VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q29109811 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235808.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q29109811‏
024 ‎‡a 0000-0002-7843-8438‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q29109811‏
043 ‎‡c AU‏
100 0 ‎‡a Steven J.B. Cooper‏ ‎‡9 fr‏ ‎‡9 ast‏ ‎‡9 ca‏ ‎‡9 it‏ ‎‡9 sl‏ ‎‡9 sq‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Steven J.B. Cooper‏ ‎‡c Australian zoologist‏ ‎‡9 en‏
400 0 ‎‡a Steven J.B. Cooper‏ ‎‡c zoöloog uit Australië‏ ‎‡9 nl‏
400 0 ‎‡a Steven J.B. Cooper‏ ‎‡c crústeolaí Astrálach‏ ‎‡9 ga‏
400 0 ‎‡a Steven J.B. Cooper‏ ‎‡c zoólogo australiano‏ ‎‡9 es‏
670 ‎‡a Author's A highly modified stygobiont diving beetle of the genus Copelatus (Coleoptera, Dytiscidae): taxonomy and cladistic analysis based on mitochondrial DNA sequences‏
670 ‎‡a Author's A molecular and morphological investigation of species boundaries and phylogenetic relationships in Australian free-tailed bats Mormopterus (Chiroptera: Molossidae)‏
670 ‎‡a Author's A new genus, Perplexacara, and new generic placements of species of Australian marsh beetles (Coleoptera: Scirtidae) based on morphology and molecular genetic data‏
670 ‎‡a Author's Across the Indian Ocean: A remarkable example of trans-oceanic dispersal in an austral mygalomorph spider‏
670 ‎‡a Author's An extension to the known distribution of the squirrel glider Petaurus norfolcensis in Australia.‏
670 ‎‡a Author's Assessment of prey overlap between a native‏
670 ‎‡a Author's Assessment of prey overlap between a native (Polistes humilis) and an introduced (Vespula germanica) social wasp using morphology and phylogenetic analyses of 16S rDNA.‏
670 ‎‡a Author's Biogeographic barriers in north-western Australia: an overview and standardisation of nomenclature‏
670 ‎‡a Author's Biogeographic history of subterranean isopods from groundwater calcrete islands in Western Australia‏
670 ‎‡a Author's Brazilian cave heritage under siege‏
670 ‎‡a Author's Burrow use by bilbies in temperate South Australia‏
670 ‎‡a Author's Characterization of nine microsatellite loci from the endangered southern brown bandicoot‏
670 ‎‡a Author's Characterization of nine microsatellite loci from the endangered southern brown bandicoot (Isoodon obesulus) using 454 pyrosequencing‏
670 ‎‡a Author's Chromosomal Speciation Revisited: Modes of Diversification in Australian Morabine Grasshoppers (Vandiemenella, viatica Species Group)‏
670 ‎‡a Author's Comparative analysis of morabine grasshopper genomes reveals highly abundant transposable elements and rapidly proliferating satellite DNA repeats‏
670 ‎‡a Author's Comparative Population Genetic Structure of the Endangered Southern Brown Bandicoot, Isoodon obesulus, in Fragmented Landscapes of Southern Australia‏
670 ‎‡a Author's Conservation systematics of the shield-backed trapdoor spiders of the -group (Mygalomorphae, Idiopidae, ): integrative taxonomy reveals a diverse and threatened fauna from south-western Australia‏
670 ‎‡a Author's Conservation systematics of the shield-backed trapdoor spiders of the nigrum-group (Mygalomorphae, Idiopidae, Idiosoma): integrative taxonomy reveals a diverse and threatened fauna from south-western Australia‏
670 ‎‡a Author's Corrigendum to: Cryptic diversity down under: defining species in the subterranean amphipod genus Nedsia Barnard & Williams, 1995 (Hadzioidea: Eriopisidae) from the Pilbara, Western Australia‏
670 ‎‡a Author's Cryptic diversity down under: defining species in the subterranean amphipod genus‏
670 ‎‡a Author's Cryptic grey-bellied dunnart (Sminthopsis griseoventer) discovered in South Australia: genetic, morphological and subfossil analyses show the value of collecting voucher material‏
670 ‎‡a Author's Cutaneous respiration by diving beetles from underground aquifers of Western Australia (Coleoptera: Dytiscidae)‏
670 ‎‡a Author's Deep phylogeographic structuring of populations of the trapdoor spider Moggridgea tingle (Migidae) from southwestern Australia: evidence for long-term refugia within refugia‏
670 ‎‡a Author's Delineation of conservation units in an endangered marsupial, the southern brown bandicoot (Isoodon obesulus obesulus), in South Australia/western Victoria, Australia‏
670 ‎‡a Author's Desert springs: deep phylogeographic structure in an ancient endemic crustacean (Phreatomerus latipes)‏
670 ‎‡a Author's Development and evaluation of a custom bait design based on 469 single-copy protein-coding genes for exon capture of isopods (Philosciidae: Haloniscus)‏
670 ‎‡a Author's Development of 16 microsatellite loci for the endangered sandhill dunnart‏
670 ‎‡a Author's Development of 16 microsatellite loci for the endangered sandhill dunnart (Sminthopsis psammophila)‏
670 ‎‡a Author's Development of a multiplex panel of microsatellite markers for two species of gliding marsupials, Petaurus breviceps and Petaurus norfolcensis‏
670 ‎‡a Author's Difficulties barcoding in the dark: the case of crustacean stygofauna from eastern Australia‏
670 ‎‡a Author's Divergent molecular lineages and not-so-cryptic species: the first descriptions of stygobitic chiltoniid amphipods‏
670 ‎‡a Author's Divergent molecular lineages and not-so-cryptic species: the first descriptions of stygobitic chiltoniid amphipods (Talitroidea: Chiltoniidae) from Western Australia‏
670 ‎‡a Author's Diversity and distribution of groundwater fauna in a calcrete aquifer: does sampling method influence the story?‏
670 ‎‡a Author's Diversity patterns of subterranean invertebrate fauna in calcretes of the Yilgarn Region, Western Australia‏
670 ‎‡a Author's DNA barcoding of microgastrine parasitoid wasps (Hymenoptera: Braconidae) using high-throughput methods more than doubles the number of species known for Australia‏
670 ‎‡a Author's DNA barcoding of stygofauna uncovers cryptic amphipod diversity in a calcrete aquifer in Western Australia's arid zone‏
670 ‎‡a Author's Effects of landscape matrix on population connectivity of an arboreal mammal, Petaurus breviceps‏
670 ‎‡a Author's Evidence for population fragmentation within a subterranean aquatic habitat in the Western Australian desert‏
670 ‎‡a Author's Evidence for speciation underground in diving beetles (Dytiscidae) from a subterranean archipelago‏
670 ‎‡a Author's Evolution in caves: Darwin's 'wrecks of ancient life' in the molecular era.‏
670 ‎‡a Author's Evolution of blind beetles in isolated aquifers: a test of alternative modes of speciation‏
670 ‎‡a Author's Evolution of subterranean diving beetles (Coleoptera: Dytiscidae: Hydroporini, Bidessini) in the arid zone of Australia‏
670 ‎‡a Author's Evolutionary history of the Australasian Scirtinae (Scirtidae; Coleoptera) inferred from ultraconserved elements‏
670 ‎‡a Author's Evolutionary transition from surface to subterranean living in Australian water beetles (Coleoptera: Dytiscidae) through adaptive and relaxed selection‏
670 ‎‡a Author's Explosive radiation of the genus Schizopera on a small subterranean island in Western Australia (Copepoda:Harpacticoida): unravelling the cases of cryptic speciation, size differentiation and multiple invasions‏
670 ‎‡a Author's Extreme genetic diversity among springtails (Collembola) in subterranean calcretes of arid Australia‏
670 ‎‡a Author's Fine-scale comparative phylogeography of a sympatric sister species triplet of subterranean diving beetles from a single calcrete aquifer in Western Australia‏
670 ‎‡a Author's Fundamental research questions in subterranean biology‏
670 ‎‡a Author's Genetic analysis of a chromosomal hybrid zone in the Australian morabine grasshoppers (Vandiemenella, viatica species group).‏
670 ‎‡a Author's Genetic elucidation of cryptic and ancient diversity in a group of Australian diplodactyline geckos: the Diplodactylus vittatus complex.‏
670 ‎‡a Author's Genetic structure of the western pygmy possum, Cercartetus concinnus Gould (Marsupialia: Burramyidae) based on mitochondrial DNA‏
