VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q25802923 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010707.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q25802923‏
024 ‎‡a 0000-0002-5225-9255‏ ‎‡2 orcid‏
024 ‎‡a 7102266172‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q25802923‏
100 0 ‎‡a Afonso Nogueira‏ ‎‡9 eo‏ ‎‡9 co‏ ‎‡9 io‏ ‎‡9 af‏ ‎‡9 vi‏ ‎‡9 ca‏ ‎‡9 it‏ ‎‡9 an‏ ‎‡9 cy‏ ‎‡9 gd‏ ‎‡9 pt-br‏ ‎‡9 ga‏ ‎‡9 zu‏ ‎‡9 cs‏ ‎‡9 et‏ ‎‡9 gl‏ ‎‡9 ie‏ ‎‡9 id‏ ‎‡9 es‏ ‎‡9 en-gb‏ ‎‡9 lb‏ ‎‡9 wa‏ ‎‡9 nn‏ ‎‡9 min‏ ‎‡9 nys‏ ‎‡9 nb‏ ‎‡9 pms‏ ‎‡9 lij‏ ‎‡9 li‏ ‎‡9 wo‏ ‎‡9 nap‏ ‎‡9 frp‏ ‎‡9 nds-nl‏ ‎‡9 fi‏ ‎‡9 rm‏ ‎‡9 ro‏ ‎‡9 ia‏ ‎‡9 is‏ ‎‡9 pcd‏ ‎‡9 vec‏ ‎‡9 sco‏ ‎‡9 nrm‏ ‎‡9 ast‏ ‎‡9 hr‏ ‎‡9 de‏ ‎‡9 hu‏ ‎‡9 da‏ ‎‡9 fr‏ ‎‡9 sc‏ ‎‡9 oc‏ ‎‡9 br‏ ‎‡9 vls‏ ‎‡9 vo‏ ‎‡9 kg‏ ‎‡9 en-ca‏ ‎‡9 scn‏ ‎‡9 mg‏ ‎‡9 bar‏ ‎‡9 pt‏ ‎‡9 gsw‏ ‎‡9 fur‏ ‎‡9 sq‏ ‎‡9 sw‏ ‎‡9 de-ch‏ ‎‡9 sk‏ ‎‡9 sr-el‏ ‎‡9 pl‏ ‎‡9 ms‏ ‎‡9 sl‏ ‎‡9 de-at‏ ‎‡9 nds‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Afonso Nogueira‏ ‎‡c palaeontologist at Federal University of Pará‏ ‎‡9 en‏
400 0 ‎‡a Afonso Nogueira‏ ‎‡c ikertzailea‏ ‎‡9 eu‏
400 0 ‎‡a Afonso Nogueira‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
400 0 ‎‡a Afonso Nogueira‏ ‎‡c forskare‏ ‎‡9 sv‏
670 ‎‡a Author's A palaeobiogeographic model for biotic diversification within Amazonia over the past three million years‏
670 ‎‡a Author's A red algal bloom in the aftermath of the Marinoan Snowball Earth‏
670 ‎‡a Author's A seção-tipo da Formação Serra do Quilombo, Grupo Araras, Neoproterozoico da Faixa Paraguai Norte, Mato Grosso‏
670 ‎‡a Author's Aliphatic and aromatic biomarkers of the Devonian source rocks from the Western Parnaíba Basin Brazil: Pimenteiras Formation‏
670 ‎‡a Author's Análise faciológica da Formação Alter do Chão (Cretáceo, Bacia do Amazonas), próximo à cidade de Óbidos, Pará, Brasil‏
670 ‎‡a Author's Ariid sea catfishes from the coeval Pirabas (Northeastern Brazil), Cantaure, Castillo (Northwestern Venezuela), and Castilletes (North Colombia) formations (early Miocene), with description of three new species‏
670 ‎‡a Author's Carbon and oxygen isotope geochemistry of Ediacaran outer platform carbonates, Paraguay Belt, central Brazil‏
670 ‎‡a Author's Carbon and strontium isotope fluctuations and paleoceanographic changes in the late Neoproterozoic Araras carbonate platform, southern Amazon craton, Brazil‏
670 ‎‡a Author's Carbonate-clastic sedimentation in the Parnaiba Basin, northern Brazil: Record of carboniferous epeiric sea in the Western Gondwana‏
670 ‎‡a Author's Closing the Clymene ocean and bending a Brasiliano belt: Evidence for the Cambrian formation of Gondwana, southeast Amazon craton‏
670 ‎‡a Author's Depósitos de plataforma mista, Neocarbonífero da Bacia do Amazonas, região de Uruará, estado do Pará‏
670 ‎‡a Author's Depósitos flúvio-costeiros da formação raizama, Ediacarano-Cambriano da faixa Paraguai norte, região de nobres, Mato Grosso, Brasil‏
670 ‎‡a Author's Depósitos sedimentares neoproterozoicos do Grupo Tucuruí - Cinturão Araguaia, Nordeste do Pará‏
670 ‎‡a Author's Ediacaran-Cambrian microbialites of the Southern Amazon Craton: relation with the metazoan rise, sea-level changes, and global tectonics‏
670 ‎‡a Author's Ediacaran ramp depositional model of the Tamengo Formation, Brazil‏
670 ‎‡a Author's Environmental changes in the western Amazônia: morphological framework, geochemistry, palynology and radiocarbon dating data‏
670 ‎‡a Author's Evidence for the Central Atlantic magmatic province (CAMP) in Precambrian and Phanerozoic sedimentary basins of the southern Amazonian Craton, Brazil‏
670 ‎‡a Author's Evolução de um sistema lacustre árido permiano, parte superior da formação pedra de fogo, borda oeste da bacia do Parnaíba‏
