetes Complications‏ ‎‡9 1‏
919 ‎‡a pittsburghinsulindependentdiabetesmellitusiddmstudyhlaantigensandhaplotypesasriskfactorsforthedevelopmentofiddminiddmpatientsandtheirsiblings‏ ‎‡A The Pittsburgh Insulin-Dependent Diabetes Mellitus (IDDM) study. HLA antigens and haplotypes as risk factors for the development of IDDM in IDDM patients and their siblings‏ ‎‡9 1‏
919 ‎‡a pittsburghinsulindependentdiabetesmellitusiddmmorbidityandmortalitystudymortalityresults‏ ‎‡A The Pittsburgh insulin-dependent diabetes mellitus (IDDM) morbidity and mortality study. Mortality results‏ ‎‡9 1‏
919 ‎‡a pittsburghinsulindependentdiabetesmellitusiddmmorbidityandmortalitystudycasecontrolanalysesofriskfactorsformortality‏ ‎‡A The Pittsburgh Insulin-Dependent Diabetes Mellitus (IDDM) Morbidity and Mortality Study: case-control analyses of risk factors for mortality‏ ‎‡9 1‏
919 ‎‡a pittsburghinsulindependentdiabetesmellitus‏ ‎‡A The Pittsburgh Insulin-Dependent Diabetes Mellitus‏ ‎‡9 1‏
919 ‎‡a pathologicalevolutionofglucoseresponsecurvesduringtheprogressiontotype1diabetesinthetrialnetpathwaytopreventionstudy‏ ‎‡A The Pathological Evolution of Glucose Response Curves During the Progression to Type 1 Diabetes in the TrialNet Pathway to Prevention Study‏ ‎‡9 1‏
919 ‎‡a celiacautoimmunityisassociatedwithlowerbloodpressureandrenalriskintype1diabetes‏ ‎‡A Celiac Autoimmunity Is Associated With Lower Blood Pressure and Renal Risk in Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a naturalhistoryofdiabetescomplicationsthepittsburghstudies‏ ‎‡A The natural history of diabetes complications: the Pittsburgh studies‏ ‎‡9 1‏
919 ‎‡a investigationofageatonsetasariskfactorformortalityinpersonswithinsulindependentdiabetesmellitususingcoxproportionalhazardsmodels‏ ‎‡A The investigation of age at onset as a risk factor for mortality in persons with insulin-dependent diabetes mellitus using Cox proportional hazards models‏ ‎‡9 1‏
919 ‎‡a interfacebetweenepidemiologyandmolecularbiologyinthesearchforthecausesofinsulindependentdiabetesmellitus‏ ‎‡A The interface between epidemiology and molecular biology in the search for the causes of insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a impactoftheapolipoproteinepolymorphismonthelipoproteinprofileininsulindependentdiabetesthepittsburghepidemiologyofdiabetescomplicationsstudy9‏ ‎‡A The impact of the apolipoprotein E polymorphism on the lipoprotein profile in insulin-dependent diabetes: the Pittsburgh Epidemiology of Diabetes Complications Study IX.‏ ‎‡9 1‏
919 ‎‡a epidemiologyofdiabetescomplicationsstudy4correlatesofdiabeticbackgroundandproliferativeretinopathy‏ ‎‡A The epidemiology of diabetes complications study. IV. Correlates of diabetic background and proliferative retinopathy‏ ‎‡9 1‏
919 ‎‡a epidemiologyandetiologyofinsulindependentdiabetesmellitusinthechild‏ ‎‡A [The epidemiology and etiology of insulin dependent diabetes mellitus in the child]‏ ‎‡9 1‏
919 ‎‡a effectsofwaterdeprivationandwaterloadingduringtreatmentwith1deamino8500argininevasopressinincentraldiabetesinsipidusinchildhood‏ ‎‡A The effects of water deprivation and water loading during treatment with 1-deamino-8-D-arginine vasopressin in central diabetes insipidus in childhood‏ ‎‡9 1‏
919 ‎‡a effectofcyproheptadineandhumangrowthhormoneonadrenocorticalfunctioninchildrenwithhypopituitarism‏ ‎‡A The effect of cyproheptadine and human growth hormone on adrenocortical function in children with hypopituitarism‏ ‎‡9 1‏
919 ‎‡a effectofageoninsulinsensitivityandinsulinsecretionin1degreerelativesoftype1diabeticpatientsapopulationanalysis‏ ‎‡A The effect of age on insulin sensitivity and insulin secretion in first-degree relatives of type 1 diabetic patients: a population analysis‏ ‎‡9 1‏
919 ‎‡a developmentoftype1insulindependentdiabetesmellitus2contrastingpresentations‏ ‎‡A The development of Type 1 (insulin-dependent) diabetes mellitus: two contrasting presentations‏ ‎‡9 1‏
919 ‎‡a developmentoftype1‏ ‎‡A The development of Type 1‏ ‎‡9 1‏
919 ‎‡a dawnphenomenoncomparisonbetweennormalandinsulindependentdiabeticadolescents‏ ‎‡A The Dawn Phenomenon: Comparison between Normal and Insulin-Dependent Diabetic Adolescents‏ ‎‡9 1‏
919 ‎‡a changingcourseofdiabeticnephropathylowdensitylipoproteincholesterolandbloodpressurecorrelatewithregressionofproteinuria‏ ‎‡A The changing course of diabetic nephropathy: low-density lipoprotein cholesterol and blood pressure correlate with regression of proteinuria.‏ ‎‡9 1‏
919 ‎‡a cardiovascularriskprofileofadolescentswithinsulindependentdiabetesmellitus‏ ‎‡A The cardiovascular risk profile of adolescents with insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a associationofwaisthipratiowithdiabetescomplicationsinanadultiddmpopulation‏ ‎‡A The association of waist/hip ratio with diabetes complications in an adult IDDM population‏ ‎‡9 1‏
919 ‎‡a associationbetweenafamilyhistoryoftype2diabetesandcoronaryarterydiseaseinatype1diabetespopulation‏ ‎‡A The association between a family history of type 2 diabetes and coronary artery disease in a type 1 diabetes population‏ ‎‡9 1‏
919 ‎‡a 30yearnaturalhistoryoftype1diabetescomplicationsthepittsburghepidemiologyofdiabetescomplicationsstudyexperience‏ ‎‡A The 30-year natural history of type 1 diabetes complications: the Pittsburgh Epidemiology of Diabetes Complications Study experience‏ ‎‡9 1‏
919 ‎‡a targetingofpancreaticgliaintype1diabetes‏ ‎‡A Targeting of pancreatic glia in type 1 diabetes.‏ ‎‡9 1‏
919 ‎‡a tcellsofmultiplesclerosispatientstargetacommonenvironmentalpeptidethatcausesencephalitisinmice‏ ‎‡A T cells of multiple sclerosis patients target a common environmental peptide that causes encephalitis in mice‏ ‎‡9 1‏
