VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q39187481 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010716.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q39187481‏
024 ‎‡a 0000-0003-4477-7412‏ ‎‡2 orcid‏
024 ‎‡a 22941905700‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q39187481‏
100 0 ‎‡a Raffaele Serra‏ ‎‡c researcher‏ ‎‡9 en‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Raffaele Serra‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
400 0 ‎‡a Raffaele Serra‏ ‎‡c investigador‏ ‎‡9 ast‏
400 0 ‎‡a Raffaele Serra‏ ‎‡c ricercatore‏ ‎‡9 it‏
400 0 ‎‡a Raffaele Serra‏ ‎‡c investigador‏ ‎‡9 es‏
670 ‎‡a Author's A Combination of Thoracic and Abdominal Stent-Grafts to Treat An Abdominal Aortic Aneurysm with Hostile Proximal Neck‏
670 ‎‡a Author's A genetic study of chronic venous insufficiency‏
670 ‎‡a Author's Absorbable suture material in carotid surgery.‏
670 ‎‡a Author's Adjuvant spinal cord stimulation improves wound healing of peripheral tissue loss due to steal syndrome of the hand: clinical challenge treating a difficult case.‏
670 ‎‡a Author's Adult vascular wall resident multipotent vascular stem cells, matrix metalloproteinases, and arterial aneurysms‏
670 ‎‡a Author's Air contamination in the sclerosing foam for the treatment of varicose veins‏
670 ‎‡a Author's Albumin administration prevents the onset of pressure ulcers in intensive care unit patients‏
670 ‎‡a Author's Altered metalloproteinase-9 expression as least common denominator between varicocele, inguinal hernia, and chronic venous disorders‏
670 ‎‡a Author's An Hybrid 2-Stage Technique to Treat a Post-Traumatic Internal Carotid-Jugular Fistula.‏
670 ‎‡a Author's An uncommon case of arterial aneurysms association with high plasma levels of Matrix Metalloproteinase-9 and Neutrophil Gelatinase-Associated Lipocalin.‏
670 ‎‡a Author's An Uncommon Case of Type III Endoleak Treated with a Custom-made Thoracic Stent Graft‏
670 ‎‡a Author's Angiosome-targeted revascularisation in diabetic foot ulcers‏
670 ‎‡a Author's Aortic banding and endovascular aneurysm repair in a case of juxtarenal aortic aneurysm with unsuitable infrarenal neck‏
670 ‎‡a Author's Application of autologous platelet-rich plasma to enhance wound healing after lower limb revascularization: A case series and literature review.‏
670 ‎‡a Author's Application of platelet-rich gel to enhance healing of transmetatarsal amputations in diabetic dysvascular patients.‏
670 ‎‡a Author's Aterofisiol(®) in carotid plaque evolution‏
670 ‎‡a Author's Axillary vein thrombosis as the first clinical manifestation of inflammatory breast cancer: report of a case‏
670 ‎‡a Author's BioEnterics Intragastric Balloon‏
670 ‎‡a Author's BioEnterics Intragastric Balloon (BIB) versus Spatz Adjustable Balloon System (ABS): Our experience in the elderly‏
670 ‎‡a Author's Biomarkers in post-reperfusion syndrome after acute lower limb ischaemia.‏
670 ‎‡a Author's Body mass index, metabolic syndrome and carotid atherosclerosis.‏
670 ‎‡a Author's Breast cancer and venous disease: a retrospective cohort study.‏
670 ‎‡a Author's Cardiovascular disease as a biomarker for an increased risk of COVID-19 infection and related poor prognosis‏
670 ‎‡a Author's Carotid body paragangliomas and matrix metalloproteinases‏
670 ‎‡a Author's Cell Therapy in Patients with Critical Limb Ischemia‏
670 ‎‡a Author's Cerebral stroke injury: the role of cytokines and brain inflammation‏
670 ‎‡a Author's Chronic venous leg ulcers are associated with high levels of metalloproteinases-9 and neutrophil gelatinase-associated lipocalin‏
670 ‎‡a Author's Chronic wound infections: the role of Pseudomonas aeruginosa and Staphylococcus aureus‏
670 ‎‡a Author's Cilostazol prevents foot ulcers in diabetic patients with peripheral vascular disease‏
670 ‎‡a Author's Combined medical, surgical and endovascular treatment of a giant cell arteritis case manifesting as upper limbs acute ischemia.‏
670 ‎‡a Author's Concomitant aortic leiomyosarcoma and takayasu arteritis in a 55-year-old male patient.‏
670 ‎‡a Author's Contribution of Predictive and Prognostic Biomarkers to Clinical Research on Chronic Kidney Disease‏
670 ‎‡a Author's COVID-19 and the Kidney: From Epidemiology to Clinical Practice‏
670 ‎‡a Author's Cyanacrylate Glue Caused Extrinsic Compression of an Infrapopliteal Vein Graft‏
670 ‎‡a Author's Day-surgery inguinal hernia repair in the elderly: single centre experience‏
670 ‎‡a Author's Doxycycline speeds up healing of chronic venous ulcers.‏
670 ‎‡a Author's Effectiveness of prostaglandin E1 in patients with mixed arterial and venous ulcers of the lower limbs‏
670 ‎‡a Author's Effects of a new nutraceutical substance on clinical and molecular parameters in patients with chronic venous ulceration.‏
670 ‎‡a Author's Effects of glucocorticoids and tumor necrosis factor-alpha inhibitors on both clinical and molecular parameters in patients with Takayasu arteritis.‏
670 ‎‡a Author's Effects of sulodexide on stability of sclerosing foams‏
670 ‎‡a Author's Endothelin-1, nitric oxide, serotonin and high blood pressure in male adolescents‏
670 ‎‡a Author's Endovascular Aortic Repair Complications and the Power of Endovascular Solutions‏