670 ‎‡a Author's Groundwater estuaries of salt lakes: buried pools of endemic biodiversity on the western plateau, Australia‏
670 ‎‡a Author's Groundwater is a hidden global keystone ecosystem‏
670 ‎‡a Author's Habitat connectivity, more than species’ biology, influences genetic differentiation in a habitat specialist, the short-eared rock-wallaby (Petrogale brachyotis)‏
670 ‎‡a Author's Habitat use, population dynamics and species identification of mulgara, Dasycercus blythi and D. cristicauda, in a zone of sympatry in central Australia‏
670 ‎‡a Author's High levels of genetic monogamy in the group-living Australian lizard Egernia stokesii.‏
670 ‎‡a Author's How blind are they? Phototactic responses in stygobiont diving beetles (Coleoptera: Dytiscidae) from calcrete aquifers of Western Australia‏
670 ‎‡a Author's Hybrid capture data unravel a rapid radiation of pimpliform parasitoid wasps (Hymenoptera: Ichneumonidae: Pimpliformes)‏
670 ‎‡a Author's Identification of trophic niches of subterranean diving beetles in a calcrete aquifer by DNA and stable isotope analyses‏
670 ‎‡a Author's Intragenomic internal transcribed spacer 2 variation in a genus of parasitoid wasps (Hymenoptera: Braconidae): implications for accurate species delimitation and phylogenetic analysis‏
670 ‎‡a Author's Islands under the desert: molecular systematics and evolutionary origins of stygobitic water beetles (Coleoptera: Dytiscidae) from central Western Australia‏
670 ‎‡a Author's Limited ecological connectivity of an arboreal marsupial across a forest/plantation landscape despite apparent resilience to fragmentation‏
670 ‎‡a Author's Linkage of the beta-like omega-globin gene to alpha-like globin genes in an Australian marsupial supports the chromosome duplication model for separation of globin gene clusters‏
670 ‎‡a Author's Massive Parallel Regression: A Précis of Genetic Mechanisms for Vision Loss in Diving Beetles‏
670 ‎‡a Author's Microsatellite markers for the Common ringtail possum (Pseudocheirus peregrinus) and their amplification in other Pseudocheirids‏
670 ‎‡a Author's Mitochondrial DNA analyses reveal widespread tardigrade diversity in Antarctica‏
670 ‎‡a Author's Molecular evolution of the carboxy terminal region of the zona pellucida 3 glycoprotein in murine rodents‏
670 ‎‡a Author's Molecular phylogenetic analyses reveal a new southern hemisphere oniscidean family‏
670 ‎‡a Author's Molecular phylogenetic analyses reveal a new southern hemisphere oniscidean family (Crustacea: Isopoda) with a unique water transport system‏
670 ‎‡a Author's Molecular phylogenetic, morphological and biogeographic evidence for a new genus of parabathynellid crustaceans (Syncarida: Bathynellacea) from groundwater in an ancient southern Australian landscape‏
670 ‎‡a Author's Molecular phylogenetics of allodapine bees, with implications for the evolution of sociality and progressive rearing‏
670 ‎‡a Author's Molecular phylogenetics of the allodapine bee genus Braunsapis: A-T bias and heterogeneous substitution parameters‏
670 ‎‡a Author's Molecular phylogenetics of the exoneurine allodapine bees reveal an ancient and puzzling dispersal from Africa to Australia‏
670 ‎‡a Author's Molecular phylogeny and historical biogeography of the large carpenter bees, genus Xylocopa (Hymenoptera: Apidae)‏
670 ‎‡a Author's Molecular phylogeny of the small carpenter bees‏
670 ‎‡a Author's Molecular phylogeny of the small carpenter bees (Hymenoptera: Apidae: Ceratinini) indicates early and rapid global dispersal‏
670 ‎‡a Author's Molecular systematics and biodiversity of oniscidean isopods in the groundwater calcretes of central Western Australia‏
670 ‎‡a Author's Molecular systematics and evolutionary origins of the genus Petaurus‏
670 ‎‡a Author's Molecular systematics and evolutionary origins of the genus Petaurus (Marsupialia: Petauridae) in Australia and New Guinea‏
670 ‎‡a Author's Molecular systematics of Australian rhinolophid bats (Chiroptera: Rhinolophidae)‏
670 ‎‡a Author's Monogamy in an Australian arboreal marsupial, the yellow-bellied glider (Petaurus australis)‏
670 ‎‡a Author's Morphological and molecular study of the genus Nitokra (Crustacea, Copepoda, Harpacticoida) in a small palaeochannel in Western Australia‏
670 ‎‡a Author's Multiple biogeographical barriers identified across the monsoon tropics of northern Australia: phylogeographic analysis of the brachyotis group of rock-wallabies‏
670 ‎‡a Author's Naming species with no morphological indicators: species status of Galeolaria caespitosa‏
670 ‎‡a Author's Naming species with no morphological indicators: species status of Galeolaria caespitosa (Annelida:Serpulidae) inferred from nuclear and mitochondrial gene sequences and morphology‏
670 ‎‡a Author's New genera, species and combinations in the Pseudomicrocara Armstrong group (Coleoptera: Scirtidae) based on morphology supported by mitochondrial and nuclear gene sequence data‏
670 ‎‡a Author's New species of Australian microgastrine parasitoid wasps‏
670 ‎‡a Author's New species of Australian microgastrine parasitoid wasps (Hymenoptera: Braconidae: Microgastrinae) documented through the ‘Bush Blitz’ surveys of national reserves‏
670 ‎‡a Author's Opsin transcripts of predatory diving beetles: a comparison of surface and subterranean photic niches‏
670 ‎‡a Author's Patterns of population genetic variation in sympatric chiltoniid amphipods within a calcrete aquifer reveal a dynamic subterranean environment‏
670 ‎‡a Author's Phylogenetic divergence of the Australian allodapine bees (Hymenoptera: Apidae)‏
670 ‎‡a Author's Phylogenetic placement and description of Ngaliadessus humphreysi gen. et sp. nov., Watts & Villastrigo (Coleoptera: Dytiscidae), a subterranean diving beetle from the Ngalia Basin in central Australia‏
670 ‎‡a Author's Phylogenetic relationships in the lizard genus Diplodactylus Gray and resurrection of Lucasium Wermuth (Gekkota, Diplodactylidae)‏
670 ‎‡a Author's Phylogenetic relationships of Australian Scirtidae‏
670 ‎‡a Author's Phylogenetic relationships of Australian Scirtidae (Coleoptera) based on mitochondrial and nuclear sequences‏
670 ‎‡a Author's Phylogenetic relationships of rock-wallabies, Petrogale (Marsupialia: Macropodidae) and their biogeographic history within Australia.‏
670 ‎‡a Author's Phylogenetics of Australian Acacia thrips: the evolution of behaviour and ecology‏
670 ‎‡a Author's Phylogeography of the ancient Parabathynellidae‏
670 ‎‡a Author's Phylogeography of the ancient Parabathynellidae (Crustacea:Bathynellacea) from the Yilgarn region of Western Australia‏
670 ‎‡a Author's Phylogeography of the Australian sugar glider‏
670 ‎‡a Author's Phylogeography of the Australian sugar glider (Petaurus breviceps): evidence for a new divergent lineage in eastern Australia‏
670 ‎‡a Author's Platypus globin genes and flanking loci suggest a new insertional model for beta-globin evolution in birds and mammals‏
670 ‎‡a Author's Plio-Pleistocene diversification and biogeographic barriers in southern Australia reflected in the phylogeography of a widespread and common lizard species‏
670 ‎‡a Author's Population genomic diversity and structure in the golden bandicoot: a history of isolation, extirpation, and conservation‏
670 ‎‡a Author's Post-Eocene climate change across continental Australia and the diversification of Australasian spiny trapdoor spiders (Idiopidae: Arbanitinae).‏
670 ‎‡a Author's Rainfall as a trigger of ecological cascade effects in an Australian groundwater ecosystem‏
670 ‎‡a Author's Re-examination of a proposed case of stasipatric speciation: phylogeography of the Australian morabine grasshoppers (Vandiemenella viatica species group).‏
670 ‎‡a Author's Reassessment of the subspecific status of the Australian Wet Tropics yellow-bellied glider, Petaurus australis‏
670 ‎‡a Author's Refining trophic dynamics through multi-factor Bayesian mixing models: A case study of subterranean beetles‏
