VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q42361484 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235931.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q42361484‏
024 ‎‡a 0000-0002-0291-5760‏ ‎‡2 orcid‏
024 ‎‡a 0000-0001-6398-0921‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q42361484‏
043 ‎‡c GB‏
046 ‎‡f 19550608‏
100 0 ‎‡a Robert West‏ ‎‡c Professor of Health Psychology and Director of Tobacco Studies at UCL‏ ‎‡9 en‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Роберт Уэст‏ ‎‡9 ru‏
400 0 ‎‡a Robert West‏ ‎‡c professeur de psychologie de la santé, En poste au Health behaviour research centre, University college London (en 2016)‏ ‎‡9 fr‏
400 0 ‎‡a Robert West‏ ‎‡c Brits opvoeder‏ ‎‡9 nl‏
400 0 ‎‡a Robert Jeremy West‏ ‎‡9 lv‏ ‎‡9 de‏ ‎‡9 it‏ ‎‡9 es‏
400 0 ‎‡a روبرت ويست‏ ‎‡9 ar‏
400 0 ‎‡a রবার্ট ওয়েস্ট‏ ‎‡9 bn‏
670 ‎‡a Author's A comparison of exposure to carcinogens among roll-your-own and factory-made cigarette smokers‏
670 ‎‡a Author's A comparison of the abuse liability and dependence potential of nicotine patch, gum, spray and inhaler.‏
670 ‎‡a Author's A double-blind placebo-controlled experimental study of nicotine: II--Effects on response inhibition and executive functioning.‏
670 ‎‡a Author's A mobile app to aid smoking cessation: preliminary evaluation of SmokeFree28.‏
670 ‎‡a Author's A randomised placebo-controlled trial of oral hydrocortisone for treating tobacco withdrawal symptoms‏
670 ‎‡a Author's A randomised trial of glucose tablets to aid smoking cessation.‏
670 ‎‡a Author's A randomized, controlled trial of adding expired carbon monoxide feedback to brief stop smoking advice: Evaluation of cognitive and behavioral effects‏
670 ‎‡a Author's A renewed call for action on alcohol policy‏
670 ‎‡a Author's A revised checklist for writing up research reports‏
670 ‎‡a Author's A smartphone app to reduce excessive alcohol consumption: Identifying the effectiveness of intervention components in a factorial randomised control trial.‏
670 ‎‡a Author's A survey of pregnant smokers' interest in different types of smoking cessation support‏
670 ‎‡a Author's Access to data from clinical trials sponsored by pharmaceutical companies.‏
670 ‎‡a Author's Acute effect of a brief bout of exercise on alcohol urges.‏
670 ‎‡a Author's Acute reduction in secretory immunoglobulin A following smoking cessation‏
670 ‎‡a Author's Addiction in China: Towards a research agenda for the next 5 years‏
670 ‎‡a Author's Addiction Theories and Constructs: a new series‏
670 ‎‡a Author's Addiction's priorities when evaluating submissions‏
670 ‎‡a Author's Adolescents' awareness of, and involvement with, illicit tobacco in the UK‏
670 ‎‡a Author's Alcoholics' beliefs about responsibility for, and recovery from, their condition‏
670 ‎‡a Author's An evaluation of the intervention against smoking in the multiple risk factor intervention trial‏
670 ‎‡a Author's An online Paper Authoring Tool (PAT) to improve reporting of, and synthesis of evidence from, trials in behavioral sciences‏
670 ‎‡a Author's Applying principles of behaviour change to reduce SARS-CoV-2 transmission‏
670 ‎‡a Author's Assessing and addressing collider bias in addiction research: the curious case of smoking and COVID-19‏
670 ‎‡a Author's Assessing drug-related harm‏
670 ‎‡a Author's Assessing smoking status in children, adolescents and adults: cotinine cut-points revisited.‏
670 ‎‡a Author's Assessing the Psychometric Properties of the Digital Behavior Change Intervention Engagement Scale in Users of an App for Reducing Alcohol Consumption: Evaluation Study‏
670 ‎‡a Author's Assessment of dependence and motivation to stop smoking‏
670 ‎‡a Author's Association of prevalence of electronic cigarette use with smoking cessation and cigarette consumption in England: a time-series analysis between 2006 and 2017‏
670 ‎‡a Author's Authors' reply to letter.‏
670 ‎‡a Author's Awareness of mouth cancer in Great Britain‏
670 ‎‡a Author's Behavior change techniques in popular alcohol reduction apps: content analysis‏
670 ‎‡a Author's Behavior change techniques used in group-based behavioral support by the English stop-smoking services and preliminary assessment of association with short-term quit outcomes‏
670 ‎‡a Author's Behavioral correlates of individual differences in road-traffic crash risk: an examination method and findings.‏
670 ‎‡a Author's Behaviour Change Techniques Associated with Smoking Cessation in Intervention and Comparator Groups of Randomised Controlled Trials: A Systematic Review and Meta-Regression‏
670 ‎‡a Author's Behavioural characteristics and involvement in different types of traffic accident‏
670 ‎‡a Author's Behavioural support programmes for smoking cessation: needs and opportunities‏
670 ‎‡a Author's Beliefs about the harms of long-term use of nicotine replacement therapy: perceptions of smokers in England.‏
670 ‎‡a Author's Beliefs of stop smoking practitioners in United Kingdom on the use of nicotine replacement therapy for smoking reduction.‏
670 ‎‡a Author's Beneficial effects of nicotine: fact or fiction?‏
670 ‎‡a Author's Can the Dutch Government really be abandoning smokers to their fate?‏
670 ‎‡a Author's Can we trust national smoking prevalence figures? Discrepancies between biochemically assessed and self-reported smoking rates in three countries‏
670 ‎‡a Author's Cardiovascular and subjective effects of smoking before and after 24 h of abstinence from cigarettes‏
670 ‎‡a Author's Cardiovascular Risk Factors in Patients with Schizophrenia Receiving Continuous Medical Care‏
670 ‎‡a Author's Changes in smoker characteristics in England between 2008 and 2017‏
670 ‎‡a Author's Changes in smoking prevalence in 16-17-year-old versus older adults following a rise in legal age of sale: findings from an English population study.‏
670 ‎‡a Author's Cigarette smoking and psychophysiological stress responsiveness: effects of recent smoking and temporary abstinence‏
670 ‎‡a Author's Clinical trial comparing nicotine replacement therapy (NRT) plus brief counselling, brief counselling alone, and minimal intervention on smoking cessation in hospital inpatients.‏