670 ‎‡a Author's Endovascular repair for acute traumatic transection of the descending thoracic aorta: experience of a single centre with a 12-years follow up.‏
670 ‎‡a Author's Endovascular Treatment of a Carotid Pseudoaneurysm Using the New Double-Layer Micromesh Stent (Roadsaver®)‏
670 ‎‡a Author's Estrogen Receptors and Chronic Venous Disease‏
670 ‎‡a Author's External Iliac Artery to Tibial Arteries Vein Graft for Inaccessible Femoral Artery‏
670 ‎‡a Author's Extracellular matrix assessment of infected chronic venous leg ulcers: role of metalloproteinases and inflammatory cytokines‏
670 ‎‡a Author's Extreme distal bypass to improve wound healing in Buerger's disease‏
670 ‎‡a Author's Fatal early peripheral post-reperfusion syndrome and the role of cutaneous signs‏
670 ‎‡a Author's Fondaparinux vs warfarin for the treatment of unsuspected pulmonary embolism in cancer patients‏
670 ‎‡a Author's From varices to venous ulceration: the story of chronic venous disease described by metalloproteinases‏
670 ‎‡a Author's Functional chronic venous disease: A systematic review‏
670 ‎‡a Author's Gene Therapy to prevent thrombosis and anastomotic restenosis after vascular bypass procedures‏
670 ‎‡a Author's Guidelines for venous thromboembolism and clinical practice in Italy: a nationwide survey.‏
670 ‎‡a Author's Hemorrhoids and matrix metalloproteinases: A multicenter study on the predictive role of biomarkers‏
670 ‎‡a Author's Hepatic ischemia reperfusion injury: A systematic review of literature and the role of current drugs and biomarkers‏
670 ‎‡a Author's Hyperhomocysteinaemia and chronic venous ulcers‏
670 ‎‡a Author's Increased plasma levels of metalloproteinase-9 and neutrophil gelatinase-associated lipocalin in a rare case of multiple artery aneurysm‏
670 ‎‡a Author's Laparoscopic single site‏
670 ‎‡a Author's Laparoscopic single site (LESS) and classic video-laparoscopic cholecystectomy in the elderly: A single centre experience.‏
670 ‎‡a Author's Liver resection for metastases from colorectal cancer in very elderly patients: New surgical horizons‏
670 ‎‡a Author's Loss of Eyebrows and Eyelashes During Concomitant Treatment with Sitagliptin and Metformin‏
670 ‎‡a Author's Low molecular weight heparin improves healing of chronic venous ulcers especially in the elderly‏
670 ‎‡a Author's Low serum albumin level as an independent risk factor for the onset of pressure ulcers in intensive care unit patients‏
670 ‎‡a Author's Male breast cancer manifesting as cephalic vein thrombosis‏
670 ‎‡a Author's Matrix metalloproteinases and endothelial dysfunction: The search for new prognostic markers and for new therapeutic targets for vascular wall imbalance‏
670 ‎‡a Author's Matrix metalloproteinases and risk stratification in patients undergoing surgical revascularisation for critical limb ischaemia‏
670 ‎‡a Author's Matrix Metalloproteinases in Health and Disease‏
670 ‎‡a Author's Mesenteric Venous Thrombosis and the need for a specialized Intestinal Stroke Center‏
670 ‎‡a Author's Multivisceral resection for occlusive colorectal cancer: Is it justified?‏
670 ‎‡a Author's Neutrophil-to-lymphocyte Ratio and Platelet-to-lymphocyte Ratio as Biomarkers for Cardiovascular Surgery Procedures: A Literature Review‏
670 ‎‡a Author's One-step mini-invasive treatment of abdominal aortic-iliac aneurysm associated with colo-rectal cancer‏
670 ‎‡a Author's Plasma and blood viscosity in metabolic syndrome‏
670 ‎‡a Author's Plasma MMP and TIMP evaluation in patients with deep venous thrombosis: could they have a predictive role in the development of post-thrombotic syndrome?‏
670 ‎‡a Author's Precision Medicine and Precision Nursing: The Era of Biomarkers and Precision Health‏
670 ‎‡a Author's PredyCLU: a prediction system for chronic leg ulcers based on fuzzy logic; part I - exploring the venous side.‏
670 ‎‡a Author's Protein S-100B as biochemical marker of brain ischemic damage after treatment of carotid stenosis‏
670 ‎‡a Author's Recent developments on foaming mechanical and electronic techniques for the management of varicose veins‏
670 ‎‡a Author's Relationship between gastroesophageal reflux disease and Ph nose and salivary: proposal of a simple method outpatient in patients adults.‏
670 ‎‡a Author's Resection of Carotid Body Tumors reduces arterial blood pressure. An underestimated neuroendocrine syndrome.‏
670 ‎‡a Author's Resection of hepatocellular carcinoma in elderly patients and the role of energy balance‏
670 ‎‡a Author's Risk Management and Recommendations for the Prevention of Fatal Foreign Body Aspiration: Four Cases Aged 1.5 to 3 Years and Mini-Review of the Literature‏
670 ‎‡a Author's Role of matrix metalloproteinases in non-healing venous ulcers‏
670 ‎‡a Author's Roles and Clinical Applications of Biomarkers in Cardiovascular Disease.‏
670 ‎‡a Author's Roles and Clinical Applications of Biomarkers in Cardiovascular Disease 2017.‏
670 ‎‡a Author's Selective endothelin A receptor antagonism in patients with proteinuric chronic kidney disease‏
670 ‎‡a Author's Single incision laparoscopic cholecystectomy in geriatric patients.‏
670 ‎‡a Author's Skin grafting followed by low-molecular-weight heparin long-term therapy in chronic venous leg ulcers‏