670 ‎‡a Author's Refugia within refugia: in situ speciation and conservation of threatened Bertmainius (Araneae: Migidae), a new genus of relictual trapdoor spiders endemic to the mesic zone of south-western Australia‏
670 ‎‡a Author's Regressive evolution of an eye pigment gene in independently evolved eyeless subterranean diving beetles‏
670 ‎‡a Author's Review of Australian <i>Scirtes</i> Illiger, Ora Clark and <i>Exochomoscirtes</i> Pic Coleoptera: Scirtidae) including descriptions of new species, new groups and a multi-gene molecular phylogeny of Australian and non-Australian species‏
670 ‎‡a Author's Scratching the surface of subterranean biodiversity: Molecular analysis reveals a diverse and previously unknown fauna of Parabathynellidae (Crustacea: Bathynellacea) from the Pilbara, Western Australia‏
670 ‎‡a Author's Small marsupial, big dispersal? Broad- and fine-scale genetic structure of an endangered marsupial from the Australian arid zone‏
670 ‎‡a Author's Social complexity in bees is not sufficient to explain lack of reversions to solitary living over long time scales‏
670 ‎‡a Author's Species diversity and genetic differentiation of stygofauna‏
670 ‎‡a Author's Species diversity and genetic differentiation of stygofauna (Syncarida:Bathynellacea) across an alluvial aquifer in north-eastern Australia‏
670 ‎‡a Author's Species Phylogeny of the Bee Genus Exoneurella Michener (Hymenoptera: Apidae: Allodapini): Evidence from Molecular and Morphological Data Sets‏
670 ‎‡a Author's Stressed out underground?: Illuminating the genomic response to heat stress in surface and subterranean predaceous diving beetles‏
670 ‎‡a Author's Strong Population Genetic Structure for the Endangered Micro-Trapdoor Spider Moggridgea rainbowi (Mygalomorphae, Migidae) in Unburnt Habitat after Catastrophic Bushfires‏
670 ‎‡a Author's Subterranean archipelago in the Australian arid zone: mitochondrial DNA phylogeography of amphipods from central Western Australia‏
670 ‎‡a Author's Subterranean archipelago: mitochondrial DNA phylogeography of stygobitic isopods‏
670 ‎‡a Author's Subterranean archipelago: mitochondrial DNA phylogeography of stygobitic isopods (Oniscidea:Haloniscus) from the Yilgarn region of Western Australia‏
670 ‎‡a Author's Systematic affinities of island and mainland populations of the Dunnart Sminthopsis griseoventer in Western Australia: data from allozymes and mitochondrial DNA‏
670 ‎‡a Author's Systematics and Evolution of the Dasyurid Marsupial Genus Sminthopsis: II. The Murina Species Group‏
670 ‎‡a Author's Systematics of Haloniscus Chilton, 1920 (Isopoda: Oniscidea: Philosciidae), with description of four new species from threatened Great Artesian Basin springs in South Australia‏
670 ‎‡a Author's Systematics of the spiny trapdoor spider genus Bungulla (Mygalomorphae: Idiopidae): revealing a remarkable radiation of mygalomorph spiders from the Western Australian arid zone‏
670 ‎‡a Author's Systematics of the spiny trapdoor spiders of the genus Cataxia‏
670 ‎‡a Author's Systematics of the spiny trapdoor spiders of the genus Cataxia (Mygalomorphae: Idiopidae) from south-western Australia: documenting a threatened fauna in a sky-island landscape‏
670 ‎‡a Author's Taxonomy of Paraplatyarthrus Javidkar and King (Isopoda: Oniscidea: Paraplatyarthridae) with description of five new species from Western Australia, and comments on Australian Trichorhina Budde-Lunde, 1908 (Platyarthridae)‏
670 ‎‡a Author's Taxonomy of rock-wallabies, Petrogale (Marsupialia: Macropodidae). IV. Multifaceted study of the brachyotis group identifies additional taxa‏
670 ‎‡a Author's The alpha-globin gene family of an Australian marsupial, Macropus eugenii: the long evolutionary history of the theta-globin gene and its functional status in mammals‏
670 ‎‡a Author's The Australasian spiny trapdoor spiders of the family Idiopidae‏
670 ‎‡a Author's The Australasian spiny trapdoor spiders of the family Idiopidae (Mygalomorphae: Arbanitinae): a relimitation and revision at the generic level‏
670 ‎‡a Author's The Dogma of Dingoes—Taxonomic status of the dingo: A reply to Smith et al‏
670 ‎‡a Author's The egg coat zona pellucida 3 glycoprotein - evolution of its putative sperm-binding region in Old World murine rodents‏
670 ‎‡a Author's The egg coat zona pellucida 3 glycoprotein - evolution of its putative sperm-binding region in Old World murine rodents (Rodentia: Muridae).‏
670 ‎‡a Author's The Evolution of Epigean and Stygobitic Species of Koonunga Sayce, 1907 (Syncarida: Anaspidacea) in Southern Australia, with the Description of Three New Species‏
670 ‎‡a Author's The evolution of eusociality in allodapine bees: workers began by waiting‏
670 ‎‡a Author's The mammalian alphaD-globin gene lineage and a new model for the molecular evolution of alpha-globin gene clusters at the stem of the mammalian radiation‏
670 ‎‡a Author's Third Genus Of Parastenocaridid Copepods From Australia Supported By Molecular Evidence (Copepoda, Harpacticoida)‏
670 ‎‡a Author's Tracking down carbon inputs underground from an arid zone Australian calcrete‏
670 ‎‡a Author's Trapped in desert springs: phylogeography of Australian desert spring snails‏
670 ‎‡a Author's VIEWPOINT. Is the Australian subterranean fauna uniquely diverse?‏
670 ‎‡a Author's What lies beneath: molecular phylogenetics and ancestral state reconstruction of the ancient subterranean Australian Parabathynellidae (Syncarida, Crustacea).‏
670 ‎‡a wikidata site links‏ ‎‡u https://species.wikipedia.org/wiki/Steven_John_Baynard_Cooper‏
909 ‎‡a (orcid) 0000000278438438‏ ‎‡9 1‏
919 ‎‡a highlymodifiedstygobiontdivingbeetleofthegenuscopelatuscoleopteradytiscidaetaxonomyandcladisticanalysisbasedonmitochondrialdnasequences‏ ‎‡A A highly modified stygobiont diving beetle of the genus Copelatus (Coleoptera, Dytiscidae): taxonomy and cladistic analysis based on mitochondrial DNA sequences‏ ‎‡9 1‏
919 ‎‡a molecularandmorphologicalinvestigationofspeciesboundariesandphylogeneticrelationshipsinaustralianfreetailedbatsmormopteruschiropteramolossidae‏ ‎‡A A molecular and morphological investigation of species boundaries and phylogenetic relationships in Australian free-tailed bats Mormopterus (Chiroptera: Molossidae)‏ ‎‡9 1‏
919 ‎‡a newgenusperplexacaraandnewgenericplacementsofspeciesofaustralianmarshbeetlescoleopterascirtidaebasedonmorphologyandmoleculargeneticdata‏ ‎‡A A new genus, Perplexacara, and new generic placements of species of Australian marsh beetles (Coleoptera: Scirtidae) based on morphology and molecular genetic data‏ ‎‡9 1‏
919 ‎‡a acrosstheindianoceanaremarkableexampleoftransoceanicdispersalinanaustralmygalomorphspider‏ ‎‡A Across the Indian Ocean: A remarkable example of trans-oceanic dispersal in an austral mygalomorph spider‏ ‎‡9 1‏
919 ‎‡a assessmentofpreyoverlapbetweenanative‏ ‎‡A Assessment of prey overlap between a native‏ ‎‡9 1‏
919 ‎‡a assessmentofpreyoverlapbetweenanativepolisteshumilisandanintroducedvespulagermanicasocialwaspusingmorphologyandphylogeneticanalysesof16srdna‏ ‎‡A Assessment of prey overlap between a native (Polistes humilis) and an introduced (Vespula germanica) social wasp using morphology and phylogenetic analyses of 16S rDNA.‏ ‎‡9 1‏
919 ‎‡a biogeographicbarriersinnorthwesternaustraliaanoverviewandstandardisationofnomenclature‏ ‎‡A Biogeographic barriers in north-western Australia: an overview and standardisation of nomenclature‏ ‎‡9 1‏
919 ‎‡a braziliancaveheritageundersiege‏ ‎‡A Brazilian cave heritage under siege‏ ‎‡9 1‏
919 ‎‡a burrowusebybilbiesintemperatesouthaustralia‏ ‎‡A Burrow use by bilbies in temperate South Australia‏ ‎‡9 1‏
919 ‎‡a characterizationof9microsatellitelocifromtheendangeredsouthernbrownbandicoot‏ ‎‡A Characterization of nine microsatellite loci from the endangered southern brown bandicoot‏ ‎‡9 1‏
919 ‎‡a chromosomalspeciationrevisitedmodesofdiversificationinaustralianmorabinegrasshoppersvandiemenellaviaticaspeciesgroup‏ ‎‡A Chromosomal Speciation Revisited: Modes of Diversification in Australian Morabine Grasshoppers (Vandiemenella, viatica Species Group)‏ ‎‡9 1‏