919 ‎‡a subclinicalatherosclerosisandestimatedglucosedisposalrateaspredictorsofmortalityintype1diabetes‏ ‎‡A Subclinical atherosclerosis and estimated glucose disposal rate as predictors of mortality in type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a spontaneouswholebloodplateletaggregationhematologicalvariablesandcomplicationsininsulindependentdiabetesmellitusthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Spontaneous whole blood platelet aggregation, hematological variables and complications in insulin-dependent diabetes mellitus: the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a sodiumlithiumcountertransportactivityisdecreasedafterweightlossinhealthyobesemen‏ ‎‡A Sodium-lithium countertransport activity is decreased after weight loss in healthy obese men.‏ ‎‡9 1‏
919 ‎‡a singleisletautoantibodyatdiagnosisofclinicaltype1diabetesisassociatedwitholderageandinsulinresistance‏ ‎‡A Single Islet Autoantibody at Diagnosis of Clinical Type 1 Diabetes is Associated With Older Age and Insulin Resistance‏ ‎‡9 1‏
919 ‎‡a sexualdimorphismininsulinsensitivityinadolescentswithinsulindependentdiabetesmellitus‏ ‎‡A Sexual dimorphism in insulin sensitivity in adolescents with insulin-dependent diabetes mellitus.‏ ‎‡9 1‏
919 ‎‡a sexdifferencesinthecoronaryheartdiseaseriskprofileapossibleroleforinsulinthebeavercountystudy‏ ‎‡A Sex differences in the coronary heart disease risk profile: a possible role for insulin. The Beaver County Study‏ ‎‡9 1‏
919 ‎‡a sexdifferencesinsecondaryattackrateofiddmtosiblingsofprobandsthrougholderagespittsburghetiologyofiddmstudy‏ ‎‡A Sex differences in secondary attack rate of IDDM to siblings of probands through older ages. Pittsburgh Etiology of IDDM Study‏ ‎‡9 1‏
919 ‎‡a sexdifferencesindiabetes‏ ‎‡A Sex differences in diabetes‏ ‎‡9 1‏
919 ‎‡a screeningstagingandnamingofpresymptomatictype1diabetes‏ ‎‡A Screening, staging, and naming of presymptomatic type 1 diabetes.‏ ‎‡9 1‏
919 ‎‡a rituximabblymphocytedepletionandpreservationofbetacellfunction‏ ‎‡A Rituximab, B-Lymphocyte Depletion, and Preservation of Beta-Cell Function‏ ‎‡9 1‏
919 ‎‡a residualbetacellfunctioninchildrenwithiddmreproducibilityoftestingandfactorsinfluencinginsulinsecretoryreserve‏ ‎‡A Residual beta-cell function in children with IDDM: reproducibility of testing and factors influencing insulin secretory reserve‏ ‎‡9 1‏
919 ‎‡a relationshipsandhealthamongemergingadultswithandwithouttype1diabetes‏ ‎‡A Relationships and health among emerging adults with and without Type 1 diabetes.‏ ‎‡9 1‏
919 ‎‡a relationshipofadiponectinandleptinwithautoimmunityinchildrenwithnewonsettype1diabetesapilotstudy‏ ‎‡A Relationship of adiponectin and leptin with autoimmunity in children with new-onset type 1 diabetes: a pilot study‏ ‎‡9 1‏
919 ‎‡a relationsofbehavioralautonomytohealthoutcomesamongemergingadultswithandwithouttype1diabetes‏ ‎‡A Relations of behavioral autonomy to health outcomes among emerging adults with and without type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a relationofstressfullifeeventstometaboliccontrolamongadolescentswithdiabetes5yearlongitudinalstudy‏ ‎‡A Relation of stressful life events to metabolic control among adolescents with diabetes: 5-year longitudinal study‏ ‎‡9 1‏
919 ‎‡a relationofparentknowledgetoglycemiccontrolamongemergingadultswithtype1diabetesamediationalmodel‏ ‎‡A Relation of parent knowledge to glycemic control among emerging adults with type 1 diabetes: a mediational model‏ ‎‡9 1‏
919 ‎‡a regionaldifferencesinmilkandcomplementaryfeedingpatternsininfantsparticipatinginaninternationalnutritionaltype1diabetespreventiontrial‏ ‎‡A Regional differences in milk and complementary feeding patterns in infants participating in an international nutritional type 1 diabetes prevention trial‏ ‎‡9 1‏
919 ‎‡a regionalcerebralbloodflowduringhypoglycaemiainchildrenwithiddm‏ ‎‡A Regional cerebral blood flow during hypoglycaemia in children with IDDM‏ ‎‡9 1‏
919 ‎‡a randomizedefficacytrialofearlypreconceptioncounselingfordiabeticteensreadygirls‏ ‎‡A Randomized efficacy trial of early preconception counseling for diabetic teens (READY-girls).‏ ‎‡9 1‏
919 ‎‡a psychosocialpredictorsofdiabetesriskfactorsandcomplicationsan11yearfollowup‏ ‎‡A Psychosocial predictors of diabetes risk factors and complications: An 11-year follow-up‏ ‎‡9 1‏
919 ‎‡a psychosocialcorrelatesofglycemiccontrolthepittsburghepidemiologyofdiabetescomplicationsedcstudy‏ ‎‡A Psychosocial correlates of glycemic control: the Pittsburgh Epidemiology of Diabetes Complications (EDC) Study‏ ‎‡9 1‏
919 ‎‡a psychosocialcorrelatesofglycemiccontrolthepittsburghepidemiologyofdiabetescomplications‏ ‎‡A Psychosocial correlates of glycemic control: the Pittsburgh Epidemiology of Diabetes Complications‏ ‎‡9 1‏
919 ‎‡a proteinuriainchildrenwithinsulindependentdiabetesrelationshiptodurationofdiseasemetaboliccontrolandretinalchanges‏ ‎‡A Proteinuria in children with insulin-dependent diabetes: relationship to duration of disease, metabolic control, and retinal changes‏ ‎‡9 1‏
919 ‎‡a progressiveretinopathywithimprovedcontrolindiabeticdwarfismmauriacssyndrome‏ ‎‡A Progressive retinopathy with improved control in diabetic dwarfism (Mauriac's syndrome)‏ ‎‡9 1‏
919 ‎‡a progressiveretinopathywithimprovedcontrolindiabeticdwarfism‏ ‎‡A Progressive retinopathy with improved control in diabetic dwarfism‏ ‎‡9 1‏
919 ‎‡a progressiveerosionofβcellfunctionprecedestheonsetofhyperglycemiainthenodmousemodeloftype1diabetes‏ ‎‡A Progressive erosion of β-cell function precedes the onset of hyperglycemia in the NOD mouse model of type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a progressiontoinsulinrequiringdiabetesinseronegativeprediabeticsubjectstheroleof2hladqhighriskhaplotypes‏ ‎‡A Progression to insulin-requiring diabetes in seronegative prediabetic subjects: the role of two HLA-DQ high-risk haplotypes‏ ‎‡9 1‏
919 ‎‡a prevalenceofcomplicationsiniddmbysexanddurationpittsburghepidemiologyofdiabetescomplicationsstudy2‏ ‎‡A Prevalence of complications in IDDM by sex and duration. Pittsburgh Epidemiology of Diabetes Complications Study II‏ ‎‡9 1‏