670 ‎‡a Author's Skin grafting for the treatment of chronic leg ulcers - a systematic review in evidence-based medicine.‏
670 ‎‡a Author's Skin-sparing mastectomy with immediate breast and nipple reconstruction: a new technique of nipple reconstruction.‏
670 ‎‡a Author's Skin tears and risk factors assessment: a systematic review on evidence-based medicine‏
670 ‎‡a Author's Spinal Cord Stimulation Therapy for the Treatment of Concomitant Phantom Limb Pain and Critical Limb Ischemia‏
670 ‎‡a Author's Spinal cord stimulation to achieve wound healing in a primary lower limb critical ischaemia referral centre‏
670 ‎‡a Author's Study on the efficacy of surgery of the superficial venous system and of compression therapy at early stages of chronic venous disease for the prevention of chronic venous ulceration‏
670 ‎‡a Author's Successfully Kissing Stent of Innominate Artery and Left Common Carotid Artery Subsequent to Blunt Injury, in the Setting of a Bovine Aortic Arch‏
670 ‎‡a Author's Surgical resection of carotid body paragangliomas: 10 years of experience‏
670 ‎‡a Author's Surgical treatment of recidivist lymphedema.‏
670 ‎‡a Author's Symptoms in patients with skin changes due to chronic venous insufficiency often lead to emergency care service: an Italian observational study‏
670 ‎‡a Author's Tailored treatment of intestinal angiodysplasia in elderly.‏
670 ‎‡a Author's The care of transmetatarsal amputation in diabetic foot gangrene‏
670 ‎‡a Author's The Discovery of Novel Genomic, Transcriptomic, and Proteomic Biomarkers in Cardiovascular and Peripheral Vascular Disease: The State of the Art‏
670 ‎‡a Author's The effects of sulodexide on both clinical and molecular parameters in patients with mixed arterial and venous ulcers of lower limbs‏
670 ‎‡a Author's The impact of BMI on early colorectal neoplastic lesions and the role of endoscopic diagnosis:. An Italian observational study‏
670 ‎‡a Author's The importance of extended thromboprophylaxis in patients undergoing major surgery for cancer‏
670 ‎‡a Author's The Management of Cardiovascular Risk through Epigenetic Biomarkers‏
670 ‎‡a Author's The management of Takayasu's arteritis: personal experience‏
670 ‎‡a Author's The need to identify new P2Y₁₂ receptor inhibitors in the management and prevention of arterial thrombosis‏
670 ‎‡a Author's The role of adult tissue-derived stem cells in chronic leg ulcers: a systematic review focused on tissue regeneration medicine.‏
670 ‎‡a Author's The Role of Biofilm in Central Venous Catheter Related Bloodstream Infections: Evidence-based Nursing and Review of the Literature‏
670 ‎‡a Author's The role of matrix metalloproteinases and neutrophil gelatinase-associated lipocalin in central and peripheral arterial aneurysms‏
670 ‎‡a Author's The role of procalcitonin as a marker of diabetic foot ulcer infection‏
670 ‎‡a Author's The Role of Prognostic and Predictive Biomarkers for Assessing Cardiovascular Risk in Chronic Kidney Disease Patients‏
670 ‎‡a Author's The role of thrombolysis for patients with hemodynamically stable acute pulmonary embolism‏
670 ‎‡a Author's The use of growth factors, CD34(+) cells and fibrin for the management of chronic venous ulcers‏
670 ‎‡a Author's Theophylline action on primary human bronchial epithelial cells under proinflammatory stimuli and steroidal drugs: a therapeutic rationale approach‏
670 ‎‡a Author's Traumatic Anterior Knee Dislocation with Popliteal Artery Injury: The Importance of a Prompt Diagnosis and Treatment to Obtain Lower Limb Salvage‏
670 ‎‡a Author's Trophic effects of polynucleotides and hyaluronic acid in the healing of venous ulcers of the lower limbs: a clinical study.‏
670 ‎‡a Author's Update on the renal toxicity of iodinated contrast drugs used in clinical medicine‏
670 ‎‡a Author's Updates in Pathophysiology, Diagnosis and Management of Takayasu Arteritis‏
670 ‎‡a Author's Upper extremity vein thrombosis: an alert symptom of breast cancer in elderly patients. Experience on personal casuistry and review of the literature‏
670 ‎‡a Author's VAC therapy for the treatment of complex wounds after cardio-thoracic surgery‏
670 ‎‡a Author's VAC therapy to promote wound healing after surgical revascularisation for critical lower limb ischaemia.‏
670 ‎‡a Author's Varicocele in younger as risk factor for inguinal hernia and for chronic venous disease in older: preliminary results of a prospective cohort study‏
670 ‎‡a Author's Venous aneurysm complicating arteriovenous fistula access and matrix metalloproteinases.‏
670 ‎‡a Author's When Less Invasive Causes Major Sequelae: A Dramatic Evolution of an Infected Common Femoral Artery Patch‏
909 ‎‡a (orcid) 0000000344777412‏ ‎‡9 1‏
909 ‎‡a (scopus) 22941905700‏ ‎‡9 1‏
919 ‎‡a alteredmetalloproteinase9expressionasleastcommondenominatorbetweenvaricoceleinguinalherniaandchronicvenousdisorders‏ ‎‡A Altered metalloproteinase-9 expression as least common denominator between varicocele, inguinal hernia, and chronic venous disorders‏ ‎‡9 1‏
919 ‎‡a whenlessinvasivecausesmajorsequelaeadramaticevolutionofaninfectedcommonfemoralarterypatch‏ ‎‡A When Less Invasive Causes Major Sequelae: A Dramatic Evolution of an Infected Common Femoral Artery Patch‏ ‎‡9 1‏