670 ‎‡a Author's Cognitive and psychological correlates of smoking abstinence, and predictors of successful cessation.‏
670 ‎‡a Author's Complex systems and individual-level approaches to population health: a false dichotomy?‏
670 ‎‡a Author's Compulsory detention, forced detoxification and enforced labour are not ethically acceptable or effective ways to treat addiction‏
670 ‎‡a Author's COVID-19, smoking, vaping and quitting: A representative population survey in England‏
670 ‎‡a Author's Crime and Risky Behavior in Traffic: An Example of Cross-Situational Consistency‏
670 ‎‡a Author's Current issues and new directions in Psychology and Health: the potential contribution of health psychology to developing effective interventions to reduce tobacco smoking‏
670 ‎‡a Author's Current issues and new directions inPsychology and Health: The potential contribution of health psychology to developing effective interventions to reduce tobacco smoking‏
670 ‎‡a Author's Decision-making style, driving style, and self-reported involvement in road traffic accidents.‏
670 ‎‡a Author's Development of a formal system for representing behaviour-change theories‏
670 ‎‡a Author's Development of a taxonomy of behaviour change techniques used in individual behavioural support for smoking cessation‏
670 ‎‡a Author's Development of an Intervention Setting Ontology for behaviour change: Specifying where interventions take place‏
670 ‎‡a Author's Did the introduction of varenicline in England substitute for or add to the use of other smoking cessation medications?‏
670 ‎‡a Author's Differences in happiness between smokers, ex-smokers and never smokers: cross-sectional findings from a national household survey‏
670 ‎‡a Author's Do daily fluctuations in psychological and app-related variables predict engagement with an alcohol reduction app? A series of N-of-1 studies‏
670 ‎‡a Author's Do daily fluctuations in psychological and app-related variables predict engagement with an alcohol reduction app? A series of N-of-1 studies (Preprint)‏
670 ‎‡a Author's Do older children take in more smoke from their cigarettes? Evidence from carbon monoxide levels‏
670 ‎‡a Author's Do social support interventions‏
670 ‎‡a Author's Do social support interventions ( "buddy systems" ) aid smoking cessation? A review‏
670 ‎‡a Author's Does belief that one is addicted promote or deter attempts at abstinence?‏
670 ‎‡a Author's Does it matter who you see to help you stop smoking? Short-term quit rates across specialist stop smoking practitioners in England.‏
670 ‎‡a Author's Does smoking in adolescence affect body mass index, waist or height? Findings from a longitudinal study‏
670 ‎‡a Author's Does switching to an ultra-low nicotine cigarette induce nicotine withdrawal effects?‏
670 ‎‡a Author's Double-blind placebo controlled trial of dextrose tablets and nicotine patch in smoking cessation‏
670 ‎‡a Author's Drinking alcohol surrogates among clients of an alcohol-misuser treatment clinic in Novosibirsk, Russia‏
670 ‎‡a Author's Drug trafficking: time to abolish the death penalty‏
670 ‎‡a Author's Drugs and harm to society‏
670 ‎‡a Author's E-cigarette research needs to adopt open science practices to improve quality‏
670 ‎‡a Author's E-cigarette use in England 2014-2017 as a function of socioeconomic profile‏
670 ‎‡a Author's Early dating predicts smoking during adolescence: A prospective study‏
670 ‎‡a Author's Effect of a short bout of exercise on tobacco withdrawal symptoms and desire to smoke.‏
670 ‎‡a Author's Effect of buspirone on cigarette withdrawal symptoms and short-term abstinence rates in a smokers clinic‏
670 ‎‡a Author's Effect of cigarettes on memory search and subjective ratings.‏
670 ‎‡a Author's Effect of isometric exercise and body scanning on cigarette cravings and withdrawal symptoms.‏
670 ‎‡a Author's Effectiveness of an offer of the Smoke Free smartphone application for smoking cessation: protocol for a randomized controlled trial‏
670 ‎‡a Author's Effectiveness of an Online Knowledge Training and Assessment Program for Stop Smoking Practitioners‏
670 ‎‡a Author's Effectiveness of nicotine replacement therapy--a rebuttal.‏
670 ‎‡a Author's Effectiveness of specialist group treatment for smoking cessation vs. one-to-one treatment in primary care‏
670 ‎‡a Author's Effectiveness of training stop-smoking advisers to deliver cessation support to the UK national proposed standard versus usual care in Malaysia: a two-arm cluster randomised controlled trial‏
670 ‎‡a Author's Effects of nicotine on finger tapping rate in non-smokers‏
670 ‎‡a Author's Evaluation of the London Smoking Cessation Transformation Programme: a time series analysis‏
670 ‎‡a Author's Evaluations of clinical tobacco cessation interventions in Arab populations: A systematic review‏
670 ‎‡a Author's Examination Results of Pupils Offered Assisted Places: comparing GCE Advanced level results in independent and state schools‏
670 ‎‡a Author's Expenditure on smoking and alternative nicotine delivery products: a population survey in England‏
670 ‎‡a Author's Factors associated with smoking in student nurses‏
670 ‎‡a Author's Factors associated with the efficacy of smoking cessation treatments and predictors of smoking abstinence in EAGLES.‏
670 ‎‡a Author's Financing School-Based Education in England: Poverty, Examination Results, and Expenditure‏
670 ‎‡a Author's Finding smoking hot-spots: a cross-sectional survey of smoking patterns by housing tenure in England‏
670 ‎‡a Author's Gender differences in drinking practices in middle aged and older Russians‏
670 ‎‡a Author's General practitioners' views on and referral to NHS smoking cessation services‏
670 ‎‡a Author's German medical students lack knowledge of how to treat smoking and problem drinking‏
670 ‎‡a Author's Global statistics on alcohol, tobacco and illicit drug use: 2017 status report‏
670 ‎‡a Author's How cost-effective is 'No Smoking Day'?‏
670 ‎‡a Author's Hypertension and its identification among current, past and never smokers in an English population sample‏
670 ‎‡a Author's Identifying Evidence-Based Competences Required to Deliver Behavioural Support for Smoking Cessation‏