670 ‎‡a Author's Evolution of Jurassic intertrap deposits in the Parnaíba Basin, northern Brazil: The last sediment-lava interaction linked to the CAMP in West Gondwana‏
670 ‎‡a Author's Famennian glaciation in the eastern side of Parnaíba Basin, Brazil: evidence of advance and retreat of glacier in Cabeças Formation‏
670 ‎‡a Author's Fossil Fungi from Miocene Sedimentary Rocks of the Central and Coastal Amazon Region, North Brazil‏
670 ‎‡a Author's Genesis of poikilotopic zeolite in aeolianites: An example from the Parnaíba Basin, NE Brazil‏
670 ‎‡a Author's High frequency peritidal cycles of the upper Araras Group: Implications for disappearance of the neoproterozoic carbonate platform in southern Amazon Craton‏
670 ‎‡a Author's Ichnologic evidence of a Cambrian age in the southern Amazon Craton: Implications for the onset of the Western Gondwana history‏
670 ‎‡a Author's Identification of a Sturtian cap carbonate in the Neoproterozoic Sete Lagoas carbonate platform, Bambuí Group, Brazil‏
670 ‎‡a Author's Incision and aggradation phases of the Amazon River in central-eastern Amazonia during the late Neogene and Quaternary‏
670 ‎‡a Author's Iron and sulphur isotopes from the Carajás mining province (Pará, Brazil): Implications for the oxidation of the ocean and the atmosphere across the Archaean–Proterozoic transition‏
670 ‎‡a Author's Lake cyclicity as response to thermal subsidence: A post-CAMP scenario in the Parnaíba Basin, NE Brazil‏
670 ‎‡a Author's Late Pleistocene sea-level changes recorded in tidal and fluvial deposits from Itaubal Formation, onshore portion of the Foz do Amazonas Basin, Brazil‏
670 ‎‡a Author's Life in the aftermath of Marinoan glaciation: The giant stromatolite evolution in the Puga cap carbonate, southern Amazon Craton, Brazil‏
670 ‎‡a Author's Mesozoic lacustrine system in the Parnaíba Basin, northeastern Brazil: Paleogeographic implications for west Gondwana‏
670 ‎‡a Author's Microfacies, diagenesis and hydrocarbon potential of the Neoproterozoic cap carbonate of the southern Amazon Craton‏
670 ‎‡a Author's Mid- and late-Holocene sedimentary process and palaeovegetation changes near the mouth of the Amazon River‏
670 ‎‡a Author's Multi-approach provenance in stratigraphy: Implications for the Upper Mesozoic evolution of the Parnaíba Basin, NE Brazil‏
670 ‎‡a Author's Multiple sulfur isotope evidence for massive oceanic sulfate depletion in the aftermath of Snowball Earth‏
670 ‎‡a Author's Neogene–Quaternary sedimentary and paleovegetation history of the eastern Solimões Basin, central Amazon region‏
670 ‎‡a Author's Neogene sharks and rays from the Brazilian 'Blue Amazon'.‏
670 ‎‡a Author's New stratigraphic proposal of a Paleoproterozoic siliciclastic succession: Implications for the evolution of the Carajás Basin, Amazonian craton, Brazil‏
670 ‎‡a Author's Ocean redox structure across the Late Neoproterozoic Oxygenation Event: A nitrogen isotope perspective‏
670 ‎‡a Author's Organic matter in the Neoproterozoic cap carbonate from the Amazonian Craton, Brazil‏
670 ‎‡a Author's Ostracods biostratigraphy of the Oligocene-Miocene carbonate platform in the Northeastern Amazonia coast and its correlation with the Caribbean region‏
670 ‎‡a Author's Palaeontological framework from Pirabas Formation (North Brazil) used as potential model for equatorial carbonate platform‏
670 ‎‡a Author's Paleoenvironment, chemostratigraphy, and age of Pennsylvanian carbonate platform succession of the Amazonas basin, northern Brazil, Uruará region‏
670 ‎‡a Author's Paleoenvironmental reconstruction of the Ediacaran Araras platform‏
670 ‎‡a Author's Paleoenvironmental reconstruction of the Ediacaran Araras platform (Western Brazil) from the sedimentary and trace metals record‏