919 ‎‡a venousaneurysmcomplicatingarteriovenousfistulaaccessandmatrixmetalloproteinases‏ ‎‡A Venous aneurysm complicating arteriovenous fistula access and matrix metalloproteinases.‏ ‎‡9 1‏
919 ‎‡a varicoceleinyoungerasriskfactorforinguinalherniaandforchronicvenousdiseaseinolderpreliminaryresultsofaprospectivecohortstudy‏ ‎‡A Varicocele in younger as risk factor for inguinal hernia and for chronic venous disease in older: preliminary results of a prospective cohort study‏ ‎‡9 1‏
919 ‎‡a vactherapytopromotewoundhealingaftersurgicalrevascularisationforcriticallowerlimbischaemia‏ ‎‡A VAC therapy to promote wound healing after surgical revascularisation for critical lower limb ischaemia.‏ ‎‡9 1‏
919 ‎‡a vactherapyforthetreatmentofcomplexwoundsaftercardiothoracicsurgery‏ ‎‡A VAC therapy for the treatment of complex wounds after cardio-thoracic surgery‏ ‎‡9 1‏
919 ‎‡a upperextremityveinthrombosisanalertsymptomofbreastcancerinelderlypatientsexperienceonpersonalcasuistryandreviewoftheliterature‏ ‎‡A Upper extremity vein thrombosis: an alert symptom of breast cancer in elderly patients. Experience on personal casuistry and review of the literature‏ ‎‡9 1‏
919 ‎‡a updatesinpathophysiologydiagnosisandmanagementoftakayasuarteritis‏ ‎‡A Updates in Pathophysiology, Diagnosis and Management of Takayasu Arteritis‏ ‎‡9 1‏
919 ‎‡a updateontherenaltoxicityofiodinatedcontrastdrugsusedinclinicalmedicine‏ ‎‡A Update on the renal toxicity of iodinated contrast drugs used in clinical medicine‏ ‎‡9 1‏
919 ‎‡a trophiceffectsofpolynucleotidesandhyaluronicacidinthehealingofvenousulcersofthelowerlimbsaclinicalstudy‏ ‎‡A Trophic effects of polynucleotides and hyaluronic acid in the healing of venous ulcers of the lower limbs: a clinical study.‏ ‎‡9 1‏
919 ‎‡a traumaticanteriorkneedislocationwithpoplitealarteryinjurytheimportanceofapromptdiagnosisandtreatmenttoobtainlowerlimbsalvage‏ ‎‡A Traumatic Anterior Knee Dislocation with Popliteal Artery Injury: The Importance of a Prompt Diagnosis and Treatment to Obtain Lower Limb Salvage‏ ‎‡9 1‏
919 ‎‡a theophyllineactiononprimaryhumanbronchialepithelialcellsunderproinflammatorystimuliandsteroidaldrugsatherapeuticrationaleapproach‏ ‎‡A Theophylline action on primary human bronchial epithelial cells under proinflammatory stimuli and steroidal drugs: a therapeutic rationale approach‏ ‎‡9 1‏
919 ‎‡a useofgrowthfactorscd34+cellsandfibrinforthemanagementofchronicvenousulcers‏ ‎‡A The use of growth factors, CD34(+) cells and fibrin for the management of chronic venous ulcers‏ ‎‡9 1‏
919 ‎‡a roleofthrombolysisforpatientswithhemodynamicallystableacutepulmonaryembolism‏ ‎‡A The role of thrombolysis for patients with hemodynamically stable acute pulmonary embolism‏ ‎‡9 1‏
919 ‎‡a roleofprognosticandpredictivebiomarkersforassessingcardiovascularriskinchronickidneydiseasepatients‏ ‎‡A The Role of Prognostic and Predictive Biomarkers for Assessing Cardiovascular Risk in Chronic Kidney Disease Patients‏ ‎‡9 1‏
919 ‎‡a roleofprocalcitoninasamarkerofdiabeticfootulcerinfection‏ ‎‡A The role of procalcitonin as a marker of diabetic foot ulcer infection‏ ‎‡9 1‏
919 ‎‡a roleofmatrixmetalloproteinasesandneutrophilgelatinaseassociatedlipocalinincentralandperipheralarterialaneurysms‏ ‎‡A The role of matrix metalloproteinases and neutrophil gelatinase-associated lipocalin in central and peripheral arterial aneurysms‏ ‎‡9 1‏
919 ‎‡a roleofbiofilmincentralvenouscatheterrelatedbloodstreaminfectionsevidencebasednursingandreviewoftheliterature‏ ‎‡A The Role of Biofilm in Central Venous Catheter Related Bloodstream Infections: Evidence-based Nursing and Review of the Literature‏ ‎‡9 1‏
919 ‎‡a roleofadulttissuederivedstemcellsinchroniclegulcersasystematicreviewfocusedontissueregenerationmedicine‏ ‎‡A The role of adult tissue-derived stem cells in chronic leg ulcers: a systematic review focused on tissue regeneration medicine.‏ ‎‡9 1‏
919 ‎‡a needtoidentifynewp2y12receptorinhibitorsinthemanagementandpreventionofarterialthrombosis‏ ‎‡A The need to identify new P2Y₁₂ receptor inhibitors in the management and prevention of arterial thrombosis‏ ‎‡9 1‏
919 ‎‡a managementoftakayasusarteritispersonalexperience‏ ‎‡A The management of Takayasu's arteritis: personal experience‏ ‎‡9 1‏
919 ‎‡a managementofcardiovascularriskthroughepigeneticbiomarkers‏ ‎‡A The Management of Cardiovascular Risk through Epigenetic Biomarkers‏ ‎‡9 1‏
919 ‎‡a importanceofextendedthromboprophylaxisinpatientsundergoingmajorsurgeryforcancer‏ ‎‡A The importance of extended thromboprophylaxis in patients undergoing major surgery for cancer‏ ‎‡9 1‏
919 ‎‡a impactofbmionearlycolorectalneoplasticlesionsandtheroleofendoscopicdiagnosisanitalianobservationalstudy‏ ‎‡A The impact of BMI on early colorectal neoplastic lesions and the role of endoscopic diagnosis:. An Italian observational study‏ ‎‡9 1‏
919 ‎‡a effectsofsulodexideonbothclinicalandmolecularparametersinpatientswithmixedarterialandvenousulcersoflowerlimbs‏ ‎‡A The effects of sulodexide on both clinical and molecular parameters in patients with mixed arterial and venous ulcers of lower limbs‏ ‎‡9 1‏
919 ‎‡a discoveryofnovelgenomictranscriptomicandproteomicbiomarkersincardiovascularandperipheralvasculardiseasethestateoftheart‏ ‎‡A The Discovery of Novel Genomic, Transcriptomic, and Proteomic Biomarkers in Cardiovascular and Peripheral Vascular Disease: The State of the Art‏ ‎‡9 1‏
