Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q42145712 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241020233137.0 | ||
| 008 | 241020nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q42145712 | ||
| 024 | ‡a 0000-0002-0145-5571 ‡2 orcid | ||
| 024 | ‡a 10140494200 ‡2 scopus | ||
| 035 | ‡a (OCoLC)Q42145712 | ||
| 100 | 0 | ‡a Francisco A. Rodrigues ‡9 ast ‡9 es ‡9 sl | |
| 375 | ‡a 1 ‡2 iso5218 | ||
| 400 | 0 | ‡a Francisco A. Rodrigues ‡c researcher ‡9 en | |
| 400 | 0 | ‡a Francisco A. Rodrigues ‡c onderzoeker ‡9 nl | |
| 670 | ‡a Author's A generalized approach to the modeling of the species-area relationship | ||
| 670 | ‡a Author's A process of rumour scotching on finite populations | ||
| 670 | ‡a Author's A structure-dynamic approach to cortical organization: number of paths and accessibility | ||
| 670 | ‡a Author's A systematic comparison of supervised classifiers. | ||
| 670 | ‡a Author's Analysis of cluster explosive synchronization in complex networks. | ||
| 670 | ‡a Author's Analyzing trails in complex networks | ||
| 670 | ‡a Author's Automatic network fingerprinting through single-node motifs | ||
| 670 | ‡a Author's Centrality in earthquake multiplex networks | ||
| 670 | ‡a Author's Chain motifs: the tails and handles of complex networks | ||
| 670 | ‡a Author's Cluster explosive synchronization in complex networks | ||
| 670 | ‡a Author's Clustering algorithms: A comparative approach | ||
| 670 | ‡a Author's Collective dynamics in two populations of noisy oscillators with asymmetric interactions. | ||
| 670 | ‡a Author's Comparison of the interactomic networks of different species in terms of accessibility. | ||
| 670 | ‡a Author's Complex systems in the spotlight: next steps after the 2021 Nobel Prize in Physics | ||
| 670 | ‡a Author's Determination of the critical coupling of explosive synchronization transitions in scale-free networks by mean-field approximations. | ||
| 670 | ‡a Author's EEG functional connectivity and deep learning for automatic diagnosis of brain disorders: Alzheimer’s disease and schizophrenia | ||
| 670 | ‡a Author's Effects of assortative mixing in the second-order Kuramoto model. | ||
| 670 | ‡a Author's Entropy of weighted recurrence plots. | ||
| 670 | ‡a Author's Epidemic spreading with awareness and different timescales in multiplex networks | ||
| 670 | ‡a Author's Estimating complex cortical networks via surface recordings- a critical note. | ||
| 670 | ‡a Author's Exploration of the antiplatelet activity profile of betulinic acid on human platelets | ||
| 670 | ‡a Author's Explosive synchronization enhanced by time-delayed coupling | ||
| 670 | ‡a Author's Generalized connectivity between any two nodes in a complex network | ||