670 ‎‡a Author's Palynology of the Middle Miocene—Pliocene Novo Remanso Formation, Central Amazonia, Brazil‏
670 ‎‡a Author's Palynostratigraphy and sedimentary facies of Middle Miocene fluvial deposits of the Amazonas Basin, Brazil‏
670 ‎‡a Author's Pennsylvanian mixed siliciclastic-carbonate deposits of the Amazonas basin, North of Brazil: The record of an epicontinental sea in Western Gondwana‏
670 ‎‡a Author's Permian paleogeography of west-central Pangea: Reconstruction using sabkha-type gypsum-bearing deposits of Parnaíba Basin, Northern Brazil‏
670 ‎‡a Author's Postglacial transgressive shales of Upper Devonian–Lower Carboniferous boundary of the Parnaíba Basin‏
670 ‎‡a Author's Provenance of Miocene-Pleistocene siliciclastic deposits in the Eastern Amazonia coast (Brazil) and paleogeographic implications‏
670 ‎‡a Author's Provenance of Upper Pennsylvanian siliciclastic‐carbonate deposits from the Monte Alegre and Itaituba formations, North Brazil: An integrated study of sandstone petrography, heavy mineral analysis and garnet geochemistry‏
670 ‎‡a Author's Recent effects of tidal and hydro‐meteorological changes on coastal plains near the mouth of the Amazon River‏
670 ‎‡a Author's Reconstituição paleoambiental das formações Motuca e Sambaíba, Permo-Triássico da Bacia do Parnaíba no sudoeste do Estado do Maranhão, Brasil‏
670 ‎‡a Author's Register of increasing continentalization and palaeoenvironmental changes in the west-central pangaea during the Permian-Triassic, Parnaíba Basin, Northern Brazil‏
670 ‎‡a Author's Remote sensing-based analysis of the planform changes in the Upper Amazon River over the period 1986–2006‏
670 ‎‡a Author's Sedimentological and provenance response to Cambrian closure of the Clymene ocean: The upper Alto Paraguai Group, Paraguay belt, Brazil‏
670 ‎‡a Author's Serra Sul diamictite of the Carajás Basin (Brazil): A Paleoproterozoic glaciation on the Amazonian craton‏
670 ‎‡a Author's Shallow lacustrine system of the Permian Pedra de Fogo Formation, Western Gondwana, Parnaíba Basin, Brazil‏
670 ‎‡a Author's Soft-sediment deformation at the base of the Neoproterozoic Puga cap carbonate (southwestern Amazon craton, Brazil): Confirmation of rapid icehouse to greenhouse transition in snowball Earth‏
670 ‎‡a Author's Sr isotope geochemistry and Pb–Pb geochronology of the Neoproterozoic cap carbonates, Tangará da Serra, Brazil‏
670 ‎‡a Author's Sr–Nd isotopic constraints on carbonates, conodonts, and brachiopods of Early-Middle Pennsylvanian Itaituba and Nova Olinda formations, Amazonas Basin, Brazil‏
670 ‎‡a Author's Synsedimentary deformation and the paleoseismic record in Marinoan cap carbonate of the southern Amazon Craton, Brazil‏
670 ‎‡a Author's Taphonomy of lacustrine fish fossils of the Parnaíba Basin, northeastern Brazil: Spatial and causative relations of Konservat Lagerstätten in West Gondwana during Jurassic-Cretaceous‏
670 ‎‡a Author's The anastomosing pattern and the extensively distributed scroll bars in the middle Amazon River‏
670 ‎‡a Author's The crustaceans burrow Sinusichnus sinuosus from the Oligocene-Miocene carbonate deposits of eastern Amazonia‏
670 ‎‡a Author's The new occurrence of Marinoan cap carbonate in Brazil: The expansion of snowball Earth events to the southwesternmost Amazon Craton‏
670 ‎‡a Author's The Silurian glaciation in the eastern Parnaíba Basin, Brazil: paleoenvironment, sequence stratigraphy and insights for the evolution and paleogeography of West Gondwana‏
670 ‎‡a Author's Traços fósseis dos depósitos marinhos rasos da Formação Pitinga, Siluriano superior da Bacia do Amazonas, Rio Tapajós, PA, Brasil‏
670 ‎‡a Author's Upper Oligocene-Miocene deposits of Eastern Amazonia: Implications for the collapse of Neogene carbonate platforms along the coast of northern Brazil‏