919 ‎‡a prevalenceandincidenceofclinicallyrecognizedcasesoftype1diabetesinchildrenandadolescentsinrwandaafrica‏ ‎‡A Prevalence and incidence of clinically recognized cases of Type 1 diabetes in children and adolescents in Rwanda, Africa.‏ ‎‡9 1‏
919 ‎‡a predictorsofmicroalbuminuriainindividualswithiddmpittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Predictors of microalbuminuria in individuals with IDDM. Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a predictorsofmetaboliccontrolamongadolescentswithdiabetesa4yearlongitudinalstudy‏ ‎‡A Predictors of metabolic control among adolescents with diabetes: a 4-year longitudinal study‏ ‎‡9 1‏
919 ‎‡a coexistenceoftype1andtype2diabetesmellitusdoublediabetes‏ ‎‡A Coexistence of type 1 and type 2 diabetes mellitus: "double" diabetes?‏ ‎‡9 1‏
919 ‎‡a changesinglycaemiccontrolandriskofcoronaryarterydiseaseintype1diabetesmellitusfindingsfromthepittsburghepidemiologyofdiabetescomplicationsstudyedc‏ ‎‡A Changes in glycaemic control and risk of coronary artery disease in type 1 diabetes mellitus: findings from the Pittsburgh Epidemiology of Diabetes Complications Study (EDC).‏ ‎‡9 1‏
919 ‎‡a costimulationmodulationwithabataceptinpatientswithrecentonsettype1diabetesarandomiseddoubleblindplacebocontrolledtrial‏ ‎‡A Co-stimulation modulation with abatacept in patients with recent-onset type 1 diabetes: a randomised, double-blind, placebo-controlled trial‏ ‎‡9 1‏
919 ‎‡a poissonregressionmodelingoftemporalvariationinincidenceofchildhoodinsulindependentdiabetesmellitusinalleghenycountypennsylvaniaandwielkopolskapoland1970‏ ‎‡A Poisson regression modeling of temporal variation in incidence of childhood insulin-dependent diabetes mellitus in Allegheny County, Pennsylvania, and Wielkopolska, Poland, 1970-1985.‏ ‎‡9 1‏
919 ‎‡a plasmainsulinandlipoproteinconcentrationsanatherogenicassociation‏ ‎‡A Plasma insulin and lipoprotein concentrations: an atherogenic association?‏ ‎‡9 1‏
919 ‎‡a plasmacatecholamineresponsestohypoglycemiainchildrenandadolescentswithiddm‏ ‎‡A Plasma catecholamine responses to hypoglycemia in children and adolescents with IDDM‏ ‎‡9 1‏
919 ‎‡a pittsburghinsulindependentdiabetesmellitusmorbidityandmortalitystudyphysicalactivityanddiabeticcomplications‏ ‎‡A Pittsburgh Insulin-Dependent Diabetes Mellitus Morbidity and Mortality Study: physical activity and diabetic complications‏ ‎‡9 1‏
919 ‎‡a pittsburghepidemiologyofdiabetescomplicationsstudymeasuringdiabeticneuropathyfollowupstudyresults‏ ‎‡A Pittsburgh Epidemiology of Diabetes Complications Study. Measuring diabetic neuropathy follow-up study results‏ ‎‡9 1‏
919 ‎‡a physiciansselfperceptionsofcareforemergingadultswithtype1diabetes‏ ‎‡A PHYSICIANS' SELF-PERCEPTIONS OF CARE FOR EMERGING ADULTS WITH TYPE 1 DIABETES.‏ ‎‡9 1‏
919 ‎‡a physicalactivityinsulinsensitivityandthelipoproteinprofileinyoungadultsthebeavercountystudy‏ ‎‡A Physical activity, insulin sensitivity, and the lipoprotein profile in young adults: the Beaver County Study‏ ‎‡9 1‏
919 ‎‡a phosphatereplacementduringtreatmentofdiabeticketosiseffectsoncalciumandphosphorushomeostasis‏ ‎‡A Phosphate replacement during treatment of diabetic ketosis. Effects on calcium and phosphorus homeostasis‏ ‎‡9 1‏
919 ‎‡a persistenttcellanergyinhumantype1diabetes‏ ‎‡A Persistent T cell anergy in human type 1 diabetes.‏ ‎‡9 1‏
919 ‎‡a persistent100peptidelevelsandmicrovascularcomplicationsinchildhoodonsettype1diabetesoflongduration‏ ‎‡A Persistent C-peptide levels and microvascular complications in childhood onset type 1 diabetes of long duration‏ ‎‡9 1‏
919 ‎‡a peptidedosemhcaffinityandtargetselfantigenexpressionarecriticalforeffectiveimmunotherapyofnonobesediabeticmouseprediabetes‏ ‎‡A Peptide dose, MHC affinity, and target self-antigen expression are critical for effective immunotherapy of nonobese diabetic mouse prediabetes‏ ‎‡9 1‏
919 ‎‡a parentandadolescentdistributionofresponsibilityfordiabetesselfcarelinkstohealthoutcomes‏ ‎‡A Parent and adolescent distribution of responsibility for diabetes self-care: links to health outcomes‏ ‎‡9 1‏
919 ‎‡a operationalizingandexaminingfamilyplanningvigilanceinadultwomenwithtype1diabetes‏ ‎‡A Operationalizing and Examining Family Planning Vigilance in Adult Women With Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a olderageofchildhoodtype1diabetesonsetisassociatedwithisletautoantibodypositivity30yearslaterthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Older age of childhood type 1 diabetes onset is associated with islet autoantibody positivity >30 years later: the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a obesityisletcellautoimmunityandcardiovascularriskfactorsinyouthatonsetoftype1autoimmunediabetes‏ ‎‡A Obesity, islet cell autoimmunity, and cardiovascular risk factors in youth at onset of type 1 autoimmune diabetes‏ ‎‡9 1‏
919 ‎‡a neuronaltcellautoreactivityisamplifiedinoverweightchildrenwithnewonsetinsulinrequiringdiabetes‏ ‎‡A Neuronal T-cell autoreactivity is amplified in overweight children with new-onset insulin-requiring diabetes.‏ ‎‡9 1‏
919 ‎‡a needforgeneticeducationfortype1diabetes‏ ‎‡A Need for genetic education for type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a multivariateanalysesoftheriskofinsulindependentdiabetesmellitusforsiblingsofinsulindependentdiabeticpatients‏ ‎‡A Multivariate analyses of the risk of insulin-dependent diabetes mellitus for siblings of insulin-dependent diabetic patients‏ ‎‡9 1‏
919 ‎‡a motorvehicleaccidentsandiddm‏ ‎‡A Motor vehicle accidents and IDDM‏ ‎‡9 1‏
919 ‎‡a motherdaughterdyadicapproachforstartingpreconceptioncounselingatpubertyingirlswithdiabetes‏ ‎‡A Mother-daughter dyadic approach for starting preconception counseling at puberty in girls with diabetes‏ ‎‡9 1‏
919 ‎‡a measuringsubclinicalneuropathydoesitrelatetoclinicalneuropathypittsburghepidemiologyofdiabetescomplicationsstudy5‏ ‎‡A Measuring subclinical neuropathy: does it relate to clinical neuropathy? Pittsburgh epidemiology of diabetes complications study-V‏ ‎‡9 1‏