670 ‎‡a Author's Increase in common cold symptoms and mouth ulcers following smoking cessation.‏
670 ‎‡a Author's Inside Addiction: peering into the editorial review process‏
670 ‎‡a Author's Interest in nicotine replacement therapy among pregnant smokers.‏
670 ‎‡a Author's Introducing Addiction Lives‏
670 ‎‡a Author's Is 'hardcore smoker' a useful term in tobacco control?‏
670 ‎‡a Author's Is the ten-item Questionnaire of Smoking Urges‏
670 ‎‡a Author's Is the ten-item Questionnaire of Smoking Urges (QSU-brief) more sensitive to abstinence than shorter craving measures?‏
670 ‎‡a Author's Is the UK's coalition Government serious about public health?‏
670 ‎‡a Author's It is premature to expand access to medicinal cannabis in hopes of solving the US opioid crisis.‏
670 ‎‡a Author's Lessons learned from unsuccessful use of using personal carbon monoxide monitors to remotely assess abstinence in a pragmatic trial of a smartphone stop smoking app – A secondary analysis‏
670 ‎‡a Author's Levels of toxins in oral tobacco products in the UK.‏
670 ‎‡a Author's Loss of acute nicotine tolerance and severity of cigarette withdrawal‏
670 ‎‡a Author's Mitigating and learning from the impact of COVID-19 infection on addictive disorders‏
670 ‎‡a Author's Modelling continuous abstinence rates over time from clinical trials of pharmacological interventions for smoking cessation‏
670 ‎‡a Author's Modelling the effect of minor orthopaedic day surgery on patient mood at the early post-operative period: a prospective population-based cohort study‏
670 ‎‡a Author's Modely závislosti‏
670 ‎‡a Author's Moderators of real-world effectiveness of smoking cessation aids: a population study‏
670 ‎‡a Author's Motivation to reduce alcohol consumption and subsequent attempts at reduction and changes in consumption in increasing and higher-risk drinkers in England: a prospective population survey‏
670 ‎‡a Author's Multiple substance dependence: implications for treatment of nicotine dependence.‏
670 ‎‡a Author's Newly available treatments for nicotine addiction. Smokers wanting help with stopping now have effective treatment options‏
670 ‎‡a Author's Nicotine addiction: a re-analysis of the arguments.‏
670 ‎‡a Author's Nicotine intake in cigarette smokers in England: distribution and demographic correlates‏
670 ‎‡a Author's Nicotine intake in young smokers: longitudinal study of saliva cotinine concentrations.‏
670 ‎‡a Author's Ontologies relevant to behaviour change interventions: a method for their development‏
670 ‎‡a Author's 'Payment by results' and smoking cessation support.‏
670 ‎‡a Author's Perceived barriers to and benefits of attending a stop smoking course during pregnancy.‏
670 ‎‡a Author's Population-level predictors of changes in success rates of smoking quit attempts in England: a time series analysis‏
670 ‎‡a Author's Predictors of 3-month abstinence in smokers attending stop-smoking clinics in Malaysia‏
670 ‎‡a Author's Predictors of engagement, response to follow-up and extent of alcohol reduction in users of a smartphone app (Drink Less) (Preprint)‏
670 ‎‡a Author's Preferences for scale structure in melodic sequences‏
670 ‎‡a Author's Prevalence, diagnosis and relation to tobacco dependence of chronic obstructive pulmonary disease in a nationally representative population sample.‏
670 ‎‡a Author's Preventing tobacco companies from advertising using their packaging could be an important component of comprehensive tobacco control: a commentary on Australia's plain packaging of cigarettes‏
670 ‎‡a Author's Providing full manuals and intervention descriptions: Addiction policy.‏
670 ‎‡a Author's Psychology and pharmacology in cigarette withdrawal.‏
670 ‎‡a Author's Public support in England for raising the price of cigarettes to fund tobacco control activities‏
670 ‎‡a Author's Publisher Correction: A smartphone app to reduce excessive alcohol consumption: Identifying the effectiveness of intervention components in a factorial randomised control trial.‏
670 ‎‡a Author's Randomised controlled trial of ondansetron in smoking cessation‏
670 ‎‡a Author's Randomized Comparative Trial of Nicotine Polacrilex, a Transdermal Patch, Nasal Spray, and an Inhaler‏
670 ‎‡a Author's Randomized controlled trial of a social support ('buddy') intervention for smoking cessation‏
670 ‎‡a Author's Randomized controlled trial of physical activity counseling as an aid to smoking cessation: 12 month follow-up.‏
670 ‎‡a Author's Rapid reduction versus abrupt quitting for smokers who want to stop soon: a randomised controlled non-inferiority trial‏
670 ‎‡a Author's RCT of a client-centred, caseworker-delivered smoking cessation intervention for a socially disadvantaged population‏
670 ‎‡a Author's Recommendation for the assessment of tobacco craving and withdrawal in smoking cessation trials.‏
670 ‎‡a Author's Reducing SARS-CoV-2 transmission in the UK: A behavioural science approach to identifying options for increasing adherence to social distancing and shielding vulnerable people‏
670 ‎‡a Author's Reduction in Cortisol After Smoking Cessation Among Users of Nicotine Patches‏
670 ‎‡a Author's Reflections on Addiction Research Centres and the Nurturing of Creativity.‏
670 ‎‡a Author's Regular smokers, lifetime very light smokers, and reduced smokers: Comparison of psychosocial and smoking characteristics in women‏
670 ‎‡a Author's Relapse prevention interventions for smoking cessation‏
670 ‎‡a Author's Relative effectiveness of a full versus reduced version of the ‘Smoke Free’ mobile application for smoking cessation: a randomised controlled trial‏
670 ‎‡a Author's Relative effectiveness of a full versus reduced version of the 'Smoke Free' mobile application for smoking cessation: an exploratory randomised controlled trial‏
670 ‎‡a Author's Reply to 'Smoke free, but dependent on nicotine' (Karam-Hage 2019)‏
670 ‎‡a Author's Representation of behaviour change interventions and their evaluation: Development of the Upper Level of the Behaviour Change Intervention Ontology‏