| 670 | ‡a Author's Influence of network topology on cooperative problem-solving systems | ||
| 670 | ‡a Author's Insights into the assembly rules of a continent-wide multilayer network | ||
| 670 | ‡a Author's Keystone species in seed dispersal networks are mainly determined by dietary specialization | ||
| 670 | ‡a Author's Multifractality in random networks with power-law decaying bond strengths | ||
| 670 | ‡a Author's Power laws in the Roman Empire: a survival analysis | ||
| 670 | ‡a Author's Protein lethality investigated in terms of long range dynamical interactions | ||
| 670 | ‡a Author's Rumor propagation with heterogeneous transmission in social networks | ||
| 670 | ‡a Author's Structure and dynamics of functional networks in child-onset schizophrenia. | ||
| 670 | ‡a Author's The impact of information spreading on disease dynamics: Comment on "Coupled disease-behavior on complex networks: A review" by Z. Wang et al. | ||
| 670 | ‡a Author's The Impact of Social Curiosity on Information Spreading on Networks | ||
| 670 | ‡a Author's The nested structural organization of the worldwide trade multi-layer network | ||
| 670 | ‡a Author's The role of community structure on the nature of explosive synchronization. | ||
| 670 | ‡a Author's Thermodynamic characterization of networks using graph polynomials. | ||
| 670 | ‡a Author's Traveling phase waves in asymmetric networks of noisy chaotic attractors. | ||
| 670 | ‡a Author's Tweaking synchronization by connectivity modifications. | ||
| 670 | ‡a Author's Universality in the spectral and eigenfunction properties of random networks | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/viaf/32154865867959940257 | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/processed/SUDOC|241347041 | ||
| 909 | ‡a (orcid) 0000000201455571 ‡9 1 | ||
| 909 | ‡a (scopus) 10140494200 ‡9 1 | ||
| 919 | ‡a universalityinthespectralandeigenfunctionpropertiesofrandomnetworks ‡A Universality in the spectral and eigenfunction properties of random networks ‡9 1 | ||
| 919 | ‡a tweakingsynchronizationbyconnectivitymodifications ‡A Tweaking synchronization by connectivity modifications. ‡9 1 | ||
| 919 | ‡a travelingphasewavesinasymmetricnetworksofnoisychaoticattractors ‡A Traveling phase waves in asymmetric networks of noisy chaotic attractors. ‡9 1 | ||
| 919 | ‡a thermodynamiccharacterizationofnetworksusinggraphpolynomials ‡A Thermodynamic characterization of networks using graph polynomials. ‡9 1 | ||
| 919 | ‡a roleofcommunitystructureonthenatureofexplosivesynchronization ‡A The role of community structure on the nature of explosive synchronization. ‡9 1 | ||