919 ‎‡a comparativeanalysisofmorabinegrasshoppergenomesrevealshighlyabundanttransposableelementsandrapidlyproliferatingsatellitednarepeats‏ ‎‡A Comparative analysis of morabine grasshopper genomes reveals highly abundant transposable elements and rapidly proliferating satellite DNA repeats‏ ‎‡9 1‏
919 ‎‡a comparativepopulationgeneticstructureoftheendangeredsouthernbrownbandicootisoodonobesulusinfragmentedlandscapesofsouthernaustralia‏ ‎‡A Comparative Population Genetic Structure of the Endangered Southern Brown Bandicoot, Isoodon obesulus, in Fragmented Landscapes of Southern Australia‏ ‎‡9 1‏
919 ‎‡a conservationsystematicsoftheshieldbackedtrapdoorspidersofthegroupmygalomorphaeidiopidaeintegrativetaxonomyrevealsadiverseandthreatenedfaunafromsouthwesternaustralia‏ ‎‡A Conservation systematics of the shield-backed trapdoor spiders of the -group (Mygalomorphae, Idiopidae, ): integrative taxonomy reveals a diverse and threatened fauna from south-western Australia‏ ‎‡9 1‏
919 ‎‡a conservationsystematicsoftheshieldbackedtrapdoorspidersofthenigrumgroupmygalomorphaeidiopidaeidiosomaintegrativetaxonomyrevealsadiverseandthreatenedfaunafromsouthwesternaustralia‏ ‎‡A Conservation systematics of the shield-backed trapdoor spiders of the nigrum-group (Mygalomorphae, Idiopidae, Idiosoma): integrative taxonomy reveals a diverse and threatened fauna from south-western Australia‏ ‎‡9 1‏
919 ‎‡a corrigendumtocrypticdiversitydownunderdefiningspeciesinthesubterraneanamphipodgenusnedsiabarnardandwilliams1995hadzioideaeriopisidaefromthepilbarawesternaustralia‏ ‎‡A Corrigendum to: Cryptic diversity down under: defining species in the subterranean amphipod genus Nedsia Barnard & Williams, 1995 (Hadzioidea: Eriopisidae) from the Pilbara, Western Australia‏ ‎‡9 1‏
919 ‎‡a crypticdiversitydownunderdefiningspeciesinthesubterraneanamphipodgenus‏ ‎‡A Cryptic diversity down under: defining species in the subterranean amphipod genus‏ ‎‡9 1‏
919 ‎‡a cutaneousrespirationbydivingbeetlesfromundergroundaquifersofwesternaustraliacoleopteradytiscidae‏ ‎‡A Cutaneous respiration by diving beetles from underground aquifers of Western Australia (Coleoptera: Dytiscidae)‏ ‎‡9 1‏
919 ‎‡a deepphylogeographicstructuringofpopulationsofthetrapdoorspidermoggridgeatinglemigidaefromsouthwesternaustraliaevidenceforlongtermrefugiawithinrefugia‏ ‎‡A Deep phylogeographic structuring of populations of the trapdoor spider Moggridgea tingle (Migidae) from southwestern Australia: evidence for long-term refugia within refugia‏ ‎‡9 1‏
919 ‎‡a delineationofconservationunitsinanendangeredmarsupialthesouthernbrownbandicootisoodonobesulusobesulusinsouthaustraliawesternvictoriaaustralia‏ ‎‡A Delineation of conservation units in an endangered marsupial, the southern brown bandicoot (Isoodon obesulus obesulus), in South Australia/western Victoria, Australia‏ ‎‡9 1‏
919 ‎‡a developmentandevaluationofacustombaitdesignbasedon469singlecopyproteincodinggenesforexoncaptureofisopodsphilosciidaehaloniscus‏ ‎‡A Development and evaluation of a custom bait design based on 469 single-copy protein-coding genes for exon capture of isopods (Philosciidae: Haloniscus)‏ ‎‡9 1‏
919 ‎‡a developmentof16microsatellitelocifortheendangeredsandhilldunnart‏ ‎‡A Development of 16 microsatellite loci for the endangered sandhill dunnart‏ ‎‡9 1‏
919 ‎‡a developmentof16microsatellitelocifortheendangeredsandhilldunnartsminthopsispsammophila‏ ‎‡A Development of 16 microsatellite loci for the endangered sandhill dunnart (Sminthopsis psammophila)‏ ‎‡9 1‏
919 ‎‡a difficultiesbarcodinginthedarkthecaseofcrustaceanstygofaunafromeasternaustralia‏ ‎‡A Difficulties barcoding in the dark: the case of crustacean stygofauna from eastern Australia‏ ‎‡9 1‏
919 ‎‡a divergentmolecularlineagesandnotsocrypticspeciesthe1descriptionsofstygobiticchiltoniidamphipods‏ ‎‡A Divergent molecular lineages and not-so-cryptic species: the first descriptions of stygobitic chiltoniid amphipods‏ ‎‡9 1‏
919 ‎‡a divergentmolecularlineagesandnotsocrypticspeciesthe1descriptionsofstygobiticchiltoniidamphipodstalitroideachiltoniidaefromwesternaustralia‏ ‎‡A Divergent molecular lineages and not-so-cryptic species: the first descriptions of stygobitic chiltoniid amphipods (Talitroidea: Chiltoniidae) from Western Australia‏ ‎‡9 1‏
919 ‎‡a diversityanddistributionofgroundwaterfaunain‏ ‎‡A Diversity and distribution of groundwater fauna in a calcrete aquifer: does sampling method influence the story?‏ ‎‡9 1‏
919 ‎‡a diversitypatternsofsubterraneaninvertebratefaunaincalcretesoftheyilgarnregionwesternaustralia‏ ‎‡A Diversity patterns of subterranean invertebrate fauna in calcretes of the Yilgarn Region, Western Australia‏ ‎‡9 1‏
919 ‎‡a dnabarcodingofmicrogastrineparasitoidwaspshymenopterabraconidaeusinghighthroughputmethodsmorethandoublesthenumberofspeciesknownforaustralia‏ ‎‡A DNA barcoding of microgastrine parasitoid wasps (Hymenoptera: Braconidae) using high-throughput methods more than doubles the number of species known for Australia‏ ‎‡9 1‏
919 ‎‡a dnabarcodingofstygofaunauncoverscrypticamphipoddiversityinacalcreteaquiferinwesternaustraliasaridzone‏ ‎‡A DNA barcoding of stygofauna uncovers cryptic amphipod diversity in a calcrete aquifer in Western Australia's arid zone‏ ‎‡9 1‏
919 ‎‡a evidenceforpopulationfragmentationwithinasubterraneanaquatichabitatinthewesternaustraliandesert‏ ‎‡A Evidence for population fragmentation within a subterranean aquatic habitat in the Western Australian desert‏ ‎‡9 1‏
919 ‎‡a evidenceforspeciationundergroundindivingbeetlesdytiscidaefromasubterraneanarchipelago‏ ‎‡A Evidence for speciation underground in diving beetles (Dytiscidae) from a subterranean archipelago‏ ‎‡9 1‏
919 ‎‡a evolutionincavesdarwinswrecksofancientlifeinthemolecularera‏ ‎‡A Evolution in caves: Darwin's 'wrecks of ancient life' in the molecular era.‏ ‎‡9 1‏
919 ‎‡a evolutionofsubterraneandivingbeetlescoleopteradytiscidaehydroporinibidessiniinthearidzoneofaustralia‏ ‎‡A Evolution of subterranean diving beetles (Coleoptera: Dytiscidae: Hydroporini, Bidessini) in the arid zone of Australia‏ ‎‡9 1‏
919 ‎‡a evolutionaryhistoryoftheaustralasianscirtinaescirtidaecoleopterainferredfromultraconservedelements‏ ‎‡A Evolutionary history of the Australasian Scirtinae (Scirtidae; Coleoptera) inferred from ultraconserved elements‏ ‎‡9 1‏
919 ‎‡a evolutionarytransitionfromsurfacetosubterraneanlivinginaustralianwaterbeetlescoleopteradytiscidaethroughadaptiveandrelaxedselection‏ ‎‡A Evolutionary transition from surface to subterranean living in Australian water beetles (Coleoptera: Dytiscidae) through adaptive and relaxed selection‏ ‎‡9 1‏
919 ‎‡a extremegeneticdiversityamongspringtailscollembolainsubterraneancalcretesofaridaustralia‏ ‎‡A Extreme genetic diversity among springtails (Collembola) in subterranean calcretes of arid Australia‏ ‎‡9 1‏
919 ‎‡a finescalecomparativephylogeographyofasympatricsisterspeciestripletofsubterraneandivingbeetlesfromasinglecalcreteaquiferinwesternaustralia‏ ‎‡A Fine-scale comparative phylogeography of a sympatric sister species triplet of subterranean diving beetles from a single calcrete aquifer in Western Australia‏ ‎‡9 1‏
919 ‎‡a fundamentalresearchquestionsinsubterraneanbiology‏ ‎‡A Fundamental research questions in subterranean biology‏ ‎‡9 1‏
919 ‎‡a geneticanalysisofachromosomalhybridzoneintheaustralianmorabinegrasshoppersvandiemenellaviaticaspeciesgroup‏ ‎‡A Genetic analysis of a chromosomal hybrid zone in the Australian morabine grasshoppers (Vandiemenella, viatica species group).‏ ‎‡9 1‏
919 ‎‡a geneticelucidationofcrypticandancientdiversityinagroupofaustraliandiplodactylinegeckosthediplodactylusvittatuscomplex‏ ‎‡A Genetic elucidation of cryptic and ancient diversity in a group of Australian diplodactyline geckos: the Diplodactylus vittatus complex.‏ ‎‡9 1‏
919 ‎‡a geneticstructureofthewesternpygmypossumcercartetusconcinnusgouldmarsupialiaburramyidaebasedonmitochondrialdna‏ ‎‡A Genetic structure of the western pygmy possum, Cercartetus concinnus Gould (Marsupialia: Burramyidae) based on mitochondrial DNA‏ ‎‡9 1‏