670 ‎‡a Author's ROI in Public Health Policy: Supporting Decision MakingSubhash Pokhrel, Lesley Owen, Kathryn Coyle & Doug Coyle Switzerland: Palgrave Macmillan, 2018 ISBN: 978-3-319-68897-8‏
670 ‎‡a Author's Role of formal instruction and informal practice in learning to drive.‏
670 ‎‡a Author's 'S'-shaped curve: modelling trends in smoking prevalence, uptake and cessation in Great Britain from 1973 to 2016‏
670 ‎‡a Author's Self-reported practices, attitudes and levels of training of practitioners in the English NHS Stop Smoking Services.‏
670 ‎‡a Author's Should smokers be offered assistance with stopping?‏
670 ‎‡a Author's Significant effects: A personal perspective on how health psychologists can influence policy and practice‏
670 ‎‡a Author's Smokeless tobacco cessation guidelines for health professionals in England.‏
670 ‎‡a Author's Smoking cessation guidelines for health professionals: an update. Health Education Authority‏
670 ‎‡a Author's Smoking intentions and mood preceding lapse after completion of treatment to aid smoking cessation‏
670 ‎‡a Author's Smoking status of step-parents as a risk factor for smoking in adolescence.‏
670 ‎‡a Author's Specifying who delivers behaviour change interventions: development of an Intervention Source Ontology‏
670 ‎‡a Author's Stop smoking clinics in Malaysia: characteristics of attendees and predictors of success‏
670 ‎‡a Author's Strength of urges to smoke as a measure of severity of cigarette dependence: comparison with the Fagerström Test for Nicotine Dependence and its components.‏
670 ‎‡a Author's Subjective effects of cigarette smoking in adolescents‏
670 ‎‡a Author's Sustained behavior change is key to preventing and tackling future pandemics‏
670 ‎‡a Author's Symptom attribution and the recognition of psychiatric morbidity‏
670 ‎‡a Author's Test for assessing tar/nicotine yields‏
670 ‎‡a Author's The attitude of maternity staff to, and smoking cessation interventions with, childbearing women in London‏
670 ‎‡a Author's The Behaviour Change Technique Ontology: Transforming the Behaviour Change Technique Taxonomy v1‏
670 ‎‡a Author's The behaviour change wheel: a new method for characterising and designing behaviour change interventions‏
670 ‎‡a Author's The case for development of an E-cigarette Ontology (E-CigO) to improve quality, efficiency and clarity in the conduct and interpretation of research‏
670 ‎‡a Author's The clinical significance of "small" effects of smoking cessation treatments.‏
670 ‎‡a Author's The detection of notes incompatible with scalar structure‏
670 ‎‡a Author's The effect of duration of breath-holding on expired air carbon monoxide concentration in cigarette smokers‏
670 ‎‡a Author's The future of nicotine replacement in smoking cessation?‏
670 ‎‡a Author's The impact of changing nicotine replacement therapy licensing laws in the United Kingdom: findings from the International Tobacco Control Four Country Survey.‏
670 ‎‡a Author's The need for more consistent evidential standards in cannabis policy evaluations‏
670 ‎‡a Author's The Role of Personality and Attitudes in Traffic Accident Risk‏
670 ‎‡a Author's 'The smoking toolkit study': a national study of smoking and smoking cessation in England‏
670 ‎‡a Author's The UK national institute for health and clinical excellence public health guidance on behaviour change: A brief introduction‏
670 ‎‡a Author's The use of heart rate as a marker for tolerance in studies with smokers‏
670 ‎‡a Author's The Use of Nicotine Replacement Therapy for Smoking Reduction and Temporary Abstinence: An Interview Study‏
670 ‎‡a Author's The use of videos to inform smokers about different nicotine replacement products.‏
670 ‎‡a Author's Time course of cigarette withdrawal symptoms during four weeks of treatment with nicotine chewing gum‏
670 ‎‡a Author's Time for a change: putting the Transtheoretical‏
670 ‎‡a Author's Time for a change: putting the Transtheoretical (Stages of Change) Model to rest.‏
670 ‎‡a Author's Tobacco use and dementia: evidence from the 1066 dementia population-based surveys in Latin America, China and India.‏
670 ‎‡a Author's Transition towards a 'non-smoker' identity following smoking cessation: an interpretative phenomenological analysis‏
670 ‎‡a Author's Triggering anti-smoking advice by GPs: mode of action of an intervention stimulating smoking cessation advice by GPs.‏
670 ‎‡a Author's Underreporting of the active content of behavioural interventions: a systematic review and meta-analysis of randomised trials of smoking cessation interventions‏
670 ‎‡a Author's Understanding and using time series analyses in addiction research‏
670 ‎‡a Author's Updating the evidence on the effectiveness of the alcohol reduction app, Drink Less: using Bayes factors to analyse trial datasets supplemented with extended recruitment‏
670 ‎‡a Author's Urinary adrenaline concentrations during 10 days of smoking abstinence‏
670 ‎‡a Author's Use of nicotine replacement therapy for smoking reduction and during enforced temporary abstinence: a national survey of English smokers.‏
670 ‎‡a Author's Variability and effectiveness of comparator group interventions in smoking cessation trials: a systematic review and meta-analysis‏
670 ‎‡a Author's What is the purpose of diagnosing addiction or dependence and what does this mean for establishing diagnostic criteria?‏
670 ‎‡a Author's What lessons can be learned from tobacco control for combating the growing prevalence of obesity?‏
670 ‎‡a Author's What makes for an effective stop-smoking service?‏
670 ‎‡a Author's What mediates the effect of confrontational counselling on smoking cessation in smokers with COPD?‏
670 ‎‡a Author's What role does dopamine really play in tobacco addiction?‏