919 ‎‡a careoftransmetatarsalamputationindiabeticfootgangrene‏ ‎‡A The care of transmetatarsal amputation in diabetic foot gangrene‏ ‎‡9 1‏
919 ‎‡a tailoredtreatmentofintestinalangiodysplasiainelderly‏ ‎‡A Tailored treatment of intestinal angiodysplasia in elderly.‏ ‎‡9 1‏
919 ‎‡a symptomsinpatientswithskinchangesduetochronicvenousinsufficiencyoftenleadtoemergencycareserviceanitalianobservationalstudy‏ ‎‡A Symptoms in patients with skin changes due to chronic venous insufficiency often lead to emergency care service: an Italian observational study‏ ‎‡9 1‏
919 ‎‡a surgicaltreatmentofrecidivistlymphedema‏ ‎‡A Surgical treatment of recidivist lymphedema.‏ ‎‡9 1‏
919 ‎‡a surgicalresectionofcarotidbodyparagangliomas10yearsofexperience‏ ‎‡A Surgical resection of carotid body paragangliomas: 10 years of experience‏ ‎‡9 1‏
919 ‎‡a successfullykissingstentofinnominatearteryandleftcommoncarotidarterysubsequenttobluntinjuryinthesettingofabovineaorticarch‏ ‎‡A Successfully Kissing Stent of Innominate Artery and Left Common Carotid Artery Subsequent to Blunt Injury, in the Setting of a Bovine Aortic Arch‏ ‎‡9 1‏
919 ‎‡a studyontheefficacyofsurgeryofthesuperficialvenoussystemandofcompressiontherapyatearlystagesofchronicvenousdiseaseforthepreventionofchronicvenousulceration‏ ‎‡A Study on the efficacy of surgery of the superficial venous system and of compression therapy at early stages of chronic venous disease for the prevention of chronic venous ulceration‏ ‎‡9 1‏
919 ‎‡a spinalcordstimulationtoachievewoundhealinginaprimarylowerlimbcriticalischaemiareferralcentre‏ ‎‡A Spinal cord stimulation to achieve wound healing in a primary lower limb critical ischaemia referral centre‏ ‎‡9 1‏
919 ‎‡a spinalcordstimulationtherapyforthetreatmentofconcomitantphantomlimbpainandcriticallimbischemia‏ ‎‡A Spinal Cord Stimulation Therapy for the Treatment of Concomitant Phantom Limb Pain and Critical Limb Ischemia‏ ‎‡9 1‏
919 ‎‡a skintearsandriskfactorsassessmentasystematicreviewonevidencebasedmedicine‏ ‎‡A Skin tears and risk factors assessment: a systematic review on evidence-based medicine‏ ‎‡9 1‏
919 ‎‡a skinsparingmastectomywithimmediatebreastandnipplereconstructionanewtechniqueofnipplereconstruction‏ ‎‡A Skin-sparing mastectomy with immediate breast and nipple reconstruction: a new technique of nipple reconstruction.‏ ‎‡9 1‏
919 ‎‡a skingraftingforthetreatmentofchroniclegulcersasystematicreviewinevidencebasedmedicine‏ ‎‡A Skin grafting for the treatment of chronic leg ulcers - a systematic review in evidence-based medicine.‏ ‎‡9 1‏
919 ‎‡a skingraftingfollowedbylowmolecularweightheparinlongtermtherapyinchronicvenouslegulcers‏ ‎‡A Skin grafting followed by low-molecular-weight heparin long-term therapy in chronic venous leg ulcers‏ ‎‡9 1‏
919 ‎‡a singleincisionlaparoscopiccholecystectomyingeriatricpatients‏ ‎‡A Single incision laparoscopic cholecystectomy in geriatric patients.‏ ‎‡9 1‏
919 ‎‡a selectiveendothelinareceptorantagonisminpatientswithproteinuricchronickidneydisease‏ ‎‡A Selective endothelin A receptor antagonism in patients with proteinuric chronic kidney disease‏ ‎‡9 1‏
919 ‎‡a rolesandclinicalapplicationsofbiomarkersincardiovasculardisease‏ ‎‡A Roles and Clinical Applications of Biomarkers in Cardiovascular Disease 2017.‏ ‎‡9 2‏
919 ‎‡a roleofmatrixmetalloproteinasesinnonhealingvenousulcers‏ ‎‡A Role of matrix metalloproteinases in non-healing venous ulcers‏ ‎‡9 1‏
919 ‎‡a riskmanagementandrecommendationsforthepreventionoffatalforeignbodyaspiration4casesaged15to3yearsandminireviewoftheliterature‏ ‎‡A Risk Management and Recommendations for the Prevention of Fatal Foreign Body Aspiration: Four Cases Aged 1.5 to 3 Years and Mini-Review of the Literature‏ ‎‡9 1‏
919 ‎‡a resectionofhepatocellularcarcinomainelderlypatientsandtheroleofenergybalance‏ ‎‡A Resection of hepatocellular carcinoma in elderly patients and the role of energy balance‏ ‎‡9 1‏
919 ‎‡a resectionofcarotidbodytumorsreducesarterialbloodpressureanunderestimatedneuroendocrinesyndrome‏ ‎‡A Resection of Carotid Body Tumors reduces arterial blood pressure. An underestimated neuroendocrine syndrome.‏ ‎‡9 1‏
919 ‎‡a relationshipbetweengastroesophagealrefluxdiseaseandphnoseandsalivaryproposalofasimplemethodoutpatientinpatientsadults‏ ‎‡A Relationship between gastroesophageal reflux disease and Ph nose and salivary: proposal of a simple method outpatient in patients adults.‏ ‎‡9 1‏
919 ‎‡a recentdevelopmentsonfoamingmechanicalandelectronictechniquesforthemanagementofvaricoseveins‏ ‎‡A Recent developments on foaming mechanical and electronic techniques for the management of varicose veins‏ ‎‡9 1‏
919 ‎‡a proteins100basbiochemicalmarkerofbrainischemicdamageaftertreatmentofcarotidstenosis‏ ‎‡A Protein S-100B as biochemical marker of brain ischemic damage after treatment of carotid stenosis‏ ‎‡9 1‏
919 ‎‡a predycluapredictionsystemforchroniclegulcersbasedonfuzzylogicpart1exploringthevenousside‏ ‎‡A PredyCLU: a prediction system for chronic leg ulcers based on fuzzy logic; part I - exploring the venous side.‏ ‎‡9 1‏