919 ‎‡a measuringdiabeticneuropathyassessmentandcomparisonofclinicalexaminationandquantitativesensorytesting‏ ‎‡A Measuring diabetic neuropathy. Assessment and comparison of clinical examination and quantitative sensory testing‏ ‎‡9 1‏
919 ‎‡a changingimpactofmodifiableriskfactorsontheincidenceofmajoroutcomesoftype1diabetesthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Changing impact of modifiable risk factors on the incidence of major outcomes of type 1 diabetes: the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a lowdoseantithymocyteglobulinpreserves100peptidereduceshba1candincreasesregulatorytoconventionaltcellratiosinnewonsettype1diabetes2yearclinicaltrialdata‏ ‎‡A Low-Dose Anti-Thymocyte Globulin Preserves C-Peptide, Reduces HbA1c, and Increases Regulatory to Conventional T-Cell Ratios in New-Onset Type 1 Diabetes: Two-Year Clinical Trial Data‏ ‎‡9 1‏
919 ‎‡a lowdoseantithymocyteglobulinatgpreservesβcellfunctionandimproveshbainnewonsettype1diabetes‏ ‎‡A Low-Dose Anti-Thymocyte Globulin (ATG) Preserves β-Cell Function and Improves HbA in New-Onset Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a lowdoseantithymocyteglobulin‏ ‎‡A Low-Dose Anti-Thymocyte Globulin‏ ‎‡9 1‏
919 ‎‡a longtermeffectsoftheboosterenhancedreadygirlspreconceptioncounselingprogramonintentionsandbehaviorsforfamilyplanninginteenswithdiabetes‏ ‎‡A Long-term effects of the booster-enhanced READY-Girls preconception counseling program on intentions and behaviors for family planning in teens with diabetes‏ ‎‡9 1‏
919 ‎‡a lipoproteinaconcentrationshowslittlerelationshiptoiddmcomplicationsinthepittsburghepidemiologyofdiabetescomplicationsstudycohort‏ ‎‡A Lipoprotein(a) concentration shows little relationship to IDDM complications in the Pittsburgh Epidemiology of Diabetes Complications Study cohort‏ ‎‡9 1‏
919 ‎‡a lipidandbloodpressuretreatmentgoalsfortype1diabetes10yearincidencedatafromthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Lipid and blood pressure treatment goals for type 1 diabetes: 10-year incidence data from the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a leptinbeforeandafterinsulintherapyinchildrenwithnewonsettype1diabetes‏ ‎‡A Leptin before and after insulin therapy in children with new-onset type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a largescaleprospectivetcellfunctionassaysinshippedunfrozenbloodsamplesexperiencesfromthemulticentertrigrtrial‏ ‎‡A Large-scale prospective T cell function assays in shipped, unfrozen blood samples: experiences from the multicenter TRIGR trial‏ ‎‡9 1‏
919 ‎‡a knowledgeattitudesandbehaviorsrelatedtosexualityandfamilyplanninginadolescentwomenwithandwithoutdiabetes‏ ‎‡A Knowledge, attitudes and behaviors related to sexuality and family planning in adolescent women with and without diabetes‏ ‎‡9 1‏
919 ‎‡a ispadclinicalpracticeconsensusguidelines2018managementofcysticfibrosisrelateddiabetesinchildrenandadolescents‏ ‎‡A ISPAD Clinical Practice Consensus Guidelines 2018: Management of cystic fibrosis-related diabetes in children and adolescents‏ ‎‡9 1‏
919 ‎‡a ispadclinicalpracticeconsensusguidelines2014managementofcysticfibrosisrelateddiabetesinchildrenandadolescents‏ ‎‡A ISPAD Clinical Practice Consensus Guidelines 2014. Management of cystic fibrosis-related diabetes in children and adolescents‏ ‎‡9 1‏
919 ‎‡a introducingtheendotypeconcepttoaddressthechallengeofdiseaseheterogeneityintype1diabetes‏ ‎‡A Introducing the Endotype Concept to Address the Challenge of Disease Heterogeneity in Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a interleukin1antagonismintype1diabetesofrecentonset2multicentrerandomiseddoubleblindplacebocontrolledtrials‏ ‎‡A Interleukin-1 antagonism in type 1 diabetes of recent onset: two multicentre, randomised, double-blind, placebo-controlled trials‏ ‎‡9 1‏
919 ‎‡a intensivediabetestherapyinchildhoodisitachievableisitdesirableisitsafe‏ ‎‡A Intensive diabetes therapy in childhood: is it achievable? Is it desirable? Is it safe?‏ ‎‡9 1‏
919 ‎‡a insulinresistancerelatedfactorsbutnotglycemiapredictcoronaryarterydiseaseintype1diabetes10yearfollowupdatafromthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Insulin resistance-related factors, but not glycemia, predict coronary artery disease in type 1 diabetes: 10-year follow-up data from the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a insulindependentdiabetesmellitusphysicalactivityanddeath‏ ‎‡A Insulin-dependent diabetes mellitus, physical activity, and death‏ ‎‡9 1‏
919 ‎‡a insulindependentdiabetesmellitusmortalitytheriskofcigarettesmoking‏ ‎‡A Insulin-dependent diabetes mellitus mortality. The risk of cigarette smoking‏ ‎‡9 1‏
919 ‎‡a insulinasapredictorofcoronaryheartdiseaseinteractionwithapolipoproteinephenotypeareportfromthemultipleriskfactorinterventiontrial‏ ‎‡A Insulin as a predictor of coronary heart disease: interaction with apolipoprotein E phenotype. A report from the Multiple Risk Factor Intervention Trial‏ ‎‡9 1‏
919 ‎‡a infantfeedingandtimingofcomplementaryfoodsinthedevelopmentoftype1diabetes‏ ‎‡A Infant Feeding and Timing of Complementary Foods in the Development of Type 1 Diabetes.‏ ‎‡9 1‏
919 ‎‡a infantfeedingandautoimmunediabetes‏ ‎‡A Infant feeding and autoimmune diabetes.‏ ‎‡9 1‏
919 ‎‡a increasedexpressionofmonocytecd11bmac1inoverweightrecentonsettype1diabeticchildren‏ ‎‡A Increased Expression of Monocyte CD11b (Mac-1) in Overweight Recent-Onset Type 1 Diabetic Children‏ ‎‡9 1‏
919 ‎‡a incidenceofesrdandsurvivalafterrenalreplacementtherapyinpatientswithtype1diabetesareportfromthealleghenycountyregistry‏ ‎‡A Incidence of ESRD and survival after renal replacement therapy in patients with type 1 diabetes: a report from the Allegheny County Registry‏ ‎‡9 1‏
919 ‎‡a impairedcounterregulatoryhormoneresponsestohypoglycemiainchildrenandadolescentswithnewonsetiddm‏ ‎‡A Impaired counterregulatory hormone responses to hypoglycemia in children and adolescents with new onset IDDM‏ ‎‡9 1‏