670 ‎‡a Author's Why combating tobacco smuggling is a priority‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NII|DA04157015‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/DNB|1046386891‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NUKAT|n 2006130887‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/ISNI|000000011084140X‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NTA|306075571‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/BIBSYS|90256820‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/BNF|15070198‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/BNE|XX5425238‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/viaf/112884413‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NKC|mub2014825215‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/LC|n 90690234‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/SUDOC|127476164‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NLA|000040192298‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/RERO|02-A011707294‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NLI|002184162‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/LNB|LNC10-000186858‏
909 ‎‡a (orcid) 0000000163980921‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000202915760‏ ‎‡9 1‏
919 ‎‡a effectofashortboutofexerciseontobaccowithdrawalsymptomsanddesiretosmoke‏ ‎‡A Effect of a short bout of exercise on tobacco withdrawal symptoms and desire to smoke.‏ ‎‡9 1‏
919 ‎‡a earlydatingpredictssmokingduringadolescenceaprospectivestudy‏ ‎‡A Early dating predicts smoking during adolescence: A prospective study‏ ‎‡9 1‏
919 ‎‡a ecigaretteuseinengland20142017asafunctionofsocioeconomicprofile‏ ‎‡A E-cigarette use in England 2014-2017 as a function of socioeconomic profile‏ ‎‡9 1‏
919 ‎‡a ecigaretteresearchneedstoadoptopensciencepracticestoimprovequality‏ ‎‡A E-cigarette research needs to adopt open science practices to improve quality‏ ‎‡9 1‏
919 ‎‡a drugsandharmtosociety‏ ‎‡A Drugs and harm to society‏ ‎‡9 1‏
919 ‎‡a drugtraffickingtimetoabolishthedeathpenalty‏ ‎‡A Drug trafficking: time to abolish the death penalty‏ ‎‡9 1‏
919 ‎‡a drinkingalcoholsurrogatesamongclientsofanalcoholmisusertreatmentclinicinnovosibirskrussia‏ ‎‡A Drinking alcohol surrogates among clients of an alcohol-misuser treatment clinic in Novosibirsk, Russia‏ ‎‡9 1‏
919 ‎‡a doubleblindplacebocontrolledtrialofdextrosetabletsandnicotinepatchinsmokingcessation‏ ‎‡A Double-blind placebo controlled trial of dextrose tablets and nicotine patch in smoking cessation‏ ‎‡9 1‏
919 ‎‡a doesswitchingtoanultralownicotinecigaretteinducenicotinewithdrawaleffects‏ ‎‡A Does switching to an ultra-low nicotine cigarette induce nicotine withdrawal effects?‏ ‎‡9 1‏
919 ‎‡a doessmokinginadolescenceaffectbodymassindexwaistorheightfindingsfromalongitudinalstudy‏ ‎‡A Does smoking in adolescence affect body mass index, waist or height? Findings from a longitudinal study‏ ‎‡9 1‏
919 ‎‡a doesitmatterwhoyouseetohelpyoustopsmokingshorttermquitratesacrossspecialiststopsmokingpractitionersinengland‏ ‎‡A Does it matter who you see to help you stop smoking? Short-term quit rates across specialist stop smoking practitioners in England.‏ ‎‡9 1‏
919 ‎‡a doesbeliefthat1isaddictedpromoteordeterattemptsatabstinence‏ ‎‡A Does belief that one is addicted promote or deter attempts at abstinence?‏ ‎‡9 1‏
919 ‎‡a dosocialsupportinterventionsbuddysystemsaidsmokingcessationareview‏ ‎‡A Do social support interventions ( "buddy systems" ) aid smoking cessation? A review‏ ‎‡9 1‏
919 ‎‡a dosocialsupportinterventions‏ ‎‡A Do social support interventions‏ ‎‡9 1‏
919 ‎‡a doolderchildrentakeinmoresmokefromtheircigarettesevidencefromcarbonmonoxidelevels‏ ‎‡A Do older children take in more smoke from their cigarettes? Evidence from carbon monoxide levels‏ ‎‡9 1‏
919 ‎‡a dodailyfluctuationsinpsychologicalandapprelatedvariablespredictengagementwithanalcoholreductionappaseriesofnof1studiespreprint‏ ‎‡A Do daily fluctuations in psychological and app-related variables predict engagement with an alcohol reduction app? A series of N-of-1 studies (Preprint)‏ ‎‡9 1‏
919 ‎‡a dodailyfluctuationsinpsychologicalandapprelatedvariablespredictengagementwithanalcoholreductionappaseriesofnof1studies‏ ‎‡A Do daily fluctuations in psychological and app-related variables predict engagement with an alcohol reduction app? A series of N-of-1 studies‏ ‎‡9 1‏
919 ‎‡a differencesinhappinessbetweensmokersexsmokersandneversmokerscrosssectionalfindingsfromanationalhouseholdsurvey‏ ‎‡A Differences in happiness between smokers, ex-smokers and never smokers: cross-sectional findings from a national household survey‏ ‎‡9 1‏
919 ‎‡a didtheintroductionofvareniclineinenglandsubstitutefororaddtotheuseofothersmokingcessationmedications‏ ‎‡A Did the introduction of varenicline in England substitute for or add to the use of other smoking cessation medications?‏ ‎‡9 1‏
919 ‎‡a developmentofaninterventionsettingontologyforbehaviourchangespecifyingwhereinterventionstakeplace‏ ‎‡A Development of an Intervention Setting Ontology for behaviour change: Specifying where interventions take place‏ ‎‡9 1‏
919 ‎‡a developmentofataxonomyofbehaviourchangetechniquesusedinindividualbehaviouralsupportforsmokingcessation‏ ‎‡A Development of a taxonomy of behaviour change techniques used in individual behavioural support for smoking cessation‏ ‎‡9 1‏
919 ‎‡a developmentofaformalsystemforrepresentingbehaviourchangetheories‏ ‎‡A Development of a formal system for representing behaviour-change theories‏ ‎‡9 1‏
919 ‎‡a decisionmakingstyledrivingstyleandselfreportedinvolvementinroadtrafficaccidents‏ ‎‡A Decision-making style, driving style, and self-reported involvement in road traffic accidents.‏ ‎‡9 1‏
919 ‎‡a currentissuesandnewdirectionsinpsychologyandhealththepotentialcontributionofhealthpsychologytodevelopingeffectiveinterventionstoreducetobaccosmoking‏ ‎‡A Current issues and new directions inPsychology and Health: The potential contribution of health psychology to developing effective interventions to reduce tobacco smoking‏ ‎‡9 2‏
919 ‎‡a crimeandriskybehaviorintrafficanexampleofcrosssituationalconsistency‏ ‎‡A Crime and Risky Behavior in Traffic: An Example of Cross-Situational Consistency‏ ‎‡9 1‏
919 ‎‡a covid19smokingvapingandquittingarepresentativepopulationsurveyinengland‏ ‎‡A COVID-19, smoking, vaping and quitting: A representative population survey in England‏ ‎‡9 1‏
919 ‎‡a compulsorydetentionforceddetoxificationandenforcedlabourarenotethicallyacceptableoreffectivewaystotreataddiction‏ ‎‡A Compulsory detention, forced detoxification and enforced labour are not ethically acceptable or effective ways to treat addiction‏ ‎‡9 1‏