| 919 | ‡a nestedstructuralorganizationoftheworldwidetrademultilayernetwork ‡A The nested structural organization of the worldwide trade multi-layer network ‡9 1 | ||
| 919 | ‡a impactofsocialcuriosityoninformationspreadingonnetworks ‡A The Impact of Social Curiosity on Information Spreading on Networks ‡9 1 | ||
| 919 | ‡a impactofinformationspreadingondiseasedynamicscommentoncoupleddiseasebehavioroncomplexnetworksareviewbyzwangetal ‡A The impact of information spreading on disease dynamics: Comment on "Coupled disease-behavior on complex networks: A review" by Z. Wang et al. ‡9 1 | ||
| 919 | ‡a structureanddynamicsoffunctionalnetworksinchildonsetschizophrenia ‡A Structure and dynamics of functional networks in child-onset schizophrenia. ‡9 1 | ||
| 919 | ‡a rumorpropagationwithheterogeneoustransmissioninsocialnetworks ‡A Rumor propagation with heterogeneous transmission in social networks ‡9 1 | ||
| 919 | ‡a proteinlethalityinvestigatedintermsoflongrangedynamicalinteractions ‡A Protein lethality investigated in terms of long range dynamical interactions ‡9 1 | ||
| 919 | ‡a powerlawsintheromanempireasurvivalanalysis ‡A Power laws in the Roman Empire: a survival analysis ‡9 1 | ||
| 919 | ‡a multifractalityinrandomnetworkswithpowerlawdecayingbondstrengths ‡A Multifractality in random networks with power-law decaying bond strengths ‡9 1 | ||
| 919 | ‡a keystonespeciesinseeddispersalnetworksaremainlydeterminedbydietaryspecialization ‡A Keystone species in seed dispersal networks are mainly determined by dietary specialization ‡9 1 | ||
| 919 | ‡a insightsintotheassemblyrulesofacontinentwidemultilayernetwork ‡A Insights into the assembly rules of a continent-wide multilayer network ‡9 1 | ||
| 919 | ‡a influenceofnetworktopologyoncooperativeproblemsolvingsystems ‡A Influence of network topology on cooperative problem-solving systems ‡9 1 | ||
| 919 | ‡a generalizedconnectivitybetweenany2nodesinacomplexnetwork ‡A Generalized connectivity between any two nodes in a complex network ‡9 1 | ||
| 919 | ‡a explosivesynchronizationenhancedbytimedelayedcoupling ‡A Explosive synchronization enhanced by time-delayed coupling ‡9 1 | ||
| 919 | ‡a explorationoftheantiplateletactivityprofileofbetulinicacidonhumanplatelets ‡A Exploration of the antiplatelet activity profile of betulinic acid on human platelets ‡9 1 | ||
| 919 | ‡a estimatingcomplexcorticalnetworksviasurfacerecordingsacriticalnote ‡A Estimating complex cortical networks via surface recordings- a critical note. ‡9 1 | ||
| 919 | ‡a epidemicspreadingwithawarenessanddifferenttimescalesinmultiplexnetworks ‡A Epidemic spreading with awareness and different timescales in multiplex networks ‡9 1 | ||
| 919 | ‡a entropyofweightedrecurrenceplots ‡A Entropy of weighted recurrence plots. ‡9 1 | ||