670 ‎‡a Author's Waxing and waning of microbial laminites in the aftermath of the Marinoan glaciation at the margin of the Amazon Craton (Brazil)‏
670 ‎‡a wikidata site links‏ ‎‡u https://species.wikipedia.org/wiki/Afonso_Nogueira‏
909 ‎‡a (orcid) 0000000252259255‏ ‎‡9 1‏
909 ‎‡a (scopus) 7102266172‏ ‎‡9 1‏
919 ‎‡a silurianglaciationintheeasternparnaibabasinbrazilpaleoenvironmentsequencestratigraphyandinsightsfortheevolutionandpaleogeographyofwestgondwana‏ ‎‡A The Silurian glaciation in the eastern Parnaíba Basin, Brazil: paleoenvironment, sequence stratigraphy and insights for the evolution and paleogeography of West Gondwana‏ ‎‡9 1‏
919 ‎‡a tracosfosseis2depositosmarinhosrasosdaformacaopitingasilurianosuperiordabaciadoamazonasriotapajospabrasil‏ ‎‡A Traços fósseis dos depósitos marinhos rasos da Formação Pitinga, Siluriano superior da Bacia do Amazonas, Rio Tapajós, PA, Brasil‏ ‎‡9 1‏
919 ‎‡a waxingandwaningofmicrobiallaminitesintheaftermathofthemarinoanglaciationatthemarginoftheamazoncratonbrazil‏ ‎‡A Waxing and waning of microbial laminites in the aftermath of the Marinoan glaciation at the margin of the Amazon Craton (Brazil)‏ ‎‡9 1‏
919 ‎‡a upperoligocenemiocenedepositsofeasternamazoniaimplicationsforthecollapseofneogenecarbonateplatformsalongthecoastofnorthernbrazil‏ ‎‡A Upper Oligocene-Miocene deposits of Eastern Amazonia: Implications for the collapse of Neogene carbonate platforms along the coast of northern Brazil‏ ‎‡9 1‏
919 ‎‡a palaeobiogeographicmodelforbioticdiversificationwithinamazoniaoverthepast3millionyears‏ ‎‡A A palaeobiogeographic model for biotic diversification within Amazonia over the past three million years‏ ‎‡9 1‏
919 ‎‡a redalgalbloomintheaftermathofthemarinoansnowballearth‏ ‎‡A A red algal bloom in the aftermath of the Marinoan Snowball Earth‏ ‎‡9 1‏
919 ‎‡a secaotipodaformacaoserradoquilombogrupoararasneoproterozoicodafaixaparaguainortematogrosso‏ ‎‡A A seção-tipo da Formação Serra do Quilombo, Grupo Araras, Neoproterozoico da Faixa Paraguai Norte, Mato Grosso‏ ‎‡9 1‏
919 ‎‡a aliphaticandaromaticbiomarkersofthedevoniansourcerocksfromthewesternparnaibabasinbrazilpimenteirasformation‏ ‎‡A Aliphatic and aromatic biomarkers of the Devonian source rocks from the Western Parnaíba Basin Brazil: Pimenteiras Formation‏ ‎‡9 1‏
919 ‎‡a analisefaciologicadaformacaoalterdochaocretaceobaciadoamazonasproximoacidadedeobidosparabrasil‏ ‎‡A Análise faciológica da Formação Alter do Chão (Cretáceo, Bacia do Amazonas), próximo à cidade de Óbidos, Pará, Brasil‏ ‎‡9 1‏
919 ‎‡a ariidseacatfishesfromthecoevalpirabasnortheasternbrazilcantaurecastillonorthwesternvenezuelaandcastilletesnorthcolombiaformationsearlymiocenewithdescriptionof3newspecies‏ ‎‡A Ariid sea catfishes from the coeval Pirabas (Northeastern Brazil), Cantaure, Castillo (Northwestern Venezuela), and Castilletes (North Colombia) formations (early Miocene), with description of three new species‏ ‎‡9 1‏
919 ‎‡a carbonandoxygenisotopegeochemistryofediacaranouterplatformcarbonatesparaguaybeltcentralbrazil‏ ‎‡A Carbon and oxygen isotope geochemistry of Ediacaran outer platform carbonates, Paraguay Belt, central Brazil‏ ‎‡9 1‏
919 ‎‡a carbonandstrontiumisotopefluctuationsandpaleoceanographicchangesinthelateneoproterozoicararascarbonateplatformsouthernamazoncratonbrazil‏ ‎‡A Carbon and strontium isotope fluctuations and paleoceanographic changes in the late Neoproterozoic Araras carbonate platform, southern Amazon craton, Brazil‏ ‎‡9 1‏
919 ‎‡a carbonateclasticsedimentationintheparnaibabasinnorthernbrazilrecordofcarboniferousepeiricseainthewesterngondwana‏ ‎‡A Carbonate-clastic sedimentation in the Parnaiba Basin, northern Brazil: Record of carboniferous epeiric sea in the Western Gondwana‏ ‎‡9 1‏
