VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q115668471 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000029.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q115668471‏
035 ‎‡a (OCoLC)Q115668471‏
100 0 ‎‡a María Victoria Ramos‏ ‎‡c researcher‏ ‎‡9 en‏
670 ‎‡a Author's Antibody response to Shiga toxins in Argentinean children with enteropathic hemolytic uremic syndrome at acute and long-term follow-up periods‏
670 ‎‡a Author's Involvement of the fractalkine pathway in the pathogenesis of childhood hemolytic uremic syndrome‏
670 ‎‡a Author's Leukotriene C4 increases the susceptibility of adult mice to Shiga toxin-producing Escherichia coli infection‏
670 ‎‡a Author's Oral administration of Shiga toxin-producing Escherichia coli induces intestinal and systemic specific immune response in mice‏
670 ‎‡a Author's Shiga toxin-producing Escherichia coli O157: H7 shows an increased pathogenicity in mice after the passage through the gastrointestinal tract of the same host‏
919 ‎‡a shigatoxinproducingescherichiacolio157h7showsanincreasedpathogenicityinmiceafterthepassagethroughthegastrointestinaltractofthesamehost‏ ‎‡A Shiga toxin-producing Escherichia coli O157: H7 shows an increased pathogenicity in mice after the passage through the gastrointestinal tract of the same host‏ ‎‡9 1‏
919 ‎‡a oraladministrationofshigatoxinproducingescherichiacoliinducesintestinalandsystemicspecificimmuneresponseinmice‏ ‎‡A Oral administration of Shiga toxin-producing Escherichia coli induces intestinal and systemic specific immune response in mice‏ ‎‡9 1‏
919 ‎‡a leukotrienec4increasesthesusceptibilityofadultmicetoshigatoxinproducingescherichiacoliinfection‏ ‎‡A Leukotriene C4 increases the susceptibility of adult mice to Shiga toxin-producing Escherichia coli infection‏ ‎‡9 1‏
919 ‎‡a antibodyresponsetoshigatoxinsinargentineanchildrenwithenteropathichemolyticuremicsyndromeatacuteandlongtermfollowupperiods‏ ‎‡A Antibody response to Shiga toxins in Argentinean children with enteropathic hemolytic uremic syndrome at acute and long-term follow-up periods‏ ‎‡9 1‏
919 ‎‡a involvementofthefractalkinepathwayinthepathogenesisofchildhoodhemolyticuremicsyndrome‏ ‎‡A Involvement of the fractalkine pathway in the pathogenesis of childhood hemolytic uremic syndrome‏ ‎‡9 1‏
996 ‎‡2 LC|no2003027295
996 ‎‡2 ISNI|0000000060262513
996 ‎‡2 LC|ns2011000646
996 ‎‡2 SUDOC|070158851
996 ‎‡2 BNF|16986410
996 ‎‡2 DNB|1057615986
996 ‎‡2 ISNI|0000000070507246
996 ‎‡2 RERO|A013273724
996 ‎‡2 LC|n 93003709
996 ‎‡2 ISNI|0000000003493411
996 ‎‡2 DNB|1089420714
996 ‎‡2 ISNI|0000000025239860
996 ‎‡2 ISNI|0000000401960441
996 ‎‡2 ISNI|0000000385914604
996 ‎‡2 ISNI|000000006840570X
996 ‎‡2 ISNI|0000000067316262
996 ‎‡2 NII|DA18949656
996 ‎‡2 ISNI|0000000046826239
996 ‎‡2 BNE|XX1319722
996 ‎‡2 BNE|XX5345242
996 ‎‡2 LC|ns2015002805
996 ‎‡2 ISNI|0000000070535933
996 ‎‡2 PTBNP|1212767