| 919 | ‡a effectsofassortativemixinginthe2orderkuramotomodel ‡A Effects of assortative mixing in the second-order Kuramoto model. ‡9 1 | ||
| 919 | ‡a eegfunctionalconnectivityanddeeplearningforautomaticdiagnosisofbraindisordersalzheimersdiseaseandschizophrenia ‡A EEG functional connectivity and deep learning for automatic diagnosis of brain disorders: Alzheimer’s disease and schizophrenia ‡9 1 | ||
| 919 | ‡a determinationofthecriticalcouplingofexplosivesynchronizationtransitionsinscalefreenetworksbymeanfieldapproximations ‡A Determination of the critical coupling of explosive synchronization transitions in scale-free networks by mean-field approximations. ‡9 1 | ||
| 919 | ‡a complexsystemsinthespotlightnextstepsafterthe2021nobelprizeinphysics ‡A Complex systems in the spotlight: next steps after the 2021 Nobel Prize in Physics ‡9 1 | ||
| 919 | ‡a comparisonoftheinteractomicnetworksofdifferentspeciesintermsofaccessibility ‡A Comparison of the interactomic networks of different species in terms of accessibility. ‡9 1 | ||
| 919 | ‡a collectivedynamicsin2populationsofnoisyoscillatorswithasymmetricinteractions ‡A Collective dynamics in two populations of noisy oscillators with asymmetric interactions. ‡9 1 | ||
| 919 | ‡a clusteringalgorithmsacomparativeapproach ‡A Clustering algorithms: A comparative approach ‡9 1 | ||
| 919 | ‡a clusterexplosivesynchronizationincomplexnetworks ‡A Cluster explosive synchronization in complex networks ‡9 1 | ||
| 919 | ‡a chainmotifsthetailsandhandlesofcomplexnetworks ‡A Chain motifs: the tails and handles of complex networks ‡9 1 | ||
| 919 | ‡a centralityinearthquakemultiplexnetworks ‡A Centrality in earthquake multiplex networks ‡9 1 | ||
| 919 | ‡a automaticnetworkfingerprintingthroughsinglenodemotifs ‡A Automatic network fingerprinting through single-node motifs ‡9 1 | ||
| 919 | ‡a analyzingtrailsincomplexnetworks ‡A Analyzing trails in complex networks ‡9 1 | ||
| 919 | ‡a analysisofclusterexplosivesynchronizationincomplexnetworks ‡A Analysis of cluster explosive synchronization in complex networks. ‡9 1 | ||
| 919 | ‡a systematiccomparisonofsupervisedclassifiers ‡A A systematic comparison of supervised classifiers. ‡9 1 | ||
| 919 | ‡a structuredynamicapproachtocorticalorganizationnumberofpathsandaccessibility ‡A A structure-dynamic approach to cortical organization: number of paths and accessibility ‡9 1 | ||
| 919 | ‡a processofrumourscotchingonfinitepopulations ‡A A process of rumour scotching on finite populations ‡9 1 | ||
| 919 | ‡a generalizedapproachtothemodelingofthespeciesarearelationship ‡A A generalized approach to the modeling of the species-area relationship ‡9 1 | ||
| 946 | ‡a b ‡9 1 | ||
| 996 | ‡2 ISNI|0000000066816708 | ||
| 996 | ‡2 LC|n 88012151 | ||