919 ‎‡a closingtheclymeneoceanandbendingabrasilianobeltevidenceforthecambrianformationofgondwanasoutheastamazoncraton‏ ‎‡A Closing the Clymene ocean and bending a Brasiliano belt: Evidence for the Cambrian formation of Gondwana, southeast Amazon craton‏ ‎‡9 1‏
919 ‎‡a depositosdeplataformamistaneocarboniferodabaciadoamazonasregiaodeuruaraestadodopara‏ ‎‡A Depósitos de plataforma mista, Neocarbonífero da Bacia do Amazonas, região de Uruará, estado do Pará‏ ‎‡9 1‏
919 ‎‡a depositosfluviocosteirosdaformacaoraizamaediacaranocambrianodafaixaparaguainorteregiaodenobresmatogrossobrasil‏ ‎‡A Depósitos flúvio-costeiros da formação raizama, Ediacarano-Cambriano da faixa Paraguai norte, região de nobres, Mato Grosso, Brasil‏ ‎‡9 1‏
919 ‎‡a depositossedimentaresneoproterozoicosdogrupotucuruicinturaoaraguaianordestedopara‏ ‎‡A Depósitos sedimentares neoproterozoicos do Grupo Tucuruí - Cinturão Araguaia, Nordeste do Pará‏ ‎‡9 1‏
919 ‎‡a ediacarancambrianmicrobialitesofthesouthernamazoncratonrelationwiththemetazoanrisesealevelchangesandglobaltectonics‏ ‎‡A Ediacaran-Cambrian microbialites of the Southern Amazon Craton: relation with the metazoan rise, sea-level changes, and global tectonics‏ ‎‡9 1‏
919 ‎‡a ediacaranrampdepositionalmodelofthetamengoformationbrazil‏ ‎‡A Ediacaran ramp depositional model of the Tamengo Formation, Brazil‏ ‎‡9 1‏
919 ‎‡a environmentalchangesinthewesternamazoniamorphologicalframeworkgeochemistrypalynologyandradiocarbondatingdata‏ ‎‡A Environmental changes in the western Amazônia: morphological framework, geochemistry, palynology and radiocarbon dating data‏ ‎‡9 1‏
919 ‎‡a evidenceforthecentralatlanticmagmaticprovincecampinprecambrianandphanerozoicsedimentarybasinsofthesouthernamazoniancratonbrazil‏ ‎‡A Evidence for the Central Atlantic magmatic province (CAMP) in Precambrian and Phanerozoic sedimentary basins of the southern Amazonian Craton, Brazil‏ ‎‡9 1‏
919 ‎‡a evolucaodeumsistemalacustrearidopermianopartesuperiordaformacaopedradefogobordaoestedabaciadoparnaiba‏ ‎‡A Evolução de um sistema lacustre árido permiano, parte superior da formação pedra de fogo, borda oeste da bacia do Parnaíba‏ ‎‡9 1‏
919 ‎‡a evolutionofjurassicintertrapdepositsintheparnaibabasinnorthernbrazilthelastsedimentlavainteractionlinkedtothecampinwestgondwana‏ ‎‡A Evolution of Jurassic intertrap deposits in the Parnaíba Basin, northern Brazil: The last sediment-lava interaction linked to the CAMP in West Gondwana‏ ‎‡9 1‏
919 ‎‡a famennianglaciationintheeasternsideofparnaibabasinbrazilevidenceofadvanceandretreatofglacierincabecasformation‏ ‎‡A Famennian glaciation in the eastern side of Parnaíba Basin, Brazil: evidence of advance and retreat of glacier in Cabeças Formation‏ ‎‡9 1‏
919 ‎‡a fossilfungifrommiocenesedimentaryrocksofthecentralandcoastalamazonregionnorthbrazil‏ ‎‡A Fossil Fungi from Miocene Sedimentary Rocks of the Central and Coastal Amazon Region, North Brazil‏ ‎‡9 1‏
919 ‎‡a genesisofpoikilotopiczeoliteinaeolianitesanexamplefromtheparnaibabasinnebrazil‏ ‎‡A Genesis of poikilotopic zeolite in aeolianites: An example from the Parnaíba Basin, NE Brazil‏ ‎‡9 1‏
919 ‎‡a highfrequencyperitidalcyclesoftheupperararasgroupimplicationsfordisappearanceoftheneoproterozoiccarbonateplatforminsouthernamazoncraton‏ ‎‡A High frequency peritidal cycles of the upper Araras Group: Implications for disappearance of the neoproterozoic carbonate platform in southern Amazon Craton‏ ‎‡9 1‏
919 ‎‡a ichnologicevidenceofacambrianageinthesouthernamazoncratonimplicationsfortheonsetofthewesterngondwanahistory‏ ‎‡A Ichnologic evidence of a Cambrian age in the southern Amazon Craton: Implications for the onset of the Western Gondwana history‏ ‎‡9 1‏