919 ‎‡a precisionmedicineandprecisionnursingtheeraofbiomarkersandprecisionhealth‏ ‎‡A Precision Medicine and Precision Nursing: The Era of Biomarkers and Precision Health‏ ‎‡9 1‏
919 ‎‡a plasmammpandtimpevaluationinpatientswithdeepvenousthrombosiscouldtheyhaveapredictiveroleinthedevelopmentofpostthromboticsyndrome‏ ‎‡A Plasma MMP and TIMP evaluation in patients with deep venous thrombosis: could they have a predictive role in the development of post-thrombotic syndrome?‏ ‎‡9 1‏
919 ‎‡a plasmaandbloodviscosityinmetabolicsyndrome‏ ‎‡A Plasma and blood viscosity in metabolic syndrome‏ ‎‡9 1‏
919 ‎‡a 1stepminiinvasivetreatmentofabdominalaorticiliacaneurysmassociatedwithcolorectalcancer‏ ‎‡A One-step mini-invasive treatment of abdominal aortic-iliac aneurysm associated with colo-rectal cancer‏ ‎‡9 1‏
919 ‎‡a neutrophiltolymphocyteratioandplatelettolymphocyteratioasbiomarkersforcardiovascularsurgeryproceduresaliteraturereview‏ ‎‡A Neutrophil-to-lymphocyte Ratio and Platelet-to-lymphocyte Ratio as Biomarkers for Cardiovascular Surgery Procedures: A Literature Review‏ ‎‡9 1‏
919 ‎‡a multivisceralresectionforocclusivecolorectalcancerisitjustified‏ ‎‡A Multivisceral resection for occlusive colorectal cancer: Is it justified?‏ ‎‡9 1‏
919 ‎‡a mesentericvenousthrombosisandtheneedforaspecializedintestinalstrokecenter‏ ‎‡A Mesenteric Venous Thrombosis and the need for a specialized Intestinal Stroke Center‏ ‎‡9 1‏
919 ‎‡a matrixmetalloproteinasesinhealthanddisease‏ ‎‡A Matrix Metalloproteinases in Health and Disease‏ ‎‡9 1‏
919 ‎‡a matrixmetalloproteinasesandriskstratificationinpatientsundergoingsurgicalrevascularisationforcriticallimbischaemia‏ ‎‡A Matrix metalloproteinases and risk stratification in patients undergoing surgical revascularisation for critical limb ischaemia‏ ‎‡9 1‏
919 ‎‡a matrixmetalloproteinasesandendothelialdysfunctionthesearchfornewprognosticmarkersandfornewtherapeutictargetsforvascularwallimbalance‏ ‎‡A Matrix metalloproteinases and endothelial dysfunction: The search for new prognostic markers and for new therapeutic targets for vascular wall imbalance‏ ‎‡9 1‏
919 ‎‡a malebreastcancermanifestingascephalicveinthrombosis‏ ‎‡A Male breast cancer manifesting as cephalic vein thrombosis‏ ‎‡9 1‏
919 ‎‡a lowserumalbuminlevelasanindependentriskfactorfortheonsetofpressureulcersinintensivecareunitpatients‏ ‎‡A Low serum albumin level as an independent risk factor for the onset of pressure ulcers in intensive care unit patients‏ ‎‡9 1‏
919 ‎‡a lowmolecularweightheparinimproveshealingofchronicvenousulcersespeciallyintheelderly‏ ‎‡A Low molecular weight heparin improves healing of chronic venous ulcers especially in the elderly‏ ‎‡9 1‏
919 ‎‡a lossofeyebrowsandeyelashesduringconcomitanttreatmentwithsitagliptinandmetformin‏ ‎‡A Loss of Eyebrows and Eyelashes During Concomitant Treatment with Sitagliptin and Metformin‏ ‎‡9 1‏
919 ‎‡a liverresectionformetastasesfromcolorectalcancerinveryelderlypatientsnewsurgicalhorizons‏ ‎‡A Liver resection for metastases from colorectal cancer in very elderly patients: New surgical horizons‏ ‎‡9 1‏
919 ‎‡a laparoscopicsinglesitelessandclassicvideolaparoscopiccholecystectomyintheelderlyasinglecentreexperience‏ ‎‡A Laparoscopic single site (LESS) and classic video-laparoscopic cholecystectomy in the elderly: A single centre experience.‏ ‎‡9 1‏
919 ‎‡a laparoscopicsinglesite‏ ‎‡A Laparoscopic single site‏ ‎‡9 1‏
919 ‎‡a increasedplasmalevelsofmetalloproteinase9andneutrophilgelatinaseassociatedlipocalininararecaseofmultiplearteryaneurysm‏ ‎‡A Increased plasma levels of metalloproteinase-9 and neutrophil gelatinase-associated lipocalin in a rare case of multiple artery aneurysm‏ ‎‡9 1‏
919 ‎‡a hyperhomocysteinaemiaandchronicvenousulcers‏ ‎‡A Hyperhomocysteinaemia and chronic venous ulcers‏ ‎‡9 1‏
919 ‎‡a hepaticischemiareperfusioninjuryasystematicreviewofliteratureandtheroleofcurrentdrugsandbiomarkers‏ ‎‡A Hepatic ischemia reperfusion injury: A systematic review of literature and the role of current drugs and biomarkers‏ ‎‡9 1‏
919 ‎‡a hemorrhoidsandmatrixmetalloproteinasesamulticenterstudyonthepredictiveroleofbiomarkers‏ ‎‡A Hemorrhoids and matrix metalloproteinases: A multicenter study on the predictive role of biomarkers‏ ‎‡9 1‏
919 ‎‡a guidelinesforvenousthromboembolismandclinicalpracticeinitalyanationwidesurvey‏ ‎‡A Guidelines for venous thromboembolism and clinical practice in Italy: a nationwide survey.‏ ‎‡9 1‏
919 ‎‡a genetherapytopreventthrombosisandanastomoticrestenosisaftervascularbypassprocedures‏ ‎‡A Gene Therapy to prevent thrombosis and anastomotic restenosis after vascular bypass procedures‏ ‎‡9 1‏
919 ‎‡a functionalchronicvenousdiseaseasystematicreview‏ ‎‡A Functional chronic venous disease: A systematic review‏ ‎‡9 1‏
919 ‎‡a fromvaricestovenousulcerationthestoryofchronicvenousdiseasedescribedbymetalloproteinases‏ ‎‡A From varices to venous ulceration: the story of chronic venous disease described by metalloproteinases‏ ‎‡9 1‏
919 ‎‡a fondaparinuxvswarfarinforthetreatmentofunsuspectedpulmonaryembolismincancerpatients‏ ‎‡A Fondaparinux vs warfarin for the treatment of unsuspected pulmonary embolism in cancer patients‏ ‎‡9 1‏
919 ‎‡a fatalearlyperipheralpostreperfusionsyndromeandtheroleofcutaneoussigns‏ ‎‡A Fatal early peripheral post-reperfusion syndrome and the role of cutaneous signs‏ ‎‡9 1‏