919 ‎‡a complexsystemsandindividuallevelapproachestopopulationhealthafalsedichotomy‏ ‎‡A Complex systems and individual-level approaches to population health: a false dichotomy?‏ ‎‡9 1‏
919 ‎‡a cognitiveandpsychologicalcorrelatesofsmokingabstinenceandpredictorsofsuccessfulcessation‏ ‎‡A Cognitive and psychological correlates of smoking abstinence, and predictors of successful cessation.‏ ‎‡9 1‏
919 ‎‡a clinicaltrialcomparingnicotinereplacementtherapynrtplusbriefcounsellingbriefcounsellingaloneandminimalinterventiononsmokingcessationinhospitalinpatients‏ ‎‡A Clinical trial comparing nicotine replacement therapy (NRT) plus brief counselling, brief counselling alone, and minimal intervention on smoking cessation in hospital inpatients.‏ ‎‡9 1‏
919 ‎‡a cigarettesmokingandpsychophysiologicalstressresponsivenesseffectsofrecentsmokingandtemporaryabstinence‏ ‎‡A Cigarette smoking and psychophysiological stress responsiveness: effects of recent smoking and temporary abstinence‏ ‎‡9 1‏
919 ‎‡a changesinsmokingprevalencein1617yearoldversusolderadultsfollowingariseinlegalageofsalefindingsfromanenglishpopulationstudy‏ ‎‡A Changes in smoking prevalence in 16-17-year-old versus older adults following a rise in legal age of sale: findings from an English population study.‏ ‎‡9 1‏
919 ‎‡a effectofisometricexerciseandbodyscanningoncigarettecravingsandwithdrawalsymptoms‏ ‎‡A Effect of isometric exercise and body scanning on cigarette cravings and withdrawal symptoms.‏ ‎‡9 1‏
919 ‎‡a effectivenessofanofferofthesmokefreesmartphoneapplicationforsmokingcessationprotocolforarandomizedcontrolledtrial‏ ‎‡A Effectiveness of an offer of the Smoke Free smartphone application for smoking cessation: protocol for a randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a effectivenessofanonlineknowledgetrainingandassessmentprogramforstopsmokingpractitioners‏ ‎‡A Effectiveness of an Online Knowledge Training and Assessment Program for Stop Smoking Practitioners‏ ‎‡9 1‏
919 ‎‡a effectivenessofnicotinereplacementtherapyarebuttal‏ ‎‡A Effectiveness of nicotine replacement therapy--a rebuttal.‏ ‎‡9 1‏
919 ‎‡a effectivenessofspecialistgrouptreatmentforsmokingcessationvs1to1treatmentinprimarycare‏ ‎‡A Effectiveness of specialist group treatment for smoking cessation vs. one-to-one treatment in primary care‏ ‎‡9 1‏
919 ‎‡a effectivenessoftrainingstopsmokingadviserstodelivercessationsupporttotheuknationalproposedstandardversususualcareinmalaysiaa2armclusterrandomisedcontrolledtrial‏ ‎‡A Effectiveness of training stop-smoking advisers to deliver cessation support to the UK national proposed standard versus usual care in Malaysia: a two-arm cluster randomised controlled trial‏ ‎‡9 1‏
919 ‎‡a effectsofnicotineonfingertappingrateinnonsmokers‏ ‎‡A Effects of nicotine on finger tapping rate in non-smokers‏ ‎‡9 1‏
919 ‎‡a evaluationofthelondonsmokingcessationtransformationprogrammeatimeseriesanalysis‏ ‎‡A Evaluation of the London Smoking Cessation Transformation Programme: a time series analysis‏ ‎‡9 1‏
919 ‎‡a evaluationsofclinicaltobaccocessationinterventionsinarabpopulationsasystematicreview‏ ‎‡A Evaluations of clinical tobacco cessation interventions in Arab populations: A systematic review‏ ‎‡9 1‏
919 ‎‡a examinationresultsofpupilsofferedassistedplacescomparinggceadvancedlevelresultsinindependentandstateschools‏ ‎‡A Examination Results of Pupils Offered Assisted Places: comparing GCE Advanced level results in independent and state schools‏ ‎‡9 1‏
919 ‎‡a changesinsmokercharacteristicsinenglandbetween2008and‏ ‎‡A Changes in smoker characteristics in England between 2008 and 2017‏ ‎‡9 1‏
919 ‎‡a cardiovascularriskfactorsinpatientswithschizophreniareceivingcontinuousmedicalcare‏ ‎‡A Cardiovascular Risk Factors in Patients with Schizophrenia Receiving Continuous Medical Care‏ ‎‡9 1‏
919 ‎‡a cardiovascularandsubjectiveeffectsofsmokingbeforeandafter24hofabstinencefromcigarettes‏ ‎‡A Cardiovascular and subjective effects of smoking before and after 24 h of abstinence from cigarettes‏ ‎‡9 1‏
919 ‎‡a canwetrustnationalsmokingprevalencefiguresdiscrepanciesbetweenbiochemicallyassessedandselfreportedsmokingratesin3countries‏ ‎‡A Can we trust national smoking prevalence figures? Discrepancies between biochemically assessed and self-reported smoking rates in three countries‏ ‎‡9 1‏
919 ‎‡a canthedutchgovernmentreallybeabandoningsmokerstotheirfate‏ ‎‡A Can the Dutch Government really be abandoning smokers to their fate?‏ ‎‡9 1‏
919 ‎‡a beneficialeffectsofnicotinefactorfiction‏ ‎‡A Beneficial effects of nicotine: fact or fiction?‏ ‎‡9 1‏
919 ‎‡a beliefsofstopsmokingpractitionersinunitedkingdomontheuseofnicotinereplacementtherapyforsmokingreduction‏ ‎‡A Beliefs of stop smoking practitioners in United Kingdom on the use of nicotine replacement therapy for smoking reduction.‏ ‎‡9 1‏
919 ‎‡a beliefsabouttheharmsoflongtermuseofnicotinereplacementtherapyperceptionsofsmokersinengland‏ ‎‡A Beliefs about the harms of long-term use of nicotine replacement therapy: perceptions of smokers in England.‏ ‎‡9 1‏
919 ‎‡a behaviouralsupportprogrammesforsmokingcessationneedsandopportunities‏ ‎‡A Behavioural support programmes for smoking cessation: needs and opportunities‏ ‎‡9 1‏
919 ‎‡a behaviouralcharacteristicsandinvolvementindifferenttypesoftrafficaccident‏ ‎‡A Behavioural characteristics and involvement in different types of traffic accident‏ ‎‡9 1‏
919 ‎‡a behaviourchangetechniquesassociatedwithsmokingcessationininterventionandcomparatorgroupsofrandomisedcontrolledtrialsasystematicreviewandmetaregression‏ ‎‡A Behaviour Change Techniques Associated with Smoking Cessation in Intervention and Comparator Groups of Randomised Controlled Trials: A Systematic Review and Meta-Regression‏ ‎‡9 1‏
919 ‎‡a behavioralcorrelatesofindividualdifferencesinroadtrafficcrashriskanexaminationmethodandfindings‏ ‎‡A Behavioral correlates of individual differences in road-traffic crash risk: an examination method and findings.‏ ‎‡9 1‏
919 ‎‡a behaviorchangetechniquesusedingroupbasedbehavioralsupportbytheenglishstopsmokingservicesandpreliminaryassessmentofassociationwithshorttermquitoutcomes‏ ‎‡A Behavior change techniques used in group-based behavioral support by the English stop-smoking services and preliminary assessment of association with short-term quit outcomes‏ ‎‡9 1‏