| 996 | ‡2 ISNI|0000000069892466 | ||
| 996 | ‡2 PTBNP|75437 | ||
| 996 | ‡2 BLBNB|000430159 | ||
| 996 | ‡2 PTBNP|1533476 | ||
| 996 | ‡2 NTA|073150649 | ||
| 996 | ‡2 PTBNP|1191352 | ||
| 996 | ‡2 ISNI|0000000069423037 | ||
| 996 | ‡2 BLBNB|001506280 | ||
| 996 | ‡2 BLBNB|001468901 | ||
| 996 | ‡2 LC|n 83205971 | ||
| 996 | ‡2 SUDOC|244888248 | ||
| 996 | ‡2 NSK|000642612 | ||
| 996 | ‡2 NKC|uk20231197591 | ||
| 996 | ‡2 BNCHL|10000000000000000126541 | ||
| 996 | ‡2 ISNI|0000000075128667 | ||
| 996 | ‡2 SUDOC|135305500 | ||
| 996 | ‡2 SUDOC|15862386X | ||
| 996 | ‡2 PTBNP|1665421 | ||
| 996 | ‡2 BLBNB|001310057 | ||
| 996 | ‡2 PTBNP|1707173 | ||
| 996 | ‡2 BAV|495_275444 | ||
| 996 | ‡2 BLBNB|000387258 | ||
| 996 | ‡2 LC|nr2006004901 | ||
| 996 | ‡2 PTBNP|1466228 | ||
| 996 | ‡2 SUDOC|183112695 | ||
| 996 | ‡2 PTBNP|1860087 | ||
| 996 | ‡2 LC|no2020038433 | ||
| 996 | ‡2 LC|n 2015237444 | ||
| 996 | ‡2 BLBNB|000335630 | ||
| 996 | ‡2 PTBNP|1451125 | ||
| 996 | ‡2 LC|no2024019294 | ||
| 996 | ‡2 ISNI|0000000068910001 | ||
| 996 | ‡2 PTBNP|148087 | ||
| 996 | ‡2 ISNI|0000000054098809 | ||
| 996 | ‡2 ISNI|000000006858287X | ||
| 996 | ‡2 ISNI|000000006992937X | ||
| 996 | ‡2 PTBNP|1520552 | ||
| 996 | ‡2 PTBNP|1781828 | ||
| 996 | ‡2 LC|nr 93029595 | ||
| 996 | ‡2 PTBNP|1154125 | ||
| 996 | ‡2 DNB|1053571658 | ||
| 996 | ‡2 ISNI|0000000070605145 | ||
| 996 | ‡2 NUKAT|n 2004259052 | ||
| 996 | ‡2 ISNI|0000000045651035 | ||
| 996 | ‡2 PTBNP|121457 | ||
| 996 | ‡2 LC|no2005028515 | ||
| 996 | ‡2 BLBNB|001554408 | ||
| 996 | ‡2 CAOONL|ncf11610854 | ||
| 996 | ‡2 DNB|1157621708 | ||
| 996 | ‡2 J9U|987007383045605171 | ||
| 996 | ‡2 PTBNP|1194151 | ||
| 996 | ‡2 SUDOC|241347041 | ||
| 996 | ‡2 BLBNB|000228962 | ||
| 996 | ‡2 BAV|495_92149 | ||
| 996 | ‡2 BLBNB|001529066 | ||
| 996 | ‡2 LC|no2004011001 | ||
| 996 | ‡2 LC|no2016083121 | ||
| 996 | ‡2 J9U|987007404235605171 | ||
| 996 | ‡2 PTBNP|1619311 | ||
| 996 | ‡2 PTBNP|717091 | ||
| 996 | ‡2 DNB|1056568003 | ||
| 996 | ‡2 LC|n 89671795 | ||
| 996 | ‡2 SUDOC|242252257 | ||
| 996 | ‡2 NLA|000035230975 | ||
| 996 | ‡2 DNB|1049718909 | ||
| 996 | ‡2 ISNI|0000000066421650 | ||
| 996 | ‡2 BLBNB|000464960 | ||
| 996 | ‡2 RERO|A000138537 | ||
| 996 | ‡2 LC|no2003046345 | ||
| 996 | ‡2 PTBNP|206692 | ||
| 996 | ‡2 ISNI|0000000070395862 | ||
| 996 | ‡2 ISNI|0000000078531961 | ||
| 996 | ‡2 DNB|171893751 | ||
| 996 | ‡2 ISNI|0000000078261009 | ||
| 996 | ‡2 PTBNP|1491098 | ||
| 996 | ‡2 PTBNP|1153762 | ||
| 996 | ‡2 SUDOC|236473387 | ||
| 996 | ‡2 PTBNP|1814274 | ||
| 996 | ‡2 ISNI|0000000079986247 | ||
| 996 | ‡2 LC|n 85372230 | ||
| 996 | ‡2 LC|n 2017251225 | ||
| 996 | ‡2 CAOONL|ncf11262308 | ||
| 996 | ‡2 LC|n 84012722 | ||
| 996 | ‡2 LC|no 99011222 | ||