919 ‎‡a groundwaterestuariesofsaltlakesburiedpoolsofendemicbiodiversityonthewesternplateauaustralia‏ ‎‡A Groundwater estuaries of salt lakes: buried pools of endemic biodiversity on the western plateau, Australia‏ ‎‡9 1‏
919 ‎‡a habitatconnectivitymorethanspeciesbiologyinfluencesgeneticdifferentiationinahabitatspecialisttheshortearedrockwallabypetrogalebrachyotis‏ ‎‡A Habitat connectivity, more than species’ biology, influences genetic differentiation in a habitat specialist, the short-eared rock-wallaby (Petrogale brachyotis)‏ ‎‡9 1‏
919 ‎‡a habitatusepopulationdynamicsandspeciesidentificationofmulgaradasycercusblythiand500cristicaudainazoneofsympatryincentralaustralia‏ ‎‡A Habitat use, population dynamics and species identification of mulgara, Dasycercus blythi and D. cristicauda, in a zone of sympatry in central Australia‏ ‎‡9 1‏
919 ‎‡a highlevelsofgeneticmonogamyinthegrouplivingaustralianlizardegerniastokesii‏ ‎‡A High levels of genetic monogamy in the group-living Australian lizard Egernia stokesii.‏ ‎‡9 1‏
919 ‎‡a hybridcapturedataunravelarapidradiationofpimpliformparasitoidwaspshymenopteraichneumonidaepimpliformes‏ ‎‡A Hybrid capture data unravel a rapid radiation of pimpliform parasitoid wasps (Hymenoptera: Ichneumonidae: Pimpliformes)‏ ‎‡9 1‏
919 ‎‡a identificationoftrophicnichesofsubterraneandivingbeetlesinacalcreteaquiferbydnaandstableisotopeanalyses‏ ‎‡A Identification of trophic niches of subterranean diving beetles in a calcrete aquifer by DNA and stable isotope analyses‏ ‎‡9 1‏
919 ‎‡a intragenomicinternaltranscribedspacer2variationinagenusofparasitoidwaspshymenopterabraconidaeimplicationsforaccuratespeciesdelimitationandphylogeneticanalysis‏ ‎‡A Intragenomic internal transcribed spacer 2 variation in a genus of parasitoid wasps (Hymenoptera: Braconidae): implications for accurate species delimitation and phylogenetic analysis‏ ‎‡9 1‏
919 ‎‡a limitedecologicalconnectivityofanarborealmarsupialacrossaforestplantationlandscapedespiteapparentresiliencetofragmentation‏ ‎‡A Limited ecological connectivity of an arboreal marsupial across a forest/plantation landscape despite apparent resilience to fragmentation‏ ‎‡9 1‏
919 ‎‡a linkageofthebetalikeomegaglobingenetoalphalikeglobingenesinanaustralianmarsupialsupportsthechromosomeduplicationmodelforseparationofglobingeneclusters‏ ‎‡A Linkage of the beta-like omega-globin gene to alpha-like globin genes in an Australian marsupial supports the chromosome duplication model for separation of globin gene clusters‏ ‎‡9 1‏
919 ‎‡a massiveparallelregressionaprecisofgeneticmechanismsforvisionlossindivingbeetles‏ ‎‡A Massive Parallel Regression: A Précis of Genetic Mechanisms for Vision Loss in Diving Beetles‏ ‎‡9 1‏
919 ‎‡a microsatellitemarkersforthecommonringtailpossumpseudocheirusperegrinusandtheiramplificationinotherpseudocheirids‏ ‎‡A Microsatellite markers for the Common ringtail possum (Pseudocheirus peregrinus) and their amplification in other Pseudocheirids‏ ‎‡9 1‏
919 ‎‡a mitochondrialdnaanalysesrevealwidespreadtardigradediversityinantarctica‏ ‎‡A Mitochondrial DNA analyses reveal widespread tardigrade diversity in Antarctica‏ ‎‡9 1‏
919 ‎‡a molecularevolutionofthecarboxyterminalregionofthezonapellucida3glycoproteininmurinerodents‏ ‎‡A Molecular evolution of the carboxy terminal region of the zona pellucida 3 glycoprotein in murine rodents‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticanalysesrevealanewsouthernhemisphereoniscideanfamily‏ ‎‡A Molecular phylogenetic analyses reveal a new southern hemisphere oniscidean family‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticmorphologicalandbiogeographicevidenceforanewgenusofparabathynellidcrustaceanssyncaridabathynellaceafromgroundwaterinanancientsouthernaustralianlandscape‏ ‎‡A Molecular phylogenetic, morphological and biogeographic evidence for a new genus of parabathynellid crustaceans (Syncarida: Bathynellacea) from groundwater in an ancient southern Australian landscape‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticsofallodapinebeeswithimplicationsfortheevolutionofsocialityandprogressiverearing‏ ‎‡A Molecular phylogenetics of allodapine bees, with implications for the evolution of sociality and progressive rearing‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticsoftheallodapinebeegenusbraunsapisatbiasandheterogeneoussubstitutionparameters‏ ‎‡A Molecular phylogenetics of the allodapine bee genus Braunsapis: A-T bias and heterogeneous substitution parameters‏ ‎‡9 1‏
919 ‎‡a molecularphylogenyandhistoricalbiogeographyofthelargecarpenterbeesgenusxylocopahymenopteraapidae‏ ‎‡A Molecular phylogeny and historical biogeography of the large carpenter bees, genus Xylocopa (Hymenoptera: Apidae)‏ ‎‡9 1‏
919 ‎‡a molecularphylogenyofthesmallcarpenterbees‏ ‎‡A Molecular phylogeny of the small carpenter bees‏ ‎‡9 1‏
919 ‎‡a molecularphylogenyofthesmallcarpenterbeeshymenopteraapidaeceratininiindicatesearlyandrapidglobaldispersal‏ ‎‡A Molecular phylogeny of the small carpenter bees (Hymenoptera: Apidae: Ceratinini) indicates early and rapid global dispersal‏ ‎‡9 1‏
919 ‎‡a molecularsystematicsandevolutionaryoriginsofthegenuspetaurus‏ ‎‡A Molecular systematics and evolutionary origins of the genus Petaurus‏ ‎‡9 1‏
919 ‎‡a molecularsystematicsandevolutionaryoriginsofthegenuspetaurusmarsupialiapetauridaeinaustraliaandnewguinea‏ ‎‡A Molecular systematics and evolutionary origins of the genus Petaurus (Marsupialia: Petauridae) in Australia and New Guinea‏ ‎‡9 1‏
919 ‎‡a molecularsystematicsofaustralianrhinolophidbatschiropterarhinolophidae‏ ‎‡A Molecular systematics of Australian rhinolophid bats (Chiroptera: Rhinolophidae)‏ ‎‡9 1‏
919 ‎‡a monogamyinanaustralianarborealmarsupialtheyellowbelliedgliderpetaurusaustralis‏ ‎‡A Monogamy in an Australian arboreal marsupial, the yellow-bellied glider (Petaurus australis)‏ ‎‡9 1‏
919 ‎‡a morphologicalandmolecularstudyofthegenusnitokracrustaceacopepodaharpacticoidainasmallpalaeochannelinwesternaustralia‏ ‎‡A Morphological and molecular study of the genus Nitokra (Crustacea, Copepoda, Harpacticoida) in a small palaeochannel in Western Australia‏ ‎‡9 1‏
919 ‎‡a multiplebiogeographicalbarriersidentifiedacrossthemonsoontropicsofnorthernaustraliaphylogeographicanalysisofthebrachyotisgroupofrockwallabies‏ ‎‡A Multiple biogeographical barriers identified across the monsoon tropics of northern Australia: phylogeographic analysis of the brachyotis group of rock-wallabies‏ ‎‡9 1‏
919 ‎‡a namingspecieswithnomorphologicalindicatorsspeciesstatusofgaleolariacaespitosa‏ ‎‡A Naming species with no morphological indicators: species status of Galeolaria caespitosa‏ ‎‡9 1‏
919 ‎‡a newgeneraspeciesandcombinationsinthepseudomicrocaraarmstronggroupcoleopterascirtidaebasedonmorphologysupportedbymitochondrialandnucleargenesequencedata‏ ‎‡A New genera, species and combinations in the Pseudomicrocara Armstrong group (Coleoptera: Scirtidae) based on morphology supported by mitochondrial and nuclear gene sequence data‏ ‎‡9 1‏
919 ‎‡a newspeciesofaustralianmicrogastrineparasitoidwasps‏ ‎‡A New species of Australian microgastrine parasitoid wasps‏ ‎‡9 1‏
919 ‎‡a newspeciesofaustralianmicrogastrineparasitoidwaspshymenopterabraconidaemicrogastrinaedocumentedthroughthebushblitzsurveysofnationalreserves‏ ‎‡A New species of Australian microgastrine parasitoid wasps (Hymenoptera: Braconidae: Microgastrinae) documented through the ‘Bush Blitz’ surveys of national reserves‏ ‎‡9 1‏
919 ‎‡a patternsofpopulationgeneticvariationinsympatricchiltoniidamphipodswithinacalcreteaquiferrevealadynamicsubterraneanenvironment‏ ‎‡A Patterns of population genetic variation in sympatric chiltoniid amphipods within a calcrete aquifer reveal a dynamic subterranean environment‏ ‎‡9 1‏
919 ‎‡a phylogeneticdivergenceoftheaustralianallodapinebeeshymenopteraapidae‏ ‎‡A Phylogenetic divergence of the Australian allodapine bees (Hymenoptera: Apidae)‏ ‎‡9 1‏