919 ‎‡a identificationofasturtiancapcarbonateintheneoproterozoicsetelagoascarbonateplatformbambuigroupbrazil‏ ‎‡A Identification of a Sturtian cap carbonate in the Neoproterozoic Sete Lagoas carbonate platform, Bambuí Group, Brazil‏ ‎‡9 1‏
919 ‎‡a incisionandaggradationphasesoftheamazonriverincentraleasternamazoniaduringthelateneogeneandquaternary‏ ‎‡A Incision and aggradation phases of the Amazon River in central-eastern Amazonia during the late Neogene and Quaternary‏ ‎‡9 1‏
919 ‎‡a ironandsulphurisotopesfromthecarajasminingprovinceparabrazilimplicationsfortheoxidationoftheoceanandtheatmosphereacrossthearchaeanproterozoictransition‏ ‎‡A Iron and sulphur isotopes from the Carajás mining province (Pará, Brazil): Implications for the oxidation of the ocean and the atmosphere across the Archaean–Proterozoic transition‏ ‎‡9 1‏
919 ‎‡a lakecyclicityasresponsetothermalsubsidenceapostcampscenariointheparnaibabasinnebrazil‏ ‎‡A Lake cyclicity as response to thermal subsidence: A post-CAMP scenario in the Parnaíba Basin, NE Brazil‏ ‎‡9 1‏
919 ‎‡a latepleistocenesealevelchangesrecordedintidalandfluvialdepositsfromitaubalformationonshoreportionofthefozdoamazonasbasinbrazil‏ ‎‡A Late Pleistocene sea-level changes recorded in tidal and fluvial deposits from Itaubal Formation, onshore portion of the Foz do Amazonas Basin, Brazil‏ ‎‡9 1‏
919 ‎‡a lifeintheaftermathofmarinoanglaciationthegiantstromatoliteevolutioninthepugacapcarbonatesouthernamazoncratonbrazil‏ ‎‡A Life in the aftermath of Marinoan glaciation: The giant stromatolite evolution in the Puga cap carbonate, southern Amazon Craton, Brazil‏ ‎‡9 1‏
919 ‎‡a mesozoiclacustrinesystemintheparnaibabasinnortheasternbrazilpaleogeographicimplicationsforwestgondwana‏ ‎‡A Mesozoic lacustrine system in the Parnaíba Basin, northeastern Brazil: Paleogeographic implications for west Gondwana‏ ‎‡9 1‏
919 ‎‡a microfaciesdiagenesisandhydrocarbonpotentialoftheneoproterozoiccapcarbonateofthesouthernamazoncraton‏ ‎‡A Microfacies, diagenesis and hydrocarbon potential of the Neoproterozoic cap carbonate of the southern Amazon Craton‏ ‎‡9 1‏
919 ‎‡a midandlateholocenesedimentaryprocessandpalaeovegetationchangesnearthemouthoftheamazonriver‏ ‎‡A Mid- and late-Holocene sedimentary process and palaeovegetation changes near the mouth of the Amazon River‏ ‎‡9 1‏
919 ‎‡a multiapproachprovenanceinstratigraphyimplicationsfortheuppermesozoicevolutionoftheparnaibabasinnebrazil‏ ‎‡A Multi-approach provenance in stratigraphy: Implications for the Upper Mesozoic evolution of the Parnaíba Basin, NE Brazil‏ ‎‡9 1‏
919 ‎‡a multiplesulfurisotopeevidenceformassiveoceanicsulfatedepletionintheaftermathofsnowballearth‏ ‎‡A Multiple sulfur isotope evidence for massive oceanic sulfate depletion in the aftermath of Snowball Earth‏ ‎‡9 1‏
919 ‎‡a neogenequaternarysedimentaryandpaleovegetationhistoryoftheeasternsolimoesbasincentralamazonregion‏ ‎‡A Neogene–Quaternary sedimentary and paleovegetation history of the eastern Solimões Basin, central Amazon region‏ ‎‡9 1‏
919 ‎‡a neogenesharksandraysfromthebrazilianblueamazon‏ ‎‡A Neogene sharks and rays from the Brazilian 'Blue Amazon'.‏ ‎‡9 1‏
919 ‎‡a newstratigraphicproposalofapaleoproterozoicsiliciclasticsuccessionimplicationsfortheevolutionofthecarajasbasinamazoniancratonbrazil‏ ‎‡A New stratigraphic proposal of a Paleoproterozoic siliciclastic succession: Implications for the evolution of the Carajás Basin, Amazonian craton, Brazil‏ ‎‡9 1‏
919 ‎‡a oceanredoxstructureacrossthelateneoproterozoicoxygenationeventanitrogenisotopeperspective‏ ‎‡A Ocean redox structure across the Late Neoproterozoic Oxygenation Event: A nitrogen isotope perspective‏ ‎‡9 1‏
919 ‎‡a organicmatterintheneoproterozoiccapcarbonatefromtheamazoniancratonbrazil‏ ‎‡A Organic matter in the Neoproterozoic cap carbonate from the Amazonian Craton, Brazil‏ ‎‡9 1‏