| 996 | ‡2 ISNI|0000000026263264 | ||
| 996 | ‡2 DNB|1157227171 | ||
| 996 | ‡2 BNE|XX1143334 | ||
| 996 | ‡2 ISNI|0000000069290326 | ||
| 996 | ‡2 BNF|16205731 | ||
| 996 | ‡2 ISNI|0000000067123823 | ||
| 996 | ‡2 LC|no2010009029 | ||
| 996 | ‡2 PTBNP|1920664 | ||
| 996 | ‡2 RERO|A009081850 | ||
| 996 | ‡2 DNB|105634136X | ||
| 996 | ‡2 PTBNP|1276040 | ||
| 996 | ‡2 LC|no2011186902 | ||
| 996 | ‡2 LC|n 84037021 | ||
| 996 | ‡2 ISNI|0000000035692837 | ||
| 996 | ‡2 RERO|A018476749 | ||
| 996 | ‡2 PTBNP|1871296 | ||
| 996 | ‡2 LC|n 79036422 | ||
| 996 | ‡2 ISNI|0000000069211464 | ||
| 996 | ‡2 PTBNP|1430387 | ||
| 996 | ‡2 BLBNB|001564106 | ||
| 996 | ‡2 BLBNB|001583528 | ||
| 996 | ‡2 ISNI|0000000069600195 | ||
| 996 | ‡2 ISNI|0000000024959305 | ||
| 996 | ‡2 ISNI|0000000070497738 | ||
| 996 | ‡2 NUKAT|n 2011144017 | ||
| 996 | ‡2 LC|n 87101894 | ||
| 996 | ‡2 DNB|141413867 | ||
| 996 | ‡2 ISNI|0000000070602219 | ||
| 996 | ‡2 BLBNB|000597133 | ||
| 996 | ‡2 ISNI|0000000068713243 | ||
| 996 | ‡2 BAV|495_248674 | ||
| 996 | ‡2 DNB|1205400826 | ||
| 996 | ‡2 BNE|XX6507772 | ||
| 996 | ‡2 BLBNB|000335629 | ||
| 996 | ‡2 BLBNB|001409791 | ||
| 996 | ‡2 BLBNB|000444464 | ||
| 996 | ‡2 DNB|140628835 | ||
| 996 | ‡2 PTBNP|1747435 | ||
| 996 | ‡2 PTBNP|233502 | ||
| 996 | ‡2 DNB|1047928760 | ||
| 996 | ‡2 PTBNP|1345258 | ||
| 996 | ‡2 SUDOC|091509092 | ||
| 996 | ‡2 CAOONL|ncf11853809 | ||
| 996 | ‡2 ISNI|000000007061157X | ||
| 996 | ‡2 NTA|364173211 | ||
| 996 | ‡2 BNE|XX1092429 | ||
| 996 | ‡2 BLBNB|000204250 | ||
| 996 | ‡2 BLBNB|000532843 | ||
| 996 | ‡2 SUDOC|140425829 | ||
| 996 | ‡2 PTBNP|1804006 | ||
| 996 | ‡2 ISNI|0000000070104156 | ||
| 996 | ‡2 PTBNP|109781 | ||
| 996 | ‡2 ISNI|0000000120227358 | ||
| 996 | ‡2 ISNI|0000000076795883 | ||
| 996 | ‡2 PTBNP|1615360 | ||
| 996 | ‡2 ISNI|0000000116779950 | ||
| 996 | ‡2 DNB|1057388084 | ||
| 996 | ‡2 LC|n 95920528 | ||
| 996 | ‡2 SUDOC|180668021 | ||
| 996 | ‡2 BLBNB|000566178 | ||
| 996 | ‡2 DNB|1057535583 | ||
| 996 | ‡2 SUDOC|197780636 | ||
| 996 | ‡2 BLBNB|000174405 | ||
| 996 | ‡2 NTA|072419490 | ||
| 996 | ‡2 ISNI|0000000024747097 | ||
| 996 | ‡2 BLBNB|001524763 | ||
| 996 | ‡2 BLBNB|000335634 | ||
| 996 | ‡2 PTBNP|109776 | ||
| 996 | ‡2 BLBNB|000335636 | ||
| 996 | ‡2 BLBNB|000335637 | ||
| 996 | ‡2 DNB|1056883936 | ||
| 996 | ‡2 BLBNB|000335631 | ||
| 996 | ‡2 SUDOC|033279780 | ||
| 996 | ‡2 BNF|14853908 | ||
| 996 | ‡2 BNF|16994717 | ||
| 996 | ‡2 LC|n 95921798 | ||
| 996 | ‡2 RERO|A023684433 | ||
| 996 | ‡2 ISNI|0000000070433507 | ||
| 996 | ‡2 BLBNB|001480000 | ||
| 996 | ‡2 PTBNP|1427756 | ||
| 996 | ‡2 PTBNP|71610 | ||
| 996 | ‡2 ISNI|0000000054246779 | ||
| 996 | ‡2 BLBNB|000522960 | ||
| 996 | ‡2 ISNI|0000000068986145 | ||