919 ‎‡a impactofageandantibodytypeonprogressionfromsingletomultipleautoantibodiesintype1diabetesrelatives‏ ‎‡A Impact of Age and Antibody Type on Progression From Single to Multiple Autoantibodies in Type 1 Diabetes Relatives‏ ‎‡9 1‏
919 ‎‡a impactofapreconceptioncounselingprogramforteenswithtype1diabetesreadygirlsonpatientproviderinteractionresourceutilizationandcost‏ ‎‡A Impact of a preconception counseling program for teens with type 1 diabetes (READY-Girls) on patient-provider interaction, resource utilization, and cost‏ ‎‡9 1‏
919 ‎‡a hypoplasiaofthepancreasinapatientwithtype1diabetesmellitus‏ ‎‡A Hypoplasia of the pancreas in a patient with type I diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a hypoglycemiaacomplicationofdiabetestherapyinchildren‏ ‎‡A Hypoglycemia: a complication of diabetes therapy in children‏ ‎‡9 1‏
919 ‎‡a hypertensionasariskfactorfordiabeticneuropathyaprospectivestudy‏ ‎‡A Hypertension as a risk factor for diabetic neuropathy: a prospective study‏ ‎‡9 1‏
919 ‎‡a hydrolyzedinfantformulaandearlyβcellautoimmunityarandomizedclinicaltrial‏ ‎‡A Hydrolyzed infant formula and early β-cell autoimmunity: a randomized clinical trial‏ ‎‡9 1‏
919 ‎‡a humoralautoimmunityagainsttheextracellulardomainoftheneuroendocrineautoantigenia2heightenstheriskoftype1diabetes‏ ‎‡A Humoral autoimmunity against the extracellular domain of the neuroendocrine autoantigen IA-2 heightens the risk of type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a humaninsulinuseandhypoglycaemiainsightsfromthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Human insulin use and hypoglycaemia: insights from the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a hormonalmetabolicandneuroradiologicabnormalitiesassociatedwithseptoopticdysplasia‏ ‎‡A Hormonal, metabolic, and neuroradiologic abnormalities associated with septo-optic dysplasia‏ ‎‡9 1‏
919 ‎‡a hlaheterogeneityofinsulindependentdiabetesmellitusatdiagnosisthepittsburghiddmstudy‏ ‎‡A HLA heterogeneity of insulin-dependent diabetes mellitus at diagnosis. The Pittsburgh IDDM study‏ ‎‡9 1‏
919 ‎‡a hladrb11501dqa10102dqb10602haplotypeprotectsautoantibodypositiverelativesfromtype1diabetesthroughoutthestagesofdiseaseprogression‏ ‎‡A HLA-DRB1*15:01-DQA1*01:02-DQB1*06:02 Haplotype Protects Autoantibody-Positive Relatives From Type 1 Diabetes Throughout the Stages of Disease Progression‏ ‎‡9 1‏
919 ‎‡a heightatdiagnosisofinsulindependentdiabetesinpatientsandtheirnondiabeticfamilymembers‏ ‎‡A Height at diagnosis of insulin dependent diabetes in patients and their non-diabetic family members‏ ‎‡9 1‏
919 ‎‡a healthlifeandautomobileinsurancecharacteristicsinadultswithiddm‏ ‎‡A Health, life, and automobile insurance characteristics in adults with IDDM.‏ ‎‡9 1‏
919 ‎‡a healthinsuranceandthefinancialimpactofiddminfamilieswithachildwithiddm‏ ‎‡A Health insurance and the financial impact of IDDM in families with a child with IDDM.‏ ‎‡9 1‏
919 ‎‡a growthhormonetherapyforpatientswithturnerssyndrome‏ ‎‡A Growth hormone therapy for patients with Turner's syndrome‏ ‎‡9 1‏
919 ‎‡a growthhormonetherapyandtumorrecurrencefindingsinchildrenwithbrainneoplasmsandhypopituitarism‏ ‎‡A Growth hormone therapy and tumor recurrence. Findings in children with brain neoplasms and hypopituitarism‏ ‎‡9 1‏
919 ‎‡a growthdifferencesbetweennorthamericanandeuropeanchildrenatriskfortype1diabetes‏ ‎‡A Growth differences between North American and European children at risk for type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a glycosylatedhemoglobinascreeningtestfordiabetesmellitus‏ ‎‡A Glycosylated hemoglobin: a screening test for diabetes mellitus?‏ ‎‡9 1‏
919 ‎‡a glycosylatedhaemoglobininchildrenwithinsulindependentdiabetesmellitus‏ ‎‡A Glycosylated haemoglobin in children with insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a glycemiaorinwomenestimatedglucosedisposalratepredictlowerextremityarterialdiseaseeventsintype1diabetes‏ ‎‡A Glycemia (or, in women, estimated glucose disposal rate) predict lower extremity arterial disease events in type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a glucosetoleranceinsiblingsoftype1diabeticpatientsrelationshiptohlastatus‏ ‎‡A Glucose tolerance in siblings of type 1 diabetic patients: relationship to HLA status‏ ‎‡9 1‏
919 ‎‡a changingprevalenceofoverweightchildrenandadolescentsatonsetofinsulintreateddiabetes‏ ‎‡A Changing Prevalence of Overweight Children and Adolescents at Onset of Insulin-Treated Diabetes‏ ‎‡9 1‏
919 ‎‡a characteristicsofslowprogressiontodiabetesinmultipleisletautoantibodypositiveindividualsfrom5longitudinalcohortsthesnailstudy‏ ‎‡A Characteristics of slow progression to diabetes in multiple islet autoantibody-positive individuals from five longitudinal cohorts: the SNAIL study.‏ ‎‡9 1‏
919 ‎‡a glucosecontrolinrwandanyouthwithtype1diabetesfollowingestablishmentofsystematichba1cbasedcareandeducation‏ ‎‡A Glucose control in Rwandan youth with type 1 diabetes following establishment of systematic, HbA1c based, care and education‏ ‎‡9 1‏
919 ‎‡a glucagonresponsestohypoglycemiainchildrenandadolescentswithiddm‏ ‎‡A Glucagon responses to hypoglycemia in children and adolescents with IDDM‏ ‎‡9 1‏
919 ‎‡a futureinterventiontrialsintype1diabetes‏ ‎‡A Future intervention trials in type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a friendshipandromanticrelationshipsamongemergingadultswithandwithouttype1diabetes‏ ‎‡A Friendship and romantic relationships among emerging adults with and without type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a featuredarticletrajectoriesofglycemiccontroloveradolescenceandemergingadulthoodan11yearlongitudinalstudyofyouthwithtype1diabetes‏ ‎‡A Featured Article: Trajectories of Glycemic Control Over Adolescence and Emerging Adulthood: An 11-Year Longitudinal Study of Youth With Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a familieswithchildrenwithdiabetesimplicationsofparentstressforparentandchildhealth‏ ‎‡A Families with children with diabetes: implications of parent stress for parent and child health‏ ‎‡9 1‏