996 ‎‡2 SUDOC|06910638X
996 ‎‡2 BNE|XX1188406
996 ‎‡2 J9U|987007461472005171
996 ‎‡2 PTBNP|1333559
996 ‎‡2 ISNI|0000000037889334
996 ‎‡2 ISNI|0000000059405062
996 ‎‡2 PTBNP|1718757
996 ‎‡2 SUDOC|124756352
996 ‎‡2 ISNI|0000000355811727
996 ‎‡2 BNE|XX4667849
996 ‎‡2 DNB|137469985
996 ‎‡2 LC|no2006095469
996 ‎‡2 DNB|1208777629
996 ‎‡2 ISNI|0000000049482371
996 ‎‡2 BNC|981058512374506706
996 ‎‡2 ISNI|0000000050273980
996 ‎‡2 BLBNB|000537195
996 ‎‡2 LC|no2024124621
996 ‎‡2 LC|n 84221558
996 ‎‡2 BNE|XX1399159
996 ‎‡2 PTBNP|38040
996 ‎‡2 ISNI|0000000078996769
996 ‎‡2 LC|no2022024289
996 ‎‡2 LC|n 88055804
996 ‎‡2 PTBNP|194794
996 ‎‡2 LC|no2005051283
996 ‎‡2 DNB|1056593466
996 ‎‡2 BLBNB|000168647
996 ‎‡2 SUDOC|260568090
996 ‎‡2 BLBNB|000354139
996 ‎‡2 LC|no2010092943
996 ‎‡2 RERO|A005751991
996 ‎‡2 DNB|1222289334
996 ‎‡2 NUKAT|n 2020122369
996 ‎‡2 PTBNP|1007532
996 ‎‡2 ISNI|0000000022243653
996 ‎‡2 SUDOC|219523061
996 ‎‡2 BNC|981061134662206706
996 ‎‡2 ISNI|0000000067812338
996 ‎‡2 ISNI|0000000068484719
996 ‎‡2 DNB|174261144
996 ‎‡2 DNB|1141179946
996 ‎‡2 PTBNP|1153379
996 ‎‡2 LC|n 2012213051
996 ‎‡2 DNB|1057416630
996 ‎‡2 LC|ns2013003252
996 ‎‡2 ISNI|0000000356724692
996 ‎‡2 BNF|16665199
996 ‎‡2 BNC|981058554943306706
996 ‎‡2 DBC|87097969658016
996 ‎‡2 PTBNP|1316459
996 ‎‡2 DNB|1213101654
996 ‎‡2 LIH|LNB:CX_w_1;=B_p_
996 ‎‡2 LC|nr 98042441
996 ‎‡2 ISNI|0000000070825770
996 ‎‡2 SUDOC|145197832
996 ‎‡2 ISNI|0000000068721841
996 ‎‡2 ISNI|0000000067804346
996 ‎‡2 LC|n 90727795
996 ‎‡2 ISNI|0000000059526788
996 ‎‡2 NTA|329074601
996 ‎‡2 LC|no2007140344
996 ‎‡2 J9U|987012438464005171
996 ‎‡2 LC|no 96015641
996 ‎‡2 LC|n 2008078035
996 ‎‡2 ISNI|0000000120730420
996 ‎‡2 LC|ns2023002941
996 ‎‡2 BLBNB|000568403
996 ‎‡2 ISNI|0000000036305907
996 ‎‡2 ISNI|0000000114422034
996 ‎‡2 ISNI|0000000043434651
996 ‎‡2 LC|n 2009212941
996 ‎‡2 LC|nr2003022921
996 ‎‡2 BLBNB|001493132
996 ‎‡2 LC|n 94072291
996 ‎‡2 LC|n 91039898
996 ‎‡2 BNE|XX6411131
996 ‎‡2 SUDOC|154832235
996 ‎‡2 DNB|139592520
996 ‎‡2 PTBNP|1738350
996 ‎‡2 PLWABN|9812829868905606
996 ‎‡2 ISNI|0000000068094366
996 ‎‡2 ISNI|0000000042537894
996 ‎‡2 LC|no2011086784
996 ‎‡2 BLBNB|000593984
996 ‎‡2 ISNI|000000006929110X
996 ‎‡2 ISNI|0000000069823102
996 ‎‡2 RERO|A009526507
996 ‎‡2 DNB|1056255943
996 ‎‡2 NYNYRILM|251433
996 ‎‡2 DNB|1061542718
996 ‎‡2 LC|no2006120218
996 ‎‡2 BLBNB|000329029
996 ‎‡2 ISNI|0000000115470986
996 ‎‡2 BNC|981058522214706706
996 ‎‡2 BNF|15507173
996 ‎‡2 DNB|1053988362
996 ‎‡2 BNE|XX865901
996 ‎‡2 SUDOC|279400705
996 ‎‡2 BNE|XX5570572
996 ‎‡2 ISNI|0000000067626420
996 ‎‡2 BIBSYS|90125149
996 ‎‡2 ISNI|000000006837558X
996 ‎‡2 DNB|1056459506
996 ‎‡2 PTBNP|124746
996 ‎‡2 LC|no2009011834
996 ‎‡2 BNF|12366280
996 ‎‡2 NUKAT|nx2022375260
996 ‎‡2 ISNI|000000005948715X
996 ‎‡2 LC|n 2008075610
996 ‎‡2 LC|n 84185995
996 ‎‡2 ISNI|0000000068602869
996 ‎‡2 PTBNP|1473708
996 ‎‡2 PTBNP|1585245