919 ‎‡a phylogeneticplacementanddescriptionofngaliadessushumphreysigenetspnovwatts&ampvillastrigocoleopteradytiscidaeasubterraneandivingbeetlefromthengaliabasinincentralaustralia‏ ‎‡A Phylogenetic placement and description of Ngaliadessus humphreysi gen. et sp. nov., Watts & Villastrigo (Coleoptera: Dytiscidae), a subterranean diving beetle from the Ngalia Basin in central Australia‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipsofaustralianscirtidae‏ ‎‡A Phylogenetic relationships of Australian Scirtidae‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipsofaustralianscirtidaecoleopterabasedonmitochondrialandnuclearsequences‏ ‎‡A Phylogenetic relationships of Australian Scirtidae (Coleoptera) based on mitochondrial and nuclear sequences‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipsofrockwallabiespetrogalemarsupialiamacropodidaeandtheirbiogeographichistorywithinaustralia‏ ‎‡A Phylogenetic relationships of rock-wallabies, Petrogale (Marsupialia: Macropodidae) and their biogeographic history within Australia.‏ ‎‡9 1‏
919 ‎‡a phylogeneticsofaustralianacaciathripstheevolutionofbehaviourandecology‏ ‎‡A Phylogenetics of Australian Acacia thrips: the evolution of behaviour and ecology‏ ‎‡9 1‏
919 ‎‡a phylogeographyoftheancientparabathynellidae‏ ‎‡A Phylogeography of the ancient Parabathynellidae‏ ‎‡9 1‏
919 ‎‡a phylogeographyoftheancientparabathynellidaecrustaceabathynellaceafromtheyilgarnregionofwesternaustralia‏ ‎‡A Phylogeography of the ancient Parabathynellidae (Crustacea:Bathynellacea) from the Yilgarn region of Western Australia‏ ‎‡9 1‏
919 ‎‡a phylogeographyoftheaustraliansugarglider‏ ‎‡A Phylogeography of the Australian sugar glider‏ ‎‡9 1‏
919 ‎‡a platypusglobingenesandflankinglocisuggestanewinsertionalmodelforbetaglobinevolutioninbirdsandmammals‏ ‎‡A Platypus globin genes and flanking loci suggest a new insertional model for beta-globin evolution in birds and mammals‏ ‎‡9 1‏
919 ‎‡a pliopleistocenediversificationandbiogeographicbarriersinsouthernaustraliareflectedinthephylogeographyofawidespreadandcommonlizardspecies‏ ‎‡A Plio-Pleistocene diversification and biogeographic barriers in southern Australia reflected in the phylogeography of a widespread and common lizard species‏ ‎‡9 1‏
919 ‎‡a populationgenomicdiversityandstructureinthegoldenbandicootahistoryofisolationextirpationandconservation‏ ‎‡A Population genomic diversity and structure in the golden bandicoot: a history of isolation, extirpation, and conservation‏ ‎‡9 1‏
919 ‎‡a rainfallasatriggerofecologicalcascadeeffectsinanaustraliangroundwaterecosystem‏ ‎‡A Rainfall as a trigger of ecological cascade effects in an Australian groundwater ecosystem‏ ‎‡9 1‏
919 ‎‡a reexaminationofaproposedcaseofstasipatricspeciationphylogeographyoftheaustralianmorabinegrasshoppersvandiemenellaviaticaspeciesgroup‏ ‎‡A Re-examination of a proposed case of stasipatric speciation: phylogeography of the Australian morabine grasshoppers (Vandiemenella viatica species group).‏ ‎‡9 1‏
919 ‎‡a reassessmentofthesubspecificstatusoftheaustralianwettropicsyellowbelliedgliderpetaurusaustralis‏ ‎‡A Reassessment of the subspecific status of the Australian Wet Tropics yellow-bellied glider, Petaurus australis‏ ‎‡9 1‏
919 ‎‡a refugiawithinrefugiainsituspeciationandconservationofthreatenedbertmainiusaraneaemigidaeanewgenusofrelictualtrapdoorspidersendemictothemesiczoneofsouthwesternaustralia‏ ‎‡A Refugia within refugia: in situ speciation and conservation of threatened Bertmainius (Araneae: Migidae), a new genus of relictual trapdoor spiders endemic to the mesic zone of south-western Australia‏ ‎‡9 1‏
919 ‎‡a regressiveevolutionofaneyepigmentgeneinindependentlyevolvedeyelesssubterraneandivingbeetles‏ ‎‡A Regressive evolution of an eye pigment gene in independently evolved eyeless subterranean diving beetles‏ ‎‡9 1‏
919 ‎‡a reviewofaustralian1scirtes1illigeroraclarkand1exochomoscirtes1piccoleopterascirtidaeincludingdescriptionsofnewspeciesnewgroupsandamultigenemolecularphylogenyofaustralianandnonaustralianspecies‏ ‎‡A Review of Australian <i>Scirtes</i> Illiger, Ora Clark and <i>Exochomoscirtes</i> Pic Coleoptera: Scirtidae) including descriptions of new species, new groups and a multi-gene molecular phylogeny of Australian and non-Australian species‏ ‎‡9 1‏
919 ‎‡a scratchingthesurfaceofsubterraneanbiodiversitymolecularanalysisrevealsadiverseandpreviouslyunknownfaunaofparabathynellidaecrustaceabathynellaceafromthepilbarawesternaustralia‏ ‎‡A Scratching the surface of subterranean biodiversity: Molecular analysis reveals a diverse and previously unknown fauna of Parabathynellidae (Crustacea: Bathynellacea) from the Pilbara, Western Australia‏ ‎‡9 1‏
919 ‎‡a smallmarsupialbigdispersalbroadandfinescalegeneticstructureofanendangeredmarsupialfromtheaustralianaridzone‏ ‎‡A Small marsupial, big dispersal? Broad- and fine-scale genetic structure of an endangered marsupial from the Australian arid zone‏ ‎‡9 1‏
919 ‎‡a socialcomplexityinbeesisnotsufficienttoexplainlackofreversionstosolitarylivingoverlongtimescales‏ ‎‡A Social complexity in bees is not sufficient to explain lack of reversions to solitary living over long time scales‏ ‎‡9 1‏
919 ‎‡a speciesdiversityandgeneticdifferentiationofstygofauna‏ ‎‡A Species diversity and genetic differentiation of stygofauna‏ ‎‡9 1‏
919 ‎‡a speciesphylogenyofthebeegenusexoneurellamichenerhymenopteraapidaeallodapinievidencefrommolecularandmorphologicaldatasets‏ ‎‡A Species Phylogeny of the Bee Genus Exoneurella Michener (Hymenoptera: Apidae: Allodapini): Evidence from Molecular and Morphological Data Sets‏ ‎‡9 1‏
919 ‎‡a stressedoutundergroundilluminatingthegenomicresponsetoheatstressinsurfaceandsubterraneanpredaceousdivingbeetles‏ ‎‡A Stressed out underground?: Illuminating the genomic response to heat stress in surface and subterranean predaceous diving beetles‏ ‎‡9 1‏
919 ‎‡a strongpopulationgeneticstructurefortheendangeredmicrotrapdoorspidermoggridgearainbowimygalomorphaemigidaeinunburnthabitataftercatastrophicbushfires‏ ‎‡A Strong Population Genetic Structure for the Endangered Micro-Trapdoor Spider Moggridgea rainbowi (Mygalomorphae, Migidae) in Unburnt Habitat after Catastrophic Bushfires‏ ‎‡9 1‏
919 ‎‡a subterraneanarchipelagomitochondrialdnaphylogeographyofstygobiticisopods‏ ‎‡A Subterranean archipelago: mitochondrial DNA phylogeography of stygobitic isopods‏ ‎‡9 1‏
919 ‎‡a subterraneanarchipelagomitochondrialdnaphylogeographyofstygobiticisopodsoniscideahaloniscusfromtheyilgarnregionofwesternaustralia‏ ‎‡A Subterranean archipelago: mitochondrial DNA phylogeography of stygobitic isopods (Oniscidea:Haloniscus) from the Yilgarn region of Western Australia‏ ‎‡9 1‏
919 ‎‡a systematicaffinitiesofislandandmainlandpopulationsofthedunnartsminthopsisgriseoventerinwesternaustraliadatafromallozymesandmitochondrialdna‏ ‎‡A Systematic affinities of island and mainland populations of the Dunnart Sminthopsis griseoventer in Western Australia: data from allozymes and mitochondrial DNA‏ ‎‡9 1‏
919 ‎‡a systematicsofhaloniscuschilton1920isopodaoniscideaphilosciidaewithdescriptionof4newspeciesfromthreatenedgreatartesianbasinspringsinsouthaustralia‏ ‎‡A Systematics of Haloniscus Chilton, 1920 (Isopoda: Oniscidea: Philosciidae), with description of four new species from threatened Great Artesian Basin springs in South Australia‏ ‎‡9 1‏
919 ‎‡a systematicsofthespinytrapdoorspidergenusbungullamygalomorphaeidiopidaerevealingaremarkableradiationofmygalomorphspidersfromthewesternaustralianaridzone‏ ‎‡A Systematics of the spiny trapdoor spider genus Bungulla (Mygalomorphae: Idiopidae): revealing a remarkable radiation of mygalomorph spiders from the Western Australian arid zone‏ ‎‡9 1‏
919 ‎‡a systematicsofthespinytrapdoorspidersofthegenuscataxia‏ ‎‡A Systematics of the spiny trapdoor spiders of the genus Cataxia‏ ‎‡9 1‏
919 ‎‡a systematicsofthespinytrapdoorspidersofthegenuscataxiamygalomorphaeidiopidaefromsouthwesternaustraliadocumentingathreatenedfaunainaskyislandlandscape‏ ‎‡A Systematics of the spiny trapdoor spiders of the genus Cataxia (Mygalomorphae: Idiopidae) from south-western Australia: documenting a threatened fauna in a sky-island landscape‏ ‎‡9 1‏