919 ‎‡a ostracodsbiostratigraphyoftheoligocenemiocenecarbonateplatforminthenortheasternamazoniacoastanditscorrelationwiththecaribbeanregion‏ ‎‡A Ostracods biostratigraphy of the Oligocene-Miocene carbonate platform in the Northeastern Amazonia coast and its correlation with the Caribbean region‏ ‎‡9 1‏
919 ‎‡a palaeontologicalframeworkfrompirabasformationnorthbrazilusedaspotentialmodelforequatorialcarbonateplatform‏ ‎‡A Palaeontological framework from Pirabas Formation (North Brazil) used as potential model for equatorial carbonate platform‏ ‎‡9 1‏
919 ‎‡a paleoenvironmentchemostratigraphyandageofpennsylvaniancarbonateplatformsuccessionoftheamazonasbasinnorthernbraziluruararegion‏ ‎‡A Paleoenvironment, chemostratigraphy, and age of Pennsylvanian carbonate platform succession of the Amazonas basin, northern Brazil, Uruará region‏ ‎‡9 1‏
919 ‎‡a paleoenvironmentalreconstructionoftheediacaranararasplatform‏ ‎‡A Paleoenvironmental reconstruction of the Ediacaran Araras platform‏ ‎‡9 1‏
919 ‎‡a paleoenvironmentalreconstructionoftheediacaranararasplatformwesternbrazilfromthesedimentaryandtracemetalsrecord‏ ‎‡A Paleoenvironmental reconstruction of the Ediacaran Araras platform (Western Brazil) from the sedimentary and trace metals record‏ ‎‡9 1‏
919 ‎‡a palynologyofthemiddlemiocenepliocenenovoremansoformationcentralamazoniabrazil‏ ‎‡A Palynology of the Middle Miocene—Pliocene Novo Remanso Formation, Central Amazonia, Brazil‏ ‎‡9 1‏
919 ‎‡a palynostratigraphyandsedimentaryfaciesofmiddlemiocenefluvialdepositsoftheamazonasbasinbrazil‏ ‎‡A Palynostratigraphy and sedimentary facies of Middle Miocene fluvial deposits of the Amazonas Basin, Brazil‏ ‎‡9 1‏
919 ‎‡a pennsylvanianmixedsiliciclasticcarbonatedepositsoftheamazonasbasinnorthofbraziltherecordofanepicontinentalseainwesterngondwana‏ ‎‡A Pennsylvanian mixed siliciclastic-carbonate deposits of the Amazonas basin, North of Brazil: The record of an epicontinental sea in Western Gondwana‏ ‎‡9 1‏
919 ‎‡a permianpaleogeographyofwestcentralpangeareconstructionusingsabkhatypegypsumbearingdepositsofparnaibabasinnorthernbrazil‏ ‎‡A Permian paleogeography of west-central Pangea: Reconstruction using sabkha-type gypsum-bearing deposits of Parnaíba Basin, Northern Brazil‏ ‎‡9 1‏
919 ‎‡a postglacialtransgressiveshalesofupperdevonianlowercarboniferousboundaryoftheparnaibabasin‏ ‎‡A Postglacial transgressive shales of Upper Devonian–Lower Carboniferous boundary of the Parnaíba Basin‏ ‎‡9 1‏
919 ‎‡a provenanceofmiocenepleistocenesiliciclasticdepositsintheeasternamazoniacoastbrazilandpaleogeographicimplications‏ ‎‡A Provenance of Miocene-Pleistocene siliciclastic deposits in the Eastern Amazonia coast (Brazil) and paleogeographic implications‏ ‎‡9 1‏
919 ‎‡a provenanceofupperpennsylvaniansiliciclasticcarbonatedepositsfromthemontealegreanditaitubaformationsnorthbrazilanintegratedstudyofsandstonepetrographyheavymineralanalysisandgarnetgeochemistry‏ ‎‡A Provenance of Upper Pennsylvanian siliciclastic‐carbonate deposits from the Monte Alegre and Itaituba formations, North Brazil: An integrated study of sandstone petrography, heavy mineral analysis and garnet geochemistry‏ ‎‡9 1‏
919 ‎‡a recenteffectsoftidalandhydrometeorologicalchangesoncoastalplainsnearthemouthoftheamazonriver‏ ‎‡A Recent effects of tidal and hydro‐meteorological changes on coastal plains near the mouth of the Amazon River‏ ‎‡9 1‏
919 ‎‡a reconstituicaopaleoambientaldasformacoesmotucaesambaibapermotriassicodabaciadoparnaibanosudoestedoestadodomaranhaobrasil‏ ‎‡A Reconstituição paleoambiental das formações Motuca e Sambaíba, Permo-Triássico da Bacia do Parnaíba no sudoeste do Estado do Maranhão, Brasil‏ ‎‡9 1‏