996 ‎‡2 BNF|16258152
996 ‎‡2 LC|no 96018888
996 ‎‡2 ISNI|0000000068676235
996 ‎‡2 ISNI|0000000035932538
996 ‎‡2 BNE|XX4440695
996 ‎‡2 SUDOC|08145046X
996 ‎‡2 BNC|981058517623506706
996 ‎‡2 BLBNB|000354282
996 ‎‡2 ISNI|0000000037267260
996 ‎‡2 ISNI|0000000418997013
996 ‎‡2 LC|no2004036777
996 ‎‡2 ISNI|0000000444647877
996 ‎‡2 BNE|XX6222352
996 ‎‡2 ISNI|0000000112349064
996 ‎‡2 ISNI|0000000059739206
996 ‎‡2 ISNI|0000000059499142
996 ‎‡2 SUDOC|273679600
996 ‎‡2 ISNI|0000000069528904
996 ‎‡2 ISNI|0000000069701340
996 ‎‡2 BNCHL|10000000000000000292502
996 ‎‡2 ISNI|0000000069428348
996 ‎‡2 DNB|1131261666
996 ‎‡2 BLBNB|000275997
996 ‎‡2 LC|no2002015226
996 ‎‡2 LC|n 2004154862
996 ‎‡2 LC|n 2001097300
996 ‎‡2 BNE|XX6384727
996 ‎‡2 PTBNP|169080
996 ‎‡2 PTBNP|1483914
996 ‎‡2 ISNI|000000007020937X
996 ‎‡2 SUDOC|136234739
996 ‎‡2 BNCHL|10000000000000000187286
996 ‎‡2 LC|ns2013004324
996 ‎‡2 PTBNP|1325048
996 ‎‡2 SUDOC|19076113X
996 ‎‡2 LC|n 2006078373
996 ‎‡2 ISNI|0000000120564645
996 ‎‡2 NTA|381184439
996 ‎‡2 DNB|173817394
996 ‎‡2 PTBNP|1743025
996 ‎‡2 LC|no2010019911
996 ‎‡2 NUKAT|n 2010040934
996 ‎‡2 BLBNB|000329019
996 ‎‡2 BNE|XX1298226
996 ‎‡2 DNB|1012430855
996 ‎‡2 ISNI|0000000092405750
996 ‎‡2 DNB|1127362240
996 ‎‡2 LC|n 84101395
996 ‎‡2 LC|no2009130057
996 ‎‡2 LC|ns2016002596
996 ‎‡2 PTBNP|79379
996 ‎‡2 PTBNP|176555
996 ‎‡2 LC|n 88012121
996 ‎‡2 W2Z|1602157057386
996 ‎‡2 BNE|XX842140
996 ‎‡2 BNE|XX5448819
996 ‎‡2 BNE|XX5454489
996 ‎‡2 PTBNP|1156649
996 ‎‡2 ISNI|0000000069825853
996 ‎‡2 LC|no2018112227
996 ‎‡2 BLBNB|000485882
996 ‎‡2 BNCHL|10000000000000000067865
996 ‎‡2 LC|n 93101665
996 ‎‡2 ISNI|0000000068789475
996 ‎‡2 PTBNP|1250248
996 ‎‡2 LC|no2012140376
996 ‎‡2 PTBNP|1571211
996 ‎‡2 BNE|XX5468509
996 ‎‡2 LC|n 2007214591
996 ‎‡2 ISNI|0000000119130313
996 ‎‡2 ERRR|12285328
996 ‎‡2 BNE|XX1278402
996 ‎‡2 PTBNP|139423
996 ‎‡2 RERO|A013280653
996 ‎‡2 LC|n 95031884
996 ‎‡2 BNE|XX4871100
996 ‎‡2 DNB|1076371892
996 ‎‡2 ISNI|0000000033745616
996 ‎‡2 BNF|14617942
996 ‎‡2 BNC|981058598176606706
996 ‎‡2 BLBNB|000219315
996 ‎‡2 LC|n 79051851
996 ‎‡2 LC|no 97028114
996 ‎‡2 LC|n 95921713
996 ‎‡2 BNF|14495395
996 ‎‡2 PTBNP|1590062
996 ‎‡2 ISNI|0000000069207916
996 ‎‡2 ISNI|0000000382383350
996 ‎‡2 ISNI|0000000078790162
996 ‎‡2 PTBNP|1625313
996 ‎‡2 ISNI|0000000068498694
996 ‎‡2 BLBNB|000252868
996 ‎‡2 ISNI|0000000123311387
996 ‎‡2 BNE|XX5401682
996 ‎‡2 SUDOC|185894259
996 ‎‡2 SUDOC|197040721
996 ‎‡2 LC|ns2018000658
996 ‎‡2 PTBNP|575234
996 ‎‡2 ISNI|0000000082849892
996 ‎‡2 PTBNP|1730838
996 ‎‡2 DNB|130474533
996 ‎‡2 SUDOC|083230149
996 ‎‡2 ISNI|0000000061128834
996 ‎‡2 ISNI|0000000070118187
996 ‎‡2 PTBNP|1291277
996 ‎‡2 BNE|XX1121544
996 ‎‡2 LC|n 2003113700
996 ‎‡2 LC|n 2007207330
996 ‎‡2 SUDOC|199609691
996 ‎‡2 PTBNP|1921309
996 ‎‡2 RERO|A026502956
996 ‎‡2 PTBNP|206589
996 ‎‡2 DNB|1293556084
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