919 ‎‡a familialinsulindependentdiabetesmellitusandhemipancreatectomy‏ ‎‡A Familial insulin-dependent diabetes mellitus and hemipancreatectomy‏ ‎‡9 1‏
919 ‎‡a familialandsporadicinsulindependentdiabetesevidenceforheterogeneousetiologies‏ ‎‡A Familial and sporadic insulin-dependent diabetes: evidence for heterogeneous etiologies?‏ ‎‡9 1‏
919 ‎‡a factorsassociatedwithavoidanceofseverecomplicationsafter25yrofiddmpittsburghepidemiologyofdiabetescomplicationsstudy1‏ ‎‡A Factors associated with avoidance of severe complications after 25 yr of IDDM. Pittsburgh Epidemiology of Diabetes Complications Study I.‏ ‎‡9 1‏
919 ‎‡a factorsaffectingglycosylatedhemoglobinvaluesinchildrenwithinsulindependentdiabetes‏ ‎‡A Factors affecting glycosylated hemoglobin values in children with insulin-dependent diabetes‏ ‎‡9 1‏
919 ‎‡a excessbmiinchildhoodamodifiableriskfactorfortype1diabetesdevelopment‏ ‎‡A Excess BMI in Childhood: A Modifiable Risk Factor for Type 1 Diabetes Development?‏ ‎‡9 1‏
919 ‎‡a excessbmiacceleratesisletautoimmunityinolderchildrenandadolescents‏ ‎‡A Excess BMI Accelerates Islet Autoimmunity in Older Children and Adolescents‏ ‎‡9 1‏
919 ‎‡a evolutionofthepittsburghstudiesoftheepidemiologyofinsulindependentdiabetesmellituspittsburghdiabetesepidemiologyandetiologyresearchgroup‏ ‎‡A Evolution of the Pittsburgh studies of the epidemiology of insulin-dependent diabetes mellitus. Pittsburgh Diabetes Epidemiology and Etiology Research Group‏ ‎‡9 1‏
919 ‎‡a evidenceforheterogeneouspathogenesisofinsulintreateddiabetesinblackandwhitechildren‏ ‎‡A Evidence for heterogeneous pathogenesis of insulin-treated diabetes in black and white children‏ ‎‡9 1‏
919 ‎‡a epidemiologypathophysiologyandprognosticimplicationsofcysticfibrosisrelateddiabetesatechnicalreview‏ ‎‡A Epidemiology, pathophysiology, and prognostic implications of cystic fibrosis-related diabetes: a technical review‏ ‎‡9 1‏
919 ‎‡a epidemiologicalcorrelatesofdiabeticneuropathyreportfrompittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Epidemiological correlates of diabetic neuropathy. Report from Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a employmentspectrumofiddm‏ ‎‡A Employment spectrum of IDDM‏ ‎‡9 1‏
919 ‎‡a employmentpatternsamongparentsofchildrenwithinsulindependentdiabetesmellitusiddm‏ ‎‡A Employment patterns among parents of children with insulin-dependent diabetes mellitus (IDDM)‏ ‎‡9 1‏
919 ‎‡a emergingadultswithtype1diabetesacomparisontopeerswithoutdiabetes‏ ‎‡A Emerging adults with type 1 diabetes: a comparison to peers without diabetes‏ ‎‡9 1‏
919 ‎‡a electroencephalographicchangesindiabeticketosisinchildrenwithnewlyandpreviouslydiagnosedinsulindependentdiabetesmellitus‏ ‎‡A Electroencephalographic changes in diabetic ketosis in children with newly and previously diagnosed insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a effectsofimprovedglycemiccontrolonmicroalbuminuriainadolescentswithinsulindependentdiabetesmellitus‏ ‎‡A Effects of improved glycemic control on microalbuminuria in adolescents with insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a effectsofenhancedconventionaltherapyonmetaboliccontrolinchildrenwithinsulindependentdiabetesmellitus‏ ‎‡A Effects of enhanced conventional therapy on metabolic control in children with insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a effectofhydrolyzedinfantformulavsconventionalformulaonriskoftype1diabetesthetrigrrandomizedclinicaltrial‏ ‎‡A Effect of Hydrolyzed Infant Formula vs Conventional Formula on Risk of Type 1 Diabetes: The TRIGR Randomized Clinical Trial‏ ‎‡9 1‏
919 ‎‡a editorialtributemarkasperling1500editorinchiefpediatricdiabetes2000‏ ‎‡A Editorial Tribute: Mark A. Sperling, MD, Editor-in-Chief, Pediatric Diabetes 2000-2017‏ ‎‡9 1‏
919 ‎‡a 1deamino8500argininevasopressininthetreatmentofcentraldiabetesinsipidusinchildhood‏ ‎‡A 1-deamino-8-D-arginine vasopressin in the treatment of central diabetes insipidus in childhood‏ ‎‡9 1‏
919 ‎‡a focusonbloodglucosemonitoringrelationtoglycemiccontrolanddeterminantsoffrequency‏ ‎‡A A focus on blood glucose monitoring: relation to glycemic control and determinants of frequency‏ ‎‡9 1‏
919 ‎‡a seroepidemiologicstudyofnondiabetic1degreerelativesofiddmcases‏ ‎‡A A sero-epidemiologic study of nondiabetic first-degree relatives of IDDM cases‏ ‎‡9 1‏
919 ‎‡a abnormalalphacellhypoglycemicrecognitioninchildrenwithinsulindependentdiabetesmellitus‏ ‎‡A Abnormal alpha cell hypoglycemic recognition in children with insulin dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a abnormalalphacellhypoglycemicrecognitioninchildrenwithinsulindependentdiabetesmellitusiddm‏ ‎‡A Abnormal alpha cell hypoglycemic recognition in children with insulin dependent diabetes mellitus (IDDM)‏ ‎‡9 1‏
919 ‎‡a abnormaltcellreactivitiesinchildhoodinflammatorydemyelinatingdiseaseandtype1diabetes‏ ‎‡A Abnormal T-cell reactivities in childhood inflammatory demyelinating disease and type 1 diabetes.‏ ‎‡9 1‏
919 ‎‡a earlyfeedingandriskoftype1diabetesexperiencesfromthetrialtoreduceinsulindependentdiabetesmellitusinthegeneticallyatrisktrigr‏ ‎‡A Early feeding and risk of type 1 diabetes: experiences from the Trial to Reduce Insulin-dependent diabetes mellitus in the Genetically at Risk (TRIGR).‏ ‎‡9 1‏
919 ‎‡a earlyandlate100peptideresponsesduringoralglucosetolerancetestingareoppositelypredictiveoftype1diabetesinautoantibodypositiveindividuals‏ ‎‡A Early and late C-peptide responses during oral glucose tolerance testing are oppositely predictive of type 1 diabetes in autoantibody-positive individuals‏ ‎‡9 1‏
919 ‎‡a clusteringofprematuremortalityin1761insulindependentdiabeticsandtheirfamilymembers‏ ‎‡A Clustering of premature mortality in 1,761 insulin-dependent diabetics and their family members‏ ‎‡9 1‏