919 ‎‡a registerofincreasingcontinentalizationandpalaeoenvironmentalchangesinthewestcentralpangaeaduringthepermiantriassicparnaibabasinnorthernbrazil‏ ‎‡A Register of increasing continentalization and palaeoenvironmental changes in the west-central pangaea during the Permian-Triassic, Parnaíba Basin, Northern Brazil‏ ‎‡9 1‏
919 ‎‡a remotesensingbasedanalysisoftheplanformchangesintheupperamazonriverovertheperiod1986‏ ‎‡A Remote sensing-based analysis of the planform changes in the Upper Amazon River over the period 1986–2006‏ ‎‡9 1‏
919 ‎‡a sedimentologicalandprovenanceresponsetocambrianclosureoftheclymeneoceantheupperaltoparaguaigroupparaguaybeltbrazil‏ ‎‡A Sedimentological and provenance response to Cambrian closure of the Clymene ocean: The upper Alto Paraguai Group, Paraguay belt, Brazil‏ ‎‡9 1‏
919 ‎‡a serrasuldiamictiteofthecarajasbasinbrazilapaleoproterozoicglaciationontheamazoniancraton‏ ‎‡A Serra Sul diamictite of the Carajás Basin (Brazil): A Paleoproterozoic glaciation on the Amazonian craton‏ ‎‡9 1‏
919 ‎‡a shallowlacustrinesystemofthepermianpedradefogoformationwesterngondwanaparnaibabasinbrazil‏ ‎‡A Shallow lacustrine system of the Permian Pedra de Fogo Formation, Western Gondwana, Parnaíba Basin, Brazil‏ ‎‡9 1‏
919 ‎‡a softsedimentdeformationatthebaseoftheneoproterozoicpugacapcarbonatesouthwesternamazoncratonbrazilconfirmationofrapidicehousetogreenhousetransitioninsnowballearth‏ ‎‡A Soft-sediment deformation at the base of the Neoproterozoic Puga cap carbonate (southwestern Amazon craton, Brazil): Confirmation of rapid icehouse to greenhouse transition in snowball Earth‏ ‎‡9 1‏
919 ‎‡a srisotopegeochemistryandpbpbgeochronologyoftheneoproterozoiccapcarbonatestangaradaserrabrazil‏ ‎‡A Sr isotope geochemistry and Pb–Pb geochronology of the Neoproterozoic cap carbonates, Tangará da Serra, Brazil‏ ‎‡9 1‏
919 ‎‡a srndisotopicconstraintsoncarbonatesconodontsandbrachiopodsofearlymiddlepennsylvanianitaitubaandnovaolindaformationsamazonasbasinbrazil‏ ‎‡A Sr–Nd isotopic constraints on carbonates, conodonts, and brachiopods of Early-Middle Pennsylvanian Itaituba and Nova Olinda formations, Amazonas Basin, Brazil‏ ‎‡9 1‏
919 ‎‡a synsedimentarydeformationandthepaleoseismicrecordinmarinoancapcarbonateofthesouthernamazoncratonbrazil‏ ‎‡A Synsedimentary deformation and the paleoseismic record in Marinoan cap carbonate of the southern Amazon Craton, Brazil‏ ‎‡9 1‏
919 ‎‡a taphonomyoflacustrinefishfossilsoftheparnaibabasinnortheasternbrazilspatialandcausativerelationsofkonservatlagerstatteninwestgondwanaduringjurassiccretaceous‏ ‎‡A Taphonomy of lacustrine fish fossils of the Parnaíba Basin, northeastern Brazil: Spatial and causative relations of Konservat Lagerstätten in West Gondwana during Jurassic-Cretaceous‏ ‎‡9 1‏
919 ‎‡a anastomosingpatternandtheextensivelydistributedscrollbarsinthemiddleamazonriver‏ ‎‡A The anastomosing pattern and the extensively distributed scroll bars in the middle Amazon River‏ ‎‡9 1‏
919 ‎‡a crustaceansburrowsinusichnussinuosusfromtheoligocenemiocenecarbonatedepositsofeasternamazonia‏ ‎‡A The crustaceans burrow Sinusichnus sinuosus from the Oligocene-Miocene carbonate deposits of eastern Amazonia‏ ‎‡9 1‏
919 ‎‡a newoccurrenceofmarinoancapcarbonateinbraziltheexpansionofsnowballeartheventstothesouthwesternmostamazoncraton‏ ‎‡A The new occurrence of Marinoan cap carbonate in Brazil: The expansion of snowball Earth events to the southwesternmost Amazon Craton‏ ‎‡9 1‏
943 ‎‡a 200x‏ ‎‡A 2006‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 SUDOC|153172614‏
996 ‎‡2 PTBNP|1688722‏
996 ‎‡2 LC|n 00004041‏
996 ‎‡2 PTBNP|1451173‏
996 ‎‡2 NTA|197636985‏
996 ‎‡2 BNF|14524947‏
996 ‎‡2 J9U|987007422243505171‏
996 ‎‡2 NUKAT|n 2011074266‏
996 ‎‡2 BIBSYS|3014633‏
996 ‎‡2 RERO|A003643708‏
996 ‎‡2 NKC|skuk0004335‏
996 ‎‡2 ISNI|0000000114462730‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