919 ‎‡a taxonomyofparaplatyarthrusjavidkarandkingisopodaoniscideaparaplatyarthridaewithdescriptionof5newspeciesfromwesternaustraliaandcommentsonaustraliantrichorhinabuddelunde1908platyarthridae‏ ‎‡A Taxonomy of Paraplatyarthrus Javidkar and King (Isopoda: Oniscidea: Paraplatyarthridae) with description of five new species from Western Australia, and comments on Australian Trichorhina Budde-Lunde, 1908 (Platyarthridae)‏ ‎‡9 1‏
919 ‎‡a taxonomyofrockwallabiespetrogalemarsupialiamacropodidae4multifacetedstudyofthebrachyotisgroupidentifiesadditionaltaxa‏ ‎‡A Taxonomy of rock-wallabies, Petrogale (Marsupialia: Macropodidae). IV. Multifaceted study of the brachyotis group identifies additional taxa‏ ‎‡9 1‏
919 ‎‡a alphaglobingenefamilyofanaustralianmarsupialmacropuseugeniithelongevolutionaryhistoryofthethetaglobingeneanditsfunctionalstatusinmammals‏ ‎‡A The alpha-globin gene family of an Australian marsupial, Macropus eugenii: the long evolutionary history of the theta-globin gene and its functional status in mammals‏ ‎‡9 1‏
919 ‎‡a australasianspinytrapdoorspidersofthefamilyidiopidaemygalomorphaearbanitinaearelimitationandrevisionatthegenericlevel‏ ‎‡A The Australasian spiny trapdoor spiders of the family Idiopidae (Mygalomorphae: Arbanitinae): a relimitation and revision at the generic level‏ ‎‡9 1‏
919 ‎‡a dogmaofdingoestaxonomicstatusofthedingoareplytosmithetal‏ ‎‡A The Dogma of Dingoes—Taxonomic status of the dingo: A reply to Smith et al‏ ‎‡9 1‏
919 ‎‡a eggcoatzonapellucida3glycoproteinevolutionofitsputativespermbindingregioninoldworldmurinerodents‏ ‎‡A The egg coat zona pellucida 3 glycoprotein - evolution of its putative sperm-binding region in Old World murine rodents‏ ‎‡9 1‏
919 ‎‡a evolutionofepigeanandstygobiticspeciesofkoonungasayce1907syncaridaanaspidaceainsouthernaustraliawiththedescriptionof3newspecies‏ ‎‡A The Evolution of Epigean and Stygobitic Species of Koonunga Sayce, 1907 (Syncarida: Anaspidacea) in Southern Australia, with the Description of Three New Species‏ ‎‡9 1‏
919 ‎‡a evolutionofeusocialityinallodapinebeesworkersbeganbywaiting‏ ‎‡A The evolution of eusociality in allodapine bees: workers began by waiting‏ ‎‡9 1‏
919 ‎‡a mammalianalphadglobingenelineageandanewmodelforthemolecularevolutionofalphaglobingeneclustersatthestemofthemammalianradiation‏ ‎‡A The mammalian alphaD-globin gene lineage and a new model for the molecular evolution of alpha-globin gene clusters at the stem of the mammalian radiation‏ ‎‡9 1‏
919 ‎‡a trackingdowncarboninputsundergroundfromanaridzoneaustraliancalcrete‏ ‎‡A Tracking down carbon inputs underground from an arid zone Australian calcrete‏ ‎‡9 1‏
919 ‎‡a trappedindesertspringsphylogeographyofaustraliandesertspringsnails‏ ‎‡A Trapped in desert springs: phylogeography of Australian desert spring snails‏ ‎‡9 1‏
919 ‎‡a viewpointistheaustraliansubterraneanfaunauniquelydiverse‏ ‎‡A VIEWPOINT. Is the Australian subterranean fauna uniquely diverse?‏ ‎‡9 1‏
919 ‎‡a whatliesbeneathmolecularphylogeneticsandancestralstatereconstructionoftheancientsubterraneanaustralianparabathynellidaesyncaridacrustacea‏ ‎‡A What lies beneath: molecular phylogenetics and ancestral state reconstruction of the ancient subterranean Australian Parabathynellidae (Syncarida, Crustacea).‏ ‎‡9 1‏
919 ‎‡a eggcoatzonapellucida3glycoproteinevolutionofitsputativespermbindingregioninoldworldmurinerodentsrodentiamuridae‏ ‎‡A The egg coat zona pellucida 3 glycoprotein - evolution of its putative sperm-binding region in Old World murine rodents (Rodentia: Muridae).‏ ‎‡9 1‏
919 ‎‡a australasianspinytrapdoorspidersofthefamilyidiopidae‏ ‎‡A The Australasian spiny trapdoor spiders of the family Idiopidae‏ ‎‡9 1‏
919 ‎‡a 3genusofparastenocarididcopepodsfromaustraliasupportedbymolecularevidencecopepodaharpacticoida‏ ‎‡A Third Genus Of Parastenocaridid Copepods From Australia Supported By Molecular Evidence (Copepoda, Harpacticoida)‏ ‎‡9 1‏
919 ‎‡a subterraneanarchipelagointheaustralianaridzonemitochondrialdnaphylogeographyofamphipodsfromcentralwesternaustralia‏ ‎‡A Subterranean archipelago in the Australian arid zone: mitochondrial DNA phylogeography of amphipods from central Western Australia‏ ‎‡9 1‏
919 ‎‡a speciesdiversityandgeneticdifferentiationofstygofaunasyncaridabathynellaceaacrossanalluvialaquiferinnortheasternaustralia‏ ‎‡A Species diversity and genetic differentiation of stygofauna (Syncarida:Bathynellacea) across an alluvial aquifer in north-eastern Australia‏ ‎‡9 1‏
919 ‎‡a systematicsandevolutionofthedasyuridmarsupialgenussminthopsis2themurinaspeciesgroup‏ ‎‡A Systematics and Evolution of the Dasyurid Marsupial Genus Sminthopsis: II. The Murina Species Group‏ ‎‡9 1‏
919 ‎‡a posteoceneclimatechangeacrosscontinentalaustraliaandthediversificationofaustralasianspinytrapdoorspidersidiopidaearbanitinae‏ ‎‡A Post-Eocene climate change across continental Australia and the diversification of Australasian spiny trapdoor spiders (Idiopidae: Arbanitinae).‏ ‎‡9 1‏
919 ‎‡a phylogeographyoftheaustraliansugargliderpetaurusbrevicepsevidenceforanewdivergentlineageineasternaustralia‏ ‎‡A Phylogeography of the Australian sugar glider (Petaurus breviceps): evidence for a new divergent lineage in eastern Australia‏ ‎‡9 1‏
919 ‎‡a refiningtrophicdynamicsthroughmultifactorbayesianmixingmodelsacasestudyofsubterraneanbeetles‏ ‎‡A Refining trophic dynamics through multi-factor Bayesian mixing models: A case study of subterranean beetles‏ ‎‡9 1‏
919 ‎‡a opsintranscriptsofpredatorydivingbeetlesacomparisonofsurfaceandsubterraneanphoticniches‏ ‎‡A Opsin transcripts of predatory diving beetles: a comparison of surface and subterranean photic niches‏ ‎‡9 1‏
919 ‎‡a namingspecieswithnomorphologicalindicatorsspeciesstatusofgaleolariacaespitosaannelidaserpulidaeinferredfromnuclearandmitochondrialgenesequencesandmorphology‏ ‎‡A Naming species with no morphological indicators: species status of Galeolaria caespitosa (Annelida:Serpulidae) inferred from nuclear and mitochondrial gene sequences and morphology‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipsinthelizardgenusdiplodactylusgrayandresurrectionoflucasiumwermuthgekkotadiplodactylidae‏ ‎‡A Phylogenetic relationships in the lizard genus Diplodactylus Gray and resurrection of Lucasium Wermuth (Gekkota, Diplodactylidae)‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticsoftheexoneurineallodapinebeesrevealanancientandpuzzlingdispersalfromafricatoaustralia‏ ‎‡A Molecular phylogenetics of the exoneurine allodapine bees reveal an ancient and puzzling dispersal from Africa to Australia‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticanalysesrevealanewsouthernhemisphereoniscideanfamilycrustaceaisopodawithauniquewatertransportsystem‏ ‎‡A Molecular phylogenetic analyses reveal a new southern hemisphere oniscidean family (Crustacea: Isopoda) with a unique water transport system‏ ‎‡9 1‏
919 ‎‡a molecularsystematicsandbiodiversityofoniscideanisopodsinthegroundwatercalcretesofcentralwesternaustralia‏ ‎‡A Molecular systematics and biodiversity of oniscidean isopods in the groundwater calcretes of central Western Australia‏ ‎‡9 1‏
919 ‎‡a howblindaretheyphototacticresponsesinstygobiontdivingbeetlescoleopteradytiscidaefromcalcreteaquifersofwesternaustralia‏ ‎‡A How blind are they? Phototactic responses in stygobiont diving beetles (Coleoptera: Dytiscidae) from calcrete aquifers of Western Australia‏ ‎‡9 1‏
919 ‎‡a groundwaterisahiddenglobalkeystoneecosystem‏ ‎‡A Groundwater is a hidden global keystone ecosystem‏ ‎‡9 1‏
919 ‎‡a islandsunderthedesertmolecularsystematicsandevolutionaryoriginsofstygobiticwaterbeetlescoleopteradytiscidaefromcentralwesternaustralia‏ ‎‡A Islands under the desert: molecular systematics and evolutionary origins of stygobitic water beetles (Coleoptera: Dytiscidae) from central Western Australia‏ ‎‡9 1‏
919 ‎‡a evolutionofblindbeetlesinisolatedaquifersatestofalternativemodesofspeciation‏ ‎‡A Evolution of blind beetles in isolated aquifers: a test of alternative modes of speciation‏ ‎‡9 1‏