919 ‎‡a earlyadolescentrelationshippredictorsofemergingadultoutcomesyouthwithandwithouttype1diabetes‏ ‎‡A Early adolescent relationship predictors of emerging adult outcomes: youth with and without type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a diurnalglucosedependentfluctuationsinglycosylatedhemoglobinlevelsininsulindependentdiabetes‏ ‎‡A Diurnal glucose--dependent fluctuations in glycosylated hemoglobin levels in insulin-dependent diabetes‏ ‎‡9 1‏
919 ‎‡a characterizationofsomatostatinspecificbindinginplasmacellmembranesofhumanplacenta‏ ‎‡A Characterization of Somatostatin Specific Binding in Plasma Cell Membranes of Human Placenta‏ ‎‡9 1‏
919 ‎‡a diseaseprogressionamong446childrenwithnewlydiagnosedtype1diabeteslocatedinscandinaviaeuropeandnorthamericaduringthelast27yr‏ ‎‡A Disease progression among 446 children with newly diagnosed type 1 diabetes located in Scandinavia, Europe, and North America during the last 27 yr‏ ‎‡9 1‏
919 ‎‡a differencesbetweenblacksandwhitesintheepidemiologyofinsulindependentdiabetesmellitusinalleghenycountypennsylvania‏ ‎‡A Differences between blacks and whites in the epidemiology of insulin-dependent diabetes mellitus in Allegheny County, Pennsylvania‏ ‎‡9 1‏
919 ‎‡a dietofadolescentswithandwithoutdiabetestradingcandyforpotatochips‏ ‎‡A Diet of adolescents with and without diabetes: Trading candy for potato chips?‏ ‎‡9 1‏
919 ‎‡a ageandsexvariationsinglucosetoleranceandinsulinresponsesparallelswithcardiovascularrisk‏ ‎‡A Age and sex variations in glucose tolerance and insulin responses: parallels with cardiovascular risk‏ ‎‡9 1‏
919 ‎‡a allcausemortalitytrendsinalargepopulationbasedcohortwithlongstandingchildhoodonsettype1diabetesthealleghenycountytype1diabetesregistry‏ ‎‡A All-cause mortality trends in a large population-based cohort with long-standing childhood-onset type 1 diabetes: the Allegheny County type 1 diabetes registry‏ ‎‡9 1‏
919 ‎‡a analysesonpossibleheterogeneityofiddmbasedonpresenceofisletcellcytoplasmicantibodyatdiagnosis‏ ‎‡A Analyses on possible heterogeneity of IDDM based on presence of islet cell cytoplasmic antibody at diagnosis‏ ‎‡9 1‏
919 ‎‡a antibodiestooxidizedldlandldlcontainingimmunecomplexesasriskfactorsforcoronaryarterydiseaseindiabetesmellitus‏ ‎‡A Antibodies to oxidized LDL and LDL-containing immune complexes as risk factors for coronary artery disease in diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a antibodiestooxidizedldlpredictcoronaryarterydiseaseintype1diabetesanestedcasecontrolstudyfromthepittsburghepidemiologyofdiabetescomplicationsstudy‏ ‎‡A Antibodies to oxidized LDL predict coronary artery disease in type 1 diabetes: a nested case-control study from the Pittsburgh Epidemiology of Diabetes Complications Study‏ ‎‡9 1‏
919 ‎‡a antigenbasedtherapywithglutamicaciddecarboxylasegadvaccineinpatientswithrecentonsettype1diabetesarandomiseddoubleblindtrial‏ ‎‡A Antigen-based therapy with glutamic acid decarboxylase (GAD) vaccine in patients with recent-onset type 1 diabetes: a randomised double-blind trial‏ ‎‡9 1‏
919 ‎‡a arepredictorsofcoronaryheartdiseaseandlowerextremityarterialdiseaseintype1diabetesthesameaprospectivestudy‏ ‎‡A Are predictors of coronary heart disease and lower-extremity arterial disease in type 1 diabetes the same? A prospective study‏ ‎‡9 1‏
919 ‎‡a assessmentofalbusureanditsusefulnessinidentifyingiddmsubjectsatincreasedriskfordevelopingclinicaldiabeticnephropathy‏ ‎‡A Assessment of AlbuSure and its usefulness in identifying IDDM subjects at increased risk for developing clinical diabetic nephropathy‏ ‎‡9 1‏
919 ‎‡a diabeticretinopathyinmauriacssyndromeparadoxicaldeteriorationwithimprovedmetaboliccontrol‏ ‎‡A Diabetic retinopathy in Mauriac's syndrome. Paradoxical deterioration with improved metabolic control‏ ‎‡9 1‏
919 ‎‡a diabeticnephropathyinadolescenceappearanceduringimprovedglycemiccontrol‏ ‎‡A Diabetic nephropathy in adolescence: appearance during improved glycemic control‏ ‎‡9 1‏
919 ‎‡a associationbetweenfamilyhistoryearlygrowthandtheriskofbetacellautoimmunityinchildrenatriskfortype1diabetes‏ ‎‡A Association between family history, early growth and the risk of beta cell autoimmunity in children at risk for type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a diabeticautonomicneuropathyandcardiovascularriskpittsburghepidemiologyofdiabetescomplicationsstudy3‏ ‎‡A Diabetic autonomic neuropathy and cardiovascular risk. Pittsburgh Epidemiology of Diabetes Complications Study III‏ ‎‡9 1‏
919 ‎‡a diabetescomplicationsandglycemiccontrolthepittsburghprospectiveinsulindependentdiabetescohortstudystatusreportafter5yrofiddm‏ ‎‡A Diabetes complications and glycemic control. The Pittsburgh Prospective Insulin-Dependent Diabetes Cohort Study Status Report after 5 yr of IDDM‏ ‎‡9 1‏
919 ‎‡a detectionofsymptomsbyadolescentsandyoungadultswithtype1diabetesduringexperimentalinductionofmildhypoglycemiaroleofhormonalandpsychologicalvariables‏ ‎‡A Detection of symptoms by adolescents and young adults with type 1 diabetes during experimental induction of mild hypoglycemia: role of hormonal and psychological variables.‏ ‎‡9 1‏
919 ‎‡a choiceofurinesamplepredictiveofmicroalbuminuriainpatientswithinsulindependentdiabetesmellitus‏ ‎‡A Choice of urine sample predictive of microalbuminuria in patients with insulin-dependent diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a demonstrationofadawnphenomenoninnormaladolescents‏ ‎‡A Demonstration of a dawn phenomenon in normal adolescents‏ ‎‡9 1‏
919 ‎‡a cytoplasmicisletcellantibodiesremainvaluableindefiningriskofprogressiontotype1diabetesinsubjectswithotherisletautoantibodies‏ ‎‡A Cytoplasmic islet cell antibodies remain valuable in defining risk of progression to type 1 diabetes in subjects with other islet autoantibodies.‏ ‎‡9 1‏
919 ‎‡a cyclosporintherapyforpreventionandcureofiddmepidemiologicalperspectiveofbenefitsandrisks‏ ‎‡A Cyclosporin therapy for prevention and cure of IDDM. Epidemiological perspective of benefits and risks‏ ‎‡9 1‏