| 996 | ‡2 LC|no2020115819 | ||
| 996 | ‡2 PTBNP|1476850 | ||
| 996 | ‡2 LC|n 84026391 | ||
| 996 | ‡2 PTBNP|1921470 | ||
| 996 | ‡2 PTBNP|228069 | ||
| 996 | ‡2 DNB|1089149549 | ||
| 996 | ‡2 DNB|1147406650 | ||
| 996 | ‡2 BLBNB|000445038 | ||
| 996 | ‡2 LC|n 2015235633 | ||
| 996 | ‡2 ISNI|0000000122701244 | ||
| 996 | ‡2 LC|n 88676213 | ||
| 996 | ‡2 LC|n 89197280 | ||
| 996 | ‡2 BNF|13608150 | ||
| 996 | ‡2 DNB|1056568178 | ||
| 996 | ‡2 BLBNB|001420101 | ||
| 996 | ‡2 PTBNP|839064 | ||
| 996 | ‡2 DNB|1057551457 | ||
| 996 | ‡2 DNB|1314338552 | ||
| 996 | ‡2 PTBNP|1600297 | ||
| 996 | ‡2 ISNI|0000000122639313 | ||
| 996 | ‡2 BNF|12019333 | ||
| 996 | ‡2 PTBNP|1831678 | ||
| 996 | ‡2 RERO|A024590224 | ||
| 996 | ‡2 PTBNP|81894 | ||
| 996 | ‡2 LC|n 2010003144 | ||
| 996 | ‡2 DNB|1012464326 | ||
| 996 | ‡2 LC|n 2018251201 | ||
| 996 | ‡2 ISNI|0000000026793353 | ||
| 996 | ‡2 BLBNB|000567503 | ||
| 996 | ‡2 BNF|10677267 | ||
| 996 | ‡2 BLBNB|001474518 | ||
| 996 | ‡2 SUDOC|119330237 | ||
| 996 | ‡2 ISNI|0000000067889925 | ||
| 996 | ‡2 ISNI|0000000454749244 | ||
| 996 | ‡2 PTBNP|119265 | ||
| 996 | ‡2 PTBNP|31914 | ||
| 996 | ‡2 BLBNB|000462937 | ||
| 996 | ‡2 DNB|1157221645 | ||
| 996 | ‡2 NKC|jo20221160215 | ||
| 996 | ‡2 ISNI|0000000070421792 | ||
| 996 | ‡2 PTBNP|1043581 | ||
| 996 | ‡2 PTBNP|955022 | ||
| 996 | ‡2 SUDOC|07032820X | ||
| 996 | ‡2 BLBNB|000251033 | ||
| 996 | ‡2 PTBNP|1313077 | ||
| 996 | ‡2 BLBNB|000614114 | ||
| 996 | ‡2 PTBNP|1865046 | ||
| 996 | ‡2 LC|no2011108492 | ||
| 996 | ‡2 BLBNB|000624883 | ||
| 996 | ‡2 BLBNB|001499825 | ||
| 996 | ‡2 LC|nr2001046315 | ||
| 996 | ‡2 LC|n 86804780 | ||
| 996 | ‡2 PTBNP|795716 | ||
| 996 | ‡2 ISNI|0000000054791507 | ||
| 996 | ‡2 LC|n 82015034 | ||
| 996 | ‡2 ICCU|CUBV106049 | ||
| 996 | ‡2 BLBNB|000351074 | ||
| 996 | ‡2 PTBNP|1411460 | ||
| 996 | ‡2 PTBNP|1282197 | ||
| 996 | ‡2 CAOONL|ncf11512053 | ||
| 996 | ‡2 BLBNB|001455656 | ||
| 996 | ‡2 ISNI|0000000118480303 | ||
| 996 | ‡2 PTBNP|173244 | ||
| 996 | ‡2 DNB|1027436080 | ||
| 996 | ‡2 LC|no 99047027 | ||
| 996 | ‡2 J9U|987007443060505171 | ||
| 996 | ‡2 DNB|1141910411 | ||
| 996 | ‡2 PTBNP|1670722 | ||
| 996 | ‡2 BNCHL|10000000000000000168145 | ||
| 996 | ‡2 BLBNB|001640844 | ||
| 996 | ‡2 BLBNB|000467425 | ||
| 996 | ‡2 PTBNP|316796 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 | ||
| 998 | ‡a Rodrigues, Francisco Aparecido ‡2 J9U|987007404235605171 ‡3 suggested | ||
| 998 | ‡a Rodrigues, Francisco Aparecido ‡2 SUDOC|241347041 ‡3 suggested | ||
| 998 | ‡a Rodrigues, Francisco Aparecido ‡2 DNB|1312970944 ‡3 standard number | ||
| 998 | ‡a Rodrigues, Francisco Aparecido ‡2 LC|no2018136803 ‡3 title: (0.74, 'multiplexnetworks', 'centralityinearthquakemultiplexnetworks') |