919 ‎‡a behaviorchangetechniquesinpopularalcoholreductionappscontentanalysis‏ ‎‡A Behavior change techniques in popular alcohol reduction apps: content analysis‏ ‎‡9 1‏
919 ‎‡a awarenessofmouthcanceringreatbritain‏ ‎‡A Awareness of mouth cancer in Great Britain‏ ‎‡9 1‏
919 ‎‡a authorsreplytoletter‏ ‎‡A Authors' reply to letter.‏ ‎‡9 1‏
919 ‎‡a associationofprevalenceofelectroniccigaretteusewithsmokingcessationandcigaretteconsumptioninenglandatimeseriesanalysisbetween2006and‏ ‎‡A Association of prevalence of electronic cigarette use with smoking cessation and cigarette consumption in England: a time-series analysis between 2006 and 2017‏ ‎‡9 1‏
919 ‎‡a assessmentofdependenceandmotivationtostopsmoking‏ ‎‡A Assessment of dependence and motivation to stop smoking‏ ‎‡9 1‏
919 ‎‡a assessingthepsychometricpropertiesofthedigitalbehaviorchangeinterventionengagementscaleinusersofanappforreducingalcoholconsumptionevaluationstudy‏ ‎‡A Assessing the Psychometric Properties of the Digital Behavior Change Intervention Engagement Scale in Users of an App for Reducing Alcohol Consumption: Evaluation Study‏ ‎‡9 1‏
919 ‎‡a assessingsmokingstatusinchildrenadolescentsandadultscotininecutpointsrevisited‏ ‎‡A Assessing smoking status in children, adolescents and adults: cotinine cut-points revisited.‏ ‎‡9 1‏
919 ‎‡a assessingdrugrelatedharm‏ ‎‡A Assessing drug-related harm‏ ‎‡9 1‏
919 ‎‡a assessingandaddressingcolliderbiasinaddictionresearchthecuriouscaseofsmokingandcovid19‏ ‎‡A Assessing and addressing collider bias in addiction research: the curious case of smoking and COVID-19‏ ‎‡9 1‏
919 ‎‡a applyingprinciplesofbehaviourchangetoreducesarscov2transmission‏ ‎‡A Applying principles of behaviour change to reduce SARS-CoV-2 transmission‏ ‎‡9 1‏
919 ‎‡a onlinepaperauthoringtoolpattoimprovereportingofandsynthesisofevidencefromtrialsinbehavioralsciences‏ ‎‡A An online Paper Authoring Tool (PAT) to improve reporting of, and synthesis of evidence from, trials in behavioral sciences‏ ‎‡9 1‏
919 ‎‡a evaluationoftheinterventionagainstsmokinginthemultipleriskfactorinterventiontrial‏ ‎‡A An evaluation of the intervention against smoking in the multiple risk factor intervention trial‏ ‎‡9 1‏
919 ‎‡a alcoholicsbeliefsaboutresponsibilityforandrecoveryfromtheircondition‏ ‎‡A Alcoholics' beliefs about responsibility for, and recovery from, their condition‏ ‎‡9 1‏
919 ‎‡a adolescentsawarenessofandinvolvementwithillicittobaccointheuk‏ ‎‡A Adolescents' awareness of, and involvement with, illicit tobacco in the UK‏ ‎‡9 1‏
919 ‎‡a addictionsprioritieswhenevaluatingsubmissions‏ ‎‡A Addiction's priorities when evaluating submissions‏ ‎‡9 1‏
919 ‎‡a addictiontheoriesandconstructsanewseries‏ ‎‡A Addiction Theories and Constructs: a new series‏ ‎‡9 1‏
919 ‎‡a addictioninchinatowardsaresearchagendaforthenext5years‏ ‎‡A Addiction in China: Towards a research agenda for the next 5 years‏ ‎‡9 1‏
919 ‎‡a acutereductioninsecretoryimmunoglobulinafollowingsmokingcessation‏ ‎‡A Acute reduction in secretory immunoglobulin A following smoking cessation‏ ‎‡9 1‏
919 ‎‡a acuteeffectofabriefboutofexerciseonalcoholurges‏ ‎‡A Acute effect of a brief bout of exercise on alcohol urges.‏ ‎‡9 1‏
919 ‎‡a accesstodatafromclinicaltrialssponsoredbypharmaceuticalcompanies‏ ‎‡A Access to data from clinical trials sponsored by pharmaceutical companies.‏ ‎‡9 1‏
919 ‎‡a surveyofpregnantsmokersinterestindifferenttypesofsmokingcessationsupport‏ ‎‡A A survey of pregnant smokers' interest in different types of smoking cessation support‏ ‎‡9 1‏
919 ‎‡a smartphoneapptoreduceexcessivealcoholconsumptionidentifyingtheeffectivenessofinterventioncomponentsinafactorialrandomisedcontroltrial‏ ‎‡A A smartphone app to reduce excessive alcohol consumption: Identifying the effectiveness of intervention components in a factorial randomised control trial.‏ ‎‡9 1‏
919 ‎‡a revisedchecklistforwritingupresearchreports‏ ‎‡A A revised checklist for writing up research reports‏ ‎‡9 1‏
919 ‎‡a renewedcallforactiononalcoholpolicy‏ ‎‡A A renewed call for action on alcohol policy‏ ‎‡9 1‏
919 ‎‡a randomizedcontrolledtrialofaddingexpiredcarbonmonoxidefeedbacktobriefstopsmokingadviceevaluationofcognitiveandbehavioraleffects‏ ‎‡A A randomized, controlled trial of adding expired carbon monoxide feedback to brief stop smoking advice: Evaluation of cognitive and behavioral effects‏ ‎‡9 1‏
919 ‎‡a randomisedtrialofglucosetabletstoaidsmokingcessation‏ ‎‡A A randomised trial of glucose tablets to aid smoking cessation.‏ ‎‡9 1‏
919 ‎‡a randomisedplacebocontrolledtrialoforalhydrocortisonefortreatingtobaccowithdrawalsymptoms‏ ‎‡A A randomised placebo-controlled trial of oral hydrocortisone for treating tobacco withdrawal symptoms‏ ‎‡9 1‏
919 ‎‡a mobileapptoaidsmokingcessationpreliminaryevaluationofsmokefree28‏ ‎‡A A mobile app to aid smoking cessation: preliminary evaluation of SmokeFree28.‏ ‎‡9 1‏
919 ‎‡a doubleblindplacebocontrolledexperimentalstudyofnicotine2effectsonresponseinhibitionandexecutivefunctioning‏ ‎‡A A double-blind placebo-controlled experimental study of nicotine: II--Effects on response inhibition and executive functioning.‏ ‎‡9 1‏
919 ‎‡a comparisonoftheabuseliabilityanddependencepotentialofnicotinepatchgumsprayandinhaler‏ ‎‡A A comparison of the abuse liability and dependence potential of nicotine patch, gum, spray and inhaler.‏ ‎‡9 1‏
919 ‎‡a comparisonofexposuretocarcinogensamongrollyourownandfactorymadecigarettesmokers‏ ‎‡A A comparison of exposure to carcinogens among roll-your-own and factory-made cigarette smokers‏ ‎‡9 1‏
919 ‎‡a expenditureonsmokingandalternativenicotinedeliveryproductsapopulationsurveyinengland‏ ‎‡A Expenditure on smoking and alternative nicotine delivery products: a population survey in England‏ ‎‡9 1‏
919 ‎‡a factorsassociatedwithsmokinginstudentnurses‏ ‎‡A Factors associated with smoking in student nurses‏ ‎‡9 1‏
919 ‎‡a factorsassociatedwiththeefficacyofsmokingcessationtreatmentsandpredictorsofsmokingabstinenceineagles‏ ‎‡A Factors associated with the efficacy of smoking cessation treatments and predictors of smoking abstinence in EAGLES.‏ ‎‡9 1‏