919 ‎‡a extremedistalbypasstoimprovewoundhealinginbuergersdisease‏ ‎‡A Extreme distal bypass to improve wound healing in Buerger's disease‏ ‎‡9 1‏
919 ‎‡a extracellularmatrixassessmentofinfectedchronicvenouslegulcersroleofmetalloproteinasesandinflammatorycytokines‏ ‎‡A Extracellular matrix assessment of infected chronic venous leg ulcers: role of metalloproteinases and inflammatory cytokines‏ ‎‡9 1‏
919 ‎‡a externaliliacarterytotibialarteriesveingraftforinaccessiblefemoralartery‏ ‎‡A External Iliac Artery to Tibial Arteries Vein Graft for Inaccessible Femoral Artery‏ ‎‡9 1‏
919 ‎‡a estrogenreceptorsandchronicvenousdisease‏ ‎‡A Estrogen Receptors and Chronic Venous Disease‏ ‎‡9 1‏
919 ‎‡a endovasculartreatmentofacarotidpseudoaneurysmusingthenewdoublelayermicromeshstentroadsaver‏ ‎‡A Endovascular Treatment of a Carotid Pseudoaneurysm Using the New Double-Layer Micromesh Stent (Roadsaver®)‏ ‎‡9 1‏
919 ‎‡a endovascularrepairforacutetraumatictransectionofthedescendingthoracicaortaexperienceofasinglecentrewitha12yearsfollowup‏ ‎‡A Endovascular repair for acute traumatic transection of the descending thoracic aorta: experience of a single centre with a 12-years follow up.‏ ‎‡9 1‏
919 ‎‡a endovascularaorticrepaircomplicationsandthepowerofendovascularsolutions‏ ‎‡A Endovascular Aortic Repair Complications and the Power of Endovascular Solutions‏ ‎‡9 1‏
919 ‎‡a endothelin1nitricoxideserotoninandhighbloodpressureinmaleadolescents‏ ‎‡A Endothelin-1, nitric oxide, serotonin and high blood pressure in male adolescents‏ ‎‡9 1‏
919 ‎‡a effectsofsulodexideonstabilityofsclerosingfoams‏ ‎‡A Effects of sulodexide on stability of sclerosing foams‏ ‎‡9 1‏
919 ‎‡a effectsofglucocorticoidsandtumornecrosisfactoralphainhibitorsonbothclinicalandmolecularparametersinpatientswithtakayasuarteritis‏ ‎‡A Effects of glucocorticoids and tumor necrosis factor-alpha inhibitors on both clinical and molecular parameters in patients with Takayasu arteritis.‏ ‎‡9 1‏
919 ‎‡a effectsofanewnutraceuticalsubstanceonclinicalandmolecularparametersinpatientswithchronicvenousulceration‏ ‎‡A Effects of a new nutraceutical substance on clinical and molecular parameters in patients with chronic venous ulceration.‏ ‎‡9 1‏
919 ‎‡a effectivenessofprostaglandine1inpatientswithmixedarterialandvenousulcersofthelowerlimbs‏ ‎‡A Effectiveness of prostaglandin E1 in patients with mixed arterial and venous ulcers of the lower limbs‏ ‎‡9 1‏
919 ‎‡a doxycyclinespeedsuphealingofchronicvenousulcers‏ ‎‡A Doxycycline speeds up healing of chronic venous ulcers.‏ ‎‡9 1‏
919 ‎‡a daysurgeryinguinalherniarepairintheelderlysinglecentreexperience‏ ‎‡A Day-surgery inguinal hernia repair in the elderly: single centre experience‏ ‎‡9 1‏
919 ‎‡a cyanacrylategluecausedextrinsiccompressionofaninfrapoplitealveingraft‏ ‎‡A Cyanacrylate Glue Caused Extrinsic Compression of an Infrapopliteal Vein Graft‏ ‎‡9 1‏
919 ‎‡a covid19andthekidneyfromepidemiologytoclinicalpractice‏ ‎‡A COVID-19 and the Kidney: From Epidemiology to Clinical Practice‏ ‎‡9 1‏
919 ‎‡a contributionofpredictiveandprognosticbiomarkerstoclinicalresearchonchronickidneydisease‏ ‎‡A Contribution of Predictive and Prognostic Biomarkers to Clinical Research on Chronic Kidney Disease‏ ‎‡9 1‏
919 ‎‡a concomitantaorticleiomyosarcomaandtakayasuarteritisina55yearoldmalepatient‏ ‎‡A Concomitant aortic leiomyosarcoma and takayasu arteritis in a 55-year-old male patient.‏ ‎‡9 1‏
919 ‎‡a combinedmedicalsurgicalandendovasculartreatmentofagiantcellarteritiscasemanifestingasupperlimbsacuteischemia‏ ‎‡A Combined medical, surgical and endovascular treatment of a giant cell arteritis case manifesting as upper limbs acute ischemia.‏ ‎‡9 1‏
919 ‎‡a cilostazolpreventsfootulcersindiabeticpatientswithperipheralvasculardisease‏ ‎‡A Cilostazol prevents foot ulcers in diabetic patients with peripheral vascular disease‏ ‎‡9 1‏
919 ‎‡a chronicwoundinfectionstheroleofpseudomonasaeruginosaandstaphylococcusaureus‏ ‎‡A Chronic wound infections: the role of Pseudomonas aeruginosa and Staphylococcus aureus‏ ‎‡9 1‏
919 ‎‡a chronicvenouslegulcersareassociatedwithhighlevelsofmetalloproteinases9andneutrophilgelatinaseassociatedlipocalin‏ ‎‡A Chronic venous leg ulcers are associated with high levels of metalloproteinases-9 and neutrophil gelatinase-associated lipocalin‏ ‎‡9 1‏
919 ‎‡a cerebralstrokeinjurytheroleofcytokinesandbraininflammation‏ ‎‡A Cerebral stroke injury: the role of cytokines and brain inflammation‏ ‎‡9 1‏
919 ‎‡a celltherapyinpatientswithcriticallimbischemia‏ ‎‡A Cell Therapy in Patients with Critical Limb Ischemia‏ ‎‡9 1‏
919 ‎‡a carotidbodyparagangliomasandmatrixmetalloproteinases‏ ‎‡A Carotid body paragangliomas and matrix metalloproteinases‏ ‎‡9 1‏
919 ‎‡a cardiovasculardiseaseasabiomarkerforanincreasedriskofcovid19infectionandrelatedpoorprognosis‏ ‎‡A Cardiovascular disease as a biomarker for an increased risk of COVID-19 infection and related poor prognosis‏ ‎‡9 1‏
919 ‎‡a breastcancerandvenousdiseasearetrospectivecohortstudy‏ ‎‡A Breast cancer and venous disease: a retrospective cohort study.‏ ‎‡9 1‏
919 ‎‡a bodymassindexmetabolicsyndromeandcarotidatherosclerosis‏ ‎‡A Body mass index, metabolic syndrome and carotid atherosclerosis.‏ ‎‡9 1‏