919 ‎‡a cumulativeglycemicexposureandmicrovascularcomplicationsininsulindependentdiabetesmellitustheglycemicthresholdrevisited‏ ‎‡A Cumulative glycemic exposure and microvascular complications in insulin-dependent diabetes mellitus. The glycemic threshold revisited‏ ‎‡9 1‏
919 ‎‡a crosssectionalandlongitudinalrelationshipofsodiumlithiumcountertransporttoinsulinobesityandbloodpressureinhealthyperimenopausalwomen‏ ‎‡A Cross-sectional and longitudinal relationship of sodium-lithium countertransport to insulin, obesity and blood pressure in healthy perimenopausal women‏ ‎‡9 1‏
919 ‎‡a costimulationmodulationwithabataceptinpatientswithrecentonsettype1diabetesfollowup1yearaftercessationoftreatment‏ ‎‡A Costimulation modulation with abatacept in patients with recent-onset type 1 diabetes: follow-up 1 year after cessation of treatment‏ ‎‡9 1‏
919 ‎‡a correlatesofinsulinantibodiesinnewlydiagnosedchildrenwithinsulindependentdiabetesbeforeinsulintherapy‏ ‎‡A Correlates of insulin antibodies in newly diagnosed children with insulin-dependent diabetes before insulin therapy‏ ‎‡9 1‏
919 ‎‡a coronarycalciuminadultswithtype1diabetesastrongercorrelateofclinicalcoronaryarterydiseaseinmenthaninwomen‏ ‎‡A Coronary calcium in adults with type 1 diabetes: a stronger correlate of clinical coronary artery disease in men than in women‏ ‎‡9 1‏
919 ‎‡a coronaryarterydiseaseiniddmgenderdifferencesinriskfactorsbutnotrisk‏ ‎‡A Coronary artery disease in IDDM. Gender differences in risk factors but not risk‏ ‎‡9 1‏
919 ‎‡a contributionofdiabetesdurationbeforepubertytodevelopmentofmicrovascularcomplicationsiniddmsubjects‏ ‎‡A Contribution of diabetes duration before puberty to development of microvascular complications in IDDM subjects‏ ‎‡9 1‏
919 ‎‡a associationsofhba1cwiththetimingof100peptideresponsesduringtheoralglucosetolerancetestatthediagnosisoftype1diabetes‏ ‎‡A Associations of HbA1c with the timing of C-peptide responses during the oral glucose tolerance test at the diagnosis of type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a condomusepregnancyandstdsinadolescentfemaleswithandwithouttype1diabetes‏ ‎‡A Condom use, pregnancy, and STDs in adolescent females with and without type 1 diabetes.‏ ‎‡9 1‏
919 ‎‡a autoantibodiesdirectedtowardanovelia2variantproteinenhancepredictionoftype1diabetes‏ ‎‡A Autoantibodies Directed Toward a Novel IA-2 Variant Protein Enhance Prediction of Type 1 Diabetes‏ ‎‡9 1‏
919 ‎‡a autoimmuneisletdestructioninspontaneoustype1diabetesisnotbetacellexclusive‏ ‎‡A Autoimmune islet destruction in spontaneous type 1 diabetes is not beta-cell exclusive.‏ ‎‡9 1‏
919 ‎‡a autoimmunityandgeneticscontributetotheriskofinsulindependentdiabetesmellitusinfamiliesisletcellantibodiesandhladqheterodimers‏ ‎‡A Autoimmunity and genetics contribute to the risk of insulin-dependent diabetes mellitus in families: islet cell antibodies and HLA DQ heterodimers‏ ‎‡9 1‏
919 ‎‡a characterizingsuddendeathanddeadinbedsyndromeintype1diabetesanalysisfrom2childhoodonsettype1diabetesregistries‏ ‎‡A Characterizing sudden death and dead-in-bed syndrome in Type 1 diabetes: analysis from two childhood-onset Type 1 diabetes registries.‏ ‎‡9 1‏
919 ‎‡a blymphocytedepletionwithrituximabandβcellfunction2yearresults‏ ‎‡A B-lymphocyte depletion with rituximab and β-cell function: two-year results‏ ‎‡9 1‏
919 ‎‡a comparisonofphysiologicandpharmacologicassessmentofgrowthhormonesecretion‏ ‎‡A Comparison of Physiologic and Pharmacologic Assessment of Growth Hormone Secretion‏ ‎‡9 1‏
919 ‎‡a comparisonofadolescentswithandwithoutdiabetesonindicesofpsychosocialfunctioningfor3years‏ ‎‡A Comparison of adolescents with and without diabetes on indices of psychosocial functioning for three years‏ ‎‡9 1‏
919 ‎‡a combinedanalysisofgad65andica512ia2autoantibodiesinorganandnonorganspecificautoimmunediseasesconfershighspecificityforinsulindependentdiabetesmellitus‏ ‎‡A Combined analysis of GAD65 and ICA512(IA-2) autoantibodies in organ and non-organ-specific autoimmune diseases confers high specificity for insulin-dependent diabetes mellitus‏ ‎‡9 1‏
943 ‎‡a 198x‏ ‎‡A 1985‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2017‏ ‎‡9 1‏
996 ‎‡2 DNB|1280258624
996 ‎‡2 ISNI|0000000022808677
996 ‎‡2 J9U|987007315175105171
996 ‎‡2 DNB|123138019
996 ‎‡2 PLWABN|9810583474105606
996 ‎‡2 ISNI|0000000041039092
996 ‎‡2 NUKAT|n 2012110345
996 ‎‡2 LC|no2015053796
996 ‎‡2 NUKAT|n 2015057113
996 ‎‡2 LC|no 89004666
996 ‎‡2 DNB|172806089
996 ‎‡2 ISNI|0000000058677197
996 ‎‡2 DNB|121513270
996 ‎‡2 ISNI|0000000005577483
996 ‎‡2 RERO|A002982770
996 ‎‡2 DNB|104222093
996 ‎‡2 DNB|171937538
996 ‎‡2 DNB|1050424077
996 ‎‡2 BIBSYS|99059411
996 ‎‡2 NUKAT|n 2004029965
996 ‎‡2 ISNI|0000000382617786
996 ‎‡2 DNB|115618910
996 ‎‡2 ISNI|0000000019428059
996 ‎‡2 ISNI|0000000021846639
996 ‎‡2 LC|n 80008340
996 ‎‡2 ISNI|000000007586033X
996 ‎‡2 LC|no2007128610
996 ‎‡2 LC|nr 95009735
996 ‎‡2 J9U|987007525002305171
996 ‎‡2 LC|n 81044101
996 ‎‡2 ISNI|000000004350965X
996 ‎‡2 DNB|133460703
996 ‎‡2 DNB|131619907X
996 ‎‡2 PLWABN|9810590802505606
996 ‎‡2 ISNI|0000000112547255
996 ‎‡2 J9U|987007405726405171
996 ‎‡2 DNB|1200362152
996 ‎‡2 DNB|124351174
996 ‎‡2 J9U|987007332132505171
996 ‎‡2 BIBSYS|90292135
996 ‎‡2 DNB|135305799
996 ‎‡2 NUKAT|n 2012107790
996 ‎‡2 DNB|1157295509
996 ‎‡2 LC|no2017073466
996 ‎‡2 LC|n 2005070189
996 ‎‡2 BAV|495_73745
996 ‎‡2 DNB|13244688X
996 ‎‡2 DNB|143951610
996 ‎‡2 SUDOC|176717927
996 ‎‡2 DNB|1102182745
996 ‎‡2 NKC|xx0194141
996 ‎‡2 LC|n 00033207
996 ‎‡2 DNB|120778262
996 ‎‡2 DNB|1070472352
996 ‎‡2 ISNI|0000000021660674
996 ‎‡2 PLWABN|9810608588105606
996 ‎‡2 DNB|1279969229
996 ‎‡2 DNB|1158896735
996 ‎‡2 LC|n 87148496
996 ‎‡2 DNB|1234605767
996 ‎‡2 DNB|1247313360
996 ‎‡2 DNB|1203214782
996 ‎‡2 ISNI|0000000074227946
996 ‎‡2 LC|n 81046372
996 ‎‡2 DNB|135925983
996 ‎‡2 ISNI|0000000014578875
996 ‎‡2 NTA|313059276
996 ‎‡2 DNB|138295565
996 ‎‡2 DNB|14036546X
996 ‎‡2 CAOONL|ncf10053033
996 ‎‡2 CAOONL|ncf10253825
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