919 ‎‡a effectsoflandscapematrixonpopulationconnectivityofanarborealmammalpetaurusbreviceps‏ ‎‡A Effects of landscape matrix on population connectivity of an arboreal mammal, Petaurus breviceps‏ ‎‡9 1‏
919 ‎‡a explosiveradiationofthegenusschizoperaonasmallsubterraneanislandinwesternaustraliacopepodaharpacticoidaunravellingthecasesofcrypticspeciationsizedifferentiationandmultipleinvasions‏ ‎‡A Explosive radiation of the genus Schizopera on a small subterranean island in Western Australia (Copepoda:Harpacticoida): unravelling the cases of cryptic speciation, size differentiation and multiple invasions‏ ‎‡9 1‏
919 ‎‡a desertspringsdeepphylogeographicstructureinanancientendemiccrustaceanphreatomeruslatipes‏ ‎‡A Desert springs: deep phylogeographic structure in an ancient endemic crustacean (Phreatomerus latipes)‏ ‎‡9 1‏
919 ‎‡a crypticgreybellieddunnartsminthopsisgriseoventerdiscoveredinsouthaustraliageneticmorphologicalandsubfossilanalysesshowthevalueofcollectingvouchermaterial‏ ‎‡A Cryptic grey-bellied dunnart (Sminthopsis griseoventer) discovered in South Australia: genetic, morphological and subfossil analyses show the value of collecting voucher material‏ ‎‡9 1‏
919 ‎‡a developmentofamultiplexpanelofmicrosatellitemarkersfor2speciesofglidingmarsupialspetaurusbrevicepsandpetaurusnorfolcensis‏ ‎‡A Development of a multiplex panel of microsatellite markers for two species of gliding marsupials, Petaurus breviceps and Petaurus norfolcensis‏ ‎‡9 1‏
919 ‎‡a biogeographichistoryofsubterraneanisopodsfromgroundwatercalcreteislandsinwesternaustralia‏ ‎‡A Biogeographic history of subterranean isopods from groundwater calcrete islands in Western Australia‏ ‎‡9 1‏
919 ‎‡a extensiontotheknowndistributionofthesquirrelgliderpetaurusnorfolcensisinaustralia‏ ‎‡A An extension to the known distribution of the squirrel glider Petaurus norfolcensis in Australia.‏ ‎‡9 1‏
919 ‎‡a characterizationof9microsatellitelocifromtheendangeredsouthernbrownbandicootisoodonobesulususing454pyrosequencing‏ ‎‡A Characterization of nine microsatellite loci from the endangered southern brown bandicoot (Isoodon obesulus) using 454 pyrosequencing‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
947 ‎‡a AU‏ ‎‡9 1‏
996 ‎‡2 ISNI|0000000117943564‏
996 ‎‡2 LC|n 89122429‏
996 ‎‡2 SUDOC|092739601‏
996 ‎‡2 RERO|A009217579‏
996 ‎‡2 ISNI|000000037090813X‏
996 ‎‡2 SUDOC|243803958‏
996 ‎‡2 NDL|001100945‏
996 ‎‡2 SUDOC|181571056‏
996 ‎‡2 LC|n 97081480‏
996 ‎‡2 DNB|1321932383‏
996 ‎‡2 BNF|13493854‏
996 ‎‡2 ISNI|0000000067828794‏
996 ‎‡2 BIBSYS|90179205‏
996 ‎‡2 NTA|331765527‏
996 ‎‡2 ISNI|0000000370829511‏
996 ‎‡2 LC|no2014010112‏
996 ‎‡2 BLBNB|001564382‏
996 ‎‡2 LIH|LNB:C_j__t__y_;=C_k_‏
996 ‎‡2 NII|DA02275881‏
996 ‎‡2 SUDOC|111302129‏
996 ‎‡2 LC|n 93094074‏
996 ‎‡2 NUKAT|n 2015092158‏
996 ‎‡2 ISNI|0000000119146673‏
996 ‎‡2 J9U|987007384346305171‏
996 ‎‡2 LNB|LNC10-000195063‏
996 ‎‡2 BIBSYS|6044570‏
996 ‎‡2 SUDOC|081441746‏
996 ‎‡2 BNF|16944271‏
996 ‎‡2 NUKAT|n 2005141659‏
996 ‎‡2 BIBSYS|1056845‏
996 ‎‡2 RERO|A003133789‏
996 ‎‡2 J9U|987007442131005171‏
996 ‎‡2 LC|n 92080674‏
996 ‎‡2 ISNI|0000000032795929‏
996 ‎‡2 LC|n 88051926‏
996 ‎‡2 PLWABN|9813311494005606‏
996 ‎‡2 ISNI|000000011873959X‏
996 ‎‡2 ISNI|0000000038916007‏
996 ‎‡2 ISNI|0000000021939149‏
996 ‎‡2 LC|no2022001791‏
996 ‎‡2 ISNI|0000000084210531‏
996 ‎‡2 LC|no2019020426‏
996 ‎‡2 LC|n 80042140‏
996 ‎‡2 CAOONL|ncf11330257‏
996 ‎‡2 LIH|LNB:DNNX;=BU‏
996 ‎‡2 LC|no2015047846‏
996 ‎‡2 LC|n 94038753‏
996 ‎‡2 J9U|987011288477205171‏
996 ‎‡2 BNF|14651909‏
996 ‎‡2 ISNI|0000000456732331‏
996 ‎‡2 LC|n 2003037877‏
996 ‎‡2 LC|n 2005055274‏
996 ‎‡2 ISNI|000000003540716X‏
996 ‎‡2 LC|nb2013010294‏
996 ‎‡2 BNF|13619550‏
996 ‎‡2 DNB|1084830884‏
996 ‎‡2 LC|n 96066968‏
996 ‎‡2 BIBSYS|90297266‏
996 ‎‡2 SUDOC|235687715‏
996 ‎‡2 ISNI|0000000389088303‏
996 ‎‡2 LNB|LNC10-000133675‏
996 ‎‡2 LC|no2014029559‏
996 ‎‡2 NKC|jx20051128013‏
996 ‎‡2 LC|n 86032267‏
996 ‎‡2 DNB|140988009‏
996 ‎‡2 LC|no2019093327‏
996 ‎‡2 BIBSYS|90653983‏
996 ‎‡2 LC|n 2010029071‏
996 ‎‡2 LC|n 85111890‏
996 ‎‡2 LC|nb2013010359‏
996 ‎‡2 PLWABN|9810662479005606‏
996 ‎‡2 ISNI|0000000034417753‏
996 ‎‡2 DE633|pe30024332‏
996 ‎‡2 CAOONL|ncf10227755‏
996 ‎‡2 LC|n 2007072816‏
996 ‎‡2 RERO|A012769476‏
996 ‎‡2 SUDOC|145073505‏
996 ‎‡2 CAOONL|ncf11466077‏
996 ‎‡2 NII|DA05439012‏
996 ‎‡2 LC|no2011131047‏
996 ‎‡2 SUDOC|050315951‏
996 ‎‡2 NUKAT|n 01721021‏
996 ‎‡2 BNC|981058609781706706‏
996 ‎‡2 J9U|987007378206405171‏
996 ‎‡2 ISNI|0000000118621938‏
996 ‎‡2 ISNI|0000000370856579‏
996 ‎‡2 NUKAT|n 2007134493‏
996 ‎‡2 ISNI|0000000054885386‏
996 ‎‡2 RERO|A003133790‏
996 ‎‡2 ISNI|0000000074869009‏
996 ‎‡2 SUDOC|079120784‏
996 ‎‡2 LC|n 87132252‏
996 ‎‡2 BNF|16249667‏
996 ‎‡2 NII|DA01745196‏
996 ‎‡2 ISNI|0000000081276287‏
996 ‎‡2 CAOONL|ncf11451514‏
996 ‎‡2 ISNI|0000000055087108‏
996 ‎‡2 CAOONL|ncf11494330‏
996 ‎‡2 LC|n 2013014700‏
996 ‎‡2 DNB|1306711622‏
996 ‎‡2 LC|n 2006044401‏
996 ‎‡2 SUDOC|05660436X‏
996 ‎‡2 ISNI|0000000107979627‏
996 ‎‡2 LC|n 2002135851‏
996 ‎‡2 ISNI|000000011866839X‏
996 ‎‡2 NUKAT|n 2015090667‏
996 ‎‡2 DNB|173453325‏
996 ‎‡2 LC|nb2011030105‏
996 ‎‡2 LC|nb2011030104‏
996 ‎‡2 ISNI|0000000022310246‏
996 ‎‡2 NTA|18188447X‏
996 ‎‡2 LC|nb2012011399‏
996 ‎‡2 ISNI|0000000063928421‏
996 ‎‡2 NKC|xx0013530‏
996 ‎‡2 SUDOC|032439849‏
996 ‎‡2 ISNI|0000000500004586‏
996 ‎‡2 DNB|1216341869‏
996 ‎‡2 DNB|1203766505‏
996 ‎‡2 LC|n 2021037719‏
996 ‎‡2 LC|n 93115887‏
996 ‎‡2 LC|n 97078472‏
996 ‎‡2 N6I|vtls000361556‏
996 ‎‡2 PLWABN|9810583014105606‏
996 ‎‡2 SUDOC|254938957‏
996 ‎‡2 LC|n 2005023188‏
996 ‎‡2 DNB|1306710758‏
996 ‎‡2 ISNI|0000000035793347‏
996 ‎‡2 NSK|000193445‏
996 ‎‡2 RERO|A003133800‏
996 ‎‡2 RERO|A003133802‏
996 ‎‡2 LC|no2016007339‏
996 ‎‡2 LC|nb 90546534‏
996 ‎‡2 NLA|000036004010‏
996 ‎‡2 BIBSYS|11034114‏
996 ‎‡2 N6I|vtls000299649‏
996 ‎‡2 NUKAT|n 2012241264‏
996 ‎‡2 J9U|987007438833605171‏
996 ‎‡2 LC|n 2015180942‏
996 ‎‡2 J9U|987007334751205171‏
996 ‎‡2 ISNI|000000004120406X‏
996 ‎‡2 N6I|vtls000266008‏
996 ‎‡2 J9U|987007318223105171‏
996 ‎‡2 CAOONL|ncf10017969‏
996 ‎‡2 LC|no2008044109‏
996 ‎‡2 RERO|A027353495‏
996 ‎‡2 LC|no2001041614‏
996 ‎‡2 LC|n 87819818‏
996 ‎‡2 ISNI|0000000033968465‏
996 ‎‡2 NUKAT|n 2006076840‏
996 ‎‡2 BNF|12346945‏
996 ‎‡2 RERO|A003133799‏
996 ‎‡2 NSK|000647540‏
996 ‎‡2 ISNI|000000004522405X‏
996 ‎‡2 ISNI|0000000023639158‏
996 ‎‡2 NUKAT|n 2020025506‏
996 ‎‡2 LC|n 2008032539‏
996 ‎‡2 SUDOC|032624727‏
996 ‎‡2 J9U|987007458508605171‏
996 ‎‡2 LC|n 00092131‏
996 ‎‡2 PLWABN|9810644258105606‏
996 ‎‡2 DNB|1200365984‏
996 ‎‡2 J9U|987007457700505171‏
996 ‎‡2 JPG|500067810‏
996 ‎‡2 NTA|070403147‏
996 ‎‡2 LC|nb2012012272‏
996 ‎‡2 CAOONL|ncf11226921‏
996 ‎‡2 CAOONL|ncf11541334‏
996 ‎‡2 NTA|291067425‏
996 ‎‡2 ISNI|0000000078440816‏
996 ‎‡2 ISNI|0000000036882464‏
996 ‎‡2 LC|no2009027253‏
996 ‎‡2 LC|nb2003040944‏
996 ‎‡2 NTA|146753836‏
996 ‎‡2 ISNI|0000000027117226‏
996 ‎‡2 LC|no2013127387‏
996 ‎‡2 NII|DA08302604‏
996 ‎‡2 NUKAT|n 2015137576‏
996 ‎‡2 ISNI|0000000115915471‏
996 ‎‡2 ISNI|000000049720261X‏
996 ‎‡2 LC|n 90689343‏
996 ‎‡2 LC|nb2018022548‏
996 ‎‡2 DNB|142551864‏
996 ‎‡2 NTA|316352942‏
996 ‎‡2 BIBSYS|7003960‏
996 ‎‡2 BIBSYS|1707990462320‏
996 ‎‡2 BNF|12361909‏
996 ‎‡2 LC|n 82068184‏
996 ‎‡2 LC|n 84018392‏
996 ‎‡2 DNB|113996063‏
996 ‎‡2 LC|n 79087660‏
996 ‎‡2 ISNI|000000039078244X‏
996 ‎‡2 LC|n 81145925‏
996 ‎‡2 ISNI|0000000122566951‏
996 ‎‡2 LC|n 2023042482‏
996 ‎‡2 LC|n 2011047930‏
996 ‎‡2 BIBSYS|90255456‏
996 ‎‡2 J9U|987007277977305171‏
996 ‎‡2 LC|no2002090311‏
996 ‎‡2 ISNI|0000000428000432‏
996 ‎‡2 DNB|114559168X‏
996 ‎‡2 LC|no 93031341‏
996 ‎‡2 NUKAT|n 2012040094‏
996 ‎‡2 NII|DA07383214‏
996 ‎‡2 J9U|987007371002105171‏
996 ‎‡2 BLBNB|001463319‏
996 ‎‡2 NDL|00436605‏
996 ‎‡2 BIBSYS|13020972‏
996 ‎‡2 CAOONL|ncf11395158‏
996 ‎‡2 BNF|14651569‏
996 ‎‡2 DNB|173584357‏
996 ‎‡2 LC|n 2002067053‏
996 ‎‡2 LC|no2011057718‏
996 ‎‡2 J9U|987007414163005171‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