919 ‎‡a biomarkersinpostreperfusionsyndromeafteracutelowerlimbischaemia‏ ‎‡A Biomarkers in post-reperfusion syndrome after acute lower limb ischaemia.‏ ‎‡9 1‏
919 ‎‡a bioentericsintragastricballoonbibversusspatzadjustableballoonsystemabsourexperienceintheelderly‏ ‎‡A BioEnterics Intragastric Balloon (BIB) versus Spatz Adjustable Balloon System (ABS): Our experience in the elderly‏ ‎‡9 1‏
919 ‎‡a bioentericsintragastricballoon‏ ‎‡A BioEnterics Intragastric Balloon‏ ‎‡9 1‏
919 ‎‡a axillaryveinthrombosisasthe1clinicalmanifestationofinflammatorybreastcancerreportofacase‏ ‎‡A Axillary vein thrombosis as the first clinical manifestation of inflammatory breast cancer: report of a case‏ ‎‡9 1‏
919 ‎‡a aterofisiolincarotidplaqueevolution‏ ‎‡A Aterofisiol(®) in carotid plaque evolution‏ ‎‡9 1‏
919 ‎‡a applicationofplateletrichgeltoenhancehealingoftransmetatarsalamputationsindiabeticdysvascularpatients‏ ‎‡A Application of platelet-rich gel to enhance healing of transmetatarsal amputations in diabetic dysvascular patients.‏ ‎‡9 1‏
919 ‎‡a applicationofautologousplateletrichplasmatoenhancewoundhealingafterlowerlimbrevascularizationacaseseriesandliteraturereview‏ ‎‡A Application of autologous platelet-rich plasma to enhance wound healing after lower limb revascularization: A case series and literature review.‏ ‎‡9 1‏
919 ‎‡a aorticbandingandendovascularaneurysmrepairinacaseofjuxtarenalaorticaneurysmwithunsuitableinfrarenalneck‏ ‎‡A Aortic banding and endovascular aneurysm repair in a case of juxtarenal aortic aneurysm with unsuitable infrarenal neck‏ ‎‡9 1‏
919 ‎‡a combinationofthoracicandabdominalstentgraftstotreatanabdominalaorticaneurysmwithhostileproximalneck‏ ‎‡A A Combination of Thoracic and Abdominal Stent-Grafts to Treat An Abdominal Aortic Aneurysm with Hostile Proximal Neck‏ ‎‡9 1‏
919 ‎‡a angiosometargetedrevascularisationindiabeticfootulcers‏ ‎‡A Angiosome-targeted revascularisation in diabetic foot ulcers‏ ‎‡9 1‏
919 ‎‡a geneticstudyofchronicvenousinsufficiency‏ ‎‡A A genetic study of chronic venous insufficiency‏ ‎‡9 1‏
919 ‎‡a absorbablesuturematerialincarotidsurgery‏ ‎‡A Absorbable suture material in carotid surgery.‏ ‎‡9 1‏
919 ‎‡a adjuvantspinalcordstimulationimproveswoundhealingofperipheraltissuelossduetostealsyndromeofthehandclinicalchallengetreatingadifficultcase‏ ‎‡A Adjuvant spinal cord stimulation improves wound healing of peripheral tissue loss due to steal syndrome of the hand: clinical challenge treating a difficult case.‏ ‎‡9 1‏
919 ‎‡a uncommoncaseoftype3endoleaktreatedwithacustommadethoracicstentgraft‏ ‎‡A An Uncommon Case of Type III Endoleak Treated with a Custom-made Thoracic Stent Graft‏ ‎‡9 1‏
919 ‎‡a adultvascularwallresidentmultipotentvascularstemcellsmatrixmetalloproteinasesandarterialaneurysms‏ ‎‡A Adult vascular wall resident multipotent vascular stem cells, matrix metalloproteinases, and arterial aneurysms‏ ‎‡9 1‏
919 ‎‡a aircontaminationinthesclerosingfoamforthetreatmentofvaricoseveins‏ ‎‡A Air contamination in the sclerosing foam for the treatment of varicose veins‏ ‎‡9 1‏
919 ‎‡a albuminadministrationpreventstheonsetofpressureulcersinintensivecareunitpatients‏ ‎‡A Albumin administration prevents the onset of pressure ulcers in intensive care unit patients‏ ‎‡9 1‏
919 ‎‡a uncommoncaseofarterialaneurysmsassociationwithhighplasmalevelsofmatrixmetalloproteinase9andneutrophilgelatinaseassociatedlipocalin‏ ‎‡A An uncommon case of arterial aneurysms association with high plasma levels of Matrix Metalloproteinase-9 and Neutrophil Gelatinase-Associated Lipocalin.‏ ‎‡9 1‏
919 ‎‡a hybrid2stagetechniquetotreataposttraumaticinternalcarotidjugularfistula‏ ‎‡A An Hybrid 2-Stage Technique to Treat a Post-Traumatic Internal Carotid-Jugular Fistula.‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2017‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 J9U|987007350561005171‏
996 ‎‡2 BNF|17115354‏
996 ‎‡2 ISNI|0000000108793947‏
996 ‎‡2 BNE|XX872395‏
996 ‎‡2 J9U|987007369646405171‏
996 ‎‡2 BNCHL|10000000000000000263895‏
996 ‎‡2 BNE|XX1480576‏
996 ‎‡2 LC|no2023111519‏
996 ‎‡2 BNE|XX1006257‏
996 ‎‡2 BNC|981058610557406706‏
996 ‎‡2 SUDOC|277168082‏
996 ‎‡2 BNE|XX1141987‏
996 ‎‡2 LC|n 96012164‏
996 ‎‡2 ISNI|0000000083537866‏
996 ‎‡2 BNC|981058610556106706‏
996 ‎‡2 BNE|XX873078‏
996 ‎‡2 BNCHL|10000000000000000083187‏
996 ‎‡2 DNB|1232986348‏
996 ‎‡2 SUDOC|270348859‏
996 ‎‡2 DNB|1057079359‏
996 ‎‡2 RERO|A018940465‏
996 ‎‡2 LC|n 2001028703‏
996 ‎‡2 ISNI|0000000061471050‏
996 ‎‡2 BNE|XX990769‏
996 ‎‡2 BNE|XX4859592‏
996 ‎‡2 LC|nb2022001877‏
996 ‎‡2 LC|n 2016019884‏
996 ‎‡2 ISNI|0000000119598258‏
996 ‎‡2 NII|DA01978376‏
996 ‎‡2 BNE|XX1119233‏
996 ‎‡2 SUDOC|158809580‏
996 ‎‡2 LC|n 79029404‏
996 ‎‡2 ISNI|0000000034395064‏
996 ‎‡2 SUDOC|092185738‏
996 ‎‡2 BNE|XX1469719‏
996 ‎‡2 CAOONL|ncf11269912‏
996 ‎‡2 LC|n 80119413‏
996 ‎‡2 J9U|987007277049805171‏
996 ‎‡2 SUDOC|140635807‏
996 ‎‡2 SUDOC|142682411‏
996 ‎‡2 ISNI|0000000118380986‏
996 ‎‡2 BNC|981058514858006706‏
996 ‎‡2 SUDOC|270348808‏
996 ‎‡2 BNE|XX1240433‏
996 ‎‡2 BAV|495_263868‏
996 ‎‡2 SUDOC|255359101‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏
998 ‎‡a Serra, Raffaele‏ ‎‡2 SZ|1232986348‏ ‎‡3 exact title: (1.00, 'matrixmetalloproteinasesinhealthanddisease', 'matrixmetalloproteinasesinhealthanddisease')‏