919 ‎‡a financingschoolbasededucationinenglandpovertyexaminationresultsandexpenditure‏ ‎‡A Financing School-Based Education in England: Poverty, Examination Results, and Expenditure‏ ‎‡9 1‏
919 ‎‡a findingsmokinghotspotsacrosssectionalsurveyofsmokingpatternsbyhousingtenureinengland‏ ‎‡A Finding smoking hot-spots: a cross-sectional survey of smoking patterns by housing tenure in England‏ ‎‡9 1‏
919 ‎‡a genderdifferencesindrinkingpracticesinmiddleagedandolderrussians‏ ‎‡A Gender differences in drinking practices in middle aged and older Russians‏ ‎‡9 1‏
919 ‎‡a generalpractitionersviewsonandreferraltonhssmokingcessationservices‏ ‎‡A General practitioners' views on and referral to NHS smoking cessation services‏ ‎‡9 1‏
919 ‎‡a germanmedicalstudentslackknowledgeofhowtotreatsmokingandproblemdrinking‏ ‎‡A German medical students lack knowledge of how to treat smoking and problem drinking‏ ‎‡9 1‏
919 ‎‡a globalstatisticsonalcoholtobaccoandillicitdruguse2017statusreport‏ ‎‡A Global statistics on alcohol, tobacco and illicit drug use: 2017 status report‏ ‎‡9 1‏
919 ‎‡a howcosteffectiveisnosmokingday‏ ‎‡A How cost-effective is 'No Smoking Day'?‏ ‎‡9 1‏
919 ‎‡a hypertensionanditsidentificationamongcurrentpastandneversmokersinanenglishpopulationsample‏ ‎‡A Hypertension and its identification among current, past and never smokers in an English population sample‏ ‎‡9 1‏
919 ‎‡a identifyingevidencebasedcompetencesrequiredtodeliverbehaviouralsupportforsmokingcessation‏ ‎‡A Identifying Evidence-Based Competences Required to Deliver Behavioural Support for Smoking Cessation‏ ‎‡9 1‏
919 ‎‡a increaseincommoncoldsymptomsandmouthulcersfollowingsmokingcessation‏ ‎‡A Increase in common cold symptoms and mouth ulcers following smoking cessation.‏ ‎‡9 1‏
919 ‎‡a insideaddictionpeeringintotheeditorialreviewprocess‏ ‎‡A Inside Addiction: peering into the editorial review process‏ ‎‡9 1‏
919 ‎‡a interestinnicotinereplacementtherapyamongpregnantsmokers‏ ‎‡A Interest in nicotine replacement therapy among pregnant smokers.‏ ‎‡9 1‏
919 ‎‡a introducingaddictionlives‏ ‎‡A Introducing Addiction Lives‏ ‎‡9 1‏
919 ‎‡a ishardcoresmokerausefultermintobaccocontrol‏ ‎‡A Is 'hardcore smoker' a useful term in tobacco control?‏ ‎‡9 1‏
919 ‎‡a isthe10itemquestionnaireofsmokingurges‏ ‎‡A Is the ten-item Questionnaire of Smoking Urges‏ ‎‡9 1‏
919 ‎‡a isthe10itemquestionnaireofsmokingurgesqsubriefmoresensitivetoabstinencethanshortercravingmeasures‏ ‎‡A Is the ten-item Questionnaire of Smoking Urges (QSU-brief) more sensitive to abstinence than shorter craving measures?‏ ‎‡9 1‏
919 ‎‡a istheukscoalitiongovernmentseriousaboutpublichealth‏ ‎‡A Is the UK's coalition Government serious about public health?‏ ‎‡9 1‏
919 ‎‡a itisprematuretoexpandaccesstomedicinalcannabisinhopesofsolvingtheusopioidcrisis‏ ‎‡A It is premature to expand access to medicinal cannabis in hopes of solving the US opioid crisis.‏ ‎‡9 1‏
919 ‎‡a lessonslearnedfromunsuccessfuluseofusingpersonalcarbonmonoxidemonitorstoremotelyassessabstinenceinapragmatictrialofasmartphonestopsmokingappasecondaryanalysis‏ ‎‡A Lessons learned from unsuccessful use of using personal carbon monoxide monitors to remotely assess abstinence in a pragmatic trial of a smartphone stop smoking app – A secondary analysis‏ ‎‡9 1‏
919 ‎‡a levelsoftoxinsinoraltobaccoproductsintheuk‏ ‎‡A Levels of toxins in oral tobacco products in the UK.‏ ‎‡9 1‏
919 ‎‡a lossofacutenicotinetoleranceandseverityofcigarettewithdrawal‏ ‎‡A Loss of acute nicotine tolerance and severity of cigarette withdrawal‏ ‎‡9 1‏
919 ‎‡a mitigatingandlearningfromtheimpactofcovid19infectiononaddictivedisorders‏ ‎‡A Mitigating and learning from the impact of COVID-19 infection on addictive disorders‏ ‎‡9 1‏
919 ‎‡a modellingcontinuousabstinenceratesovertimefromclinicaltrialsofpharmacologicalinterventionsforsmokingcessation‏ ‎‡A Modelling continuous abstinence rates over time from clinical trials of pharmacological interventions for smoking cessation‏ ‎‡9 1‏
919 ‎‡a modellingtheeffectofminororthopaedicdaysurgeryonpatientmoodattheearlypostoperativeperiodaprospectivepopulationbasedcohortstudy‏ ‎‡A Modelling the effect of minor orthopaedic day surgery on patient mood at the early post-operative period: a prospective population-based cohort study‏ ‎‡9 1‏
919 ‎‡a modelyzavislosti‏ ‎‡A Modely závislosti‏ ‎‡9 1‏
919 ‎‡a moderatorsofrealworldeffectivenessofsmokingcessationaidsapopulationstudy‏ ‎‡A Moderators of real-world effectiveness of smoking cessation aids: a population study‏ ‎‡9 1‏
919 ‎‡a motivationtoreducealcoholconsumptionandsubsequentattemptsatreductionandchangesinconsumptioninincreasingandhigherriskdrinkersinenglandaprospectivepopulationsurvey‏ ‎‡A Motivation to reduce alcohol consumption and subsequent attempts at reduction and changes in consumption in increasing and higher-risk drinkers in England: a prospective population survey‏ ‎‡9 1‏
919 ‎‡a multiplesubstancedependenceimplicationsfortreatmentofnicotinedependence‏ ‎‡A Multiple substance dependence: implications for treatment of nicotine dependence.‏ ‎‡9 1‏
919 ‎‡a newlyavailabletreatmentsfornicotineaddictionsmokerswantinghelpwithstoppingnowhaveeffectivetreatmentoptions‏ ‎‡A Newly available treatments for nicotine addiction. Smokers wanting help with stopping now have effective treatment options‏ ‎‡9 1‏
919 ‎‡a nicotineaddictionareanalysisofthearguments‏ ‎‡A Nicotine addiction: a re-analysis of the arguments.‏ ‎‡9 1‏
919 ‎‡a nicotineintakeincigarettesmokersinenglanddistributionanddemographiccorrelates‏ ‎‡A Nicotine intake in cigarette smokers in England: distribution and demographic correlates‏ ‎‡9 1‏
919 ‎‡a nicotineintakeinyoungsmokerslongitudinalstudyofsalivacotinineconcentrations‏ ‎‡A Nicotine intake in young smokers: longitudinal study of saliva cotinine concentrations.‏ ‎‡9 1‏
919 ‎‡a ontologiesrelevanttobehaviourchangeinterventionsamethodfortheirdevelopment‏ ‎‡A Ontologies relevant to behaviour change interventions: a method for their development‏ ‎‡9 1‏
919 ‎‡a paymentbyresultsandsmokingcessationsupport‏ ‎‡A 'Payment by results' and smoking cessation support.‏ ‎‡9 1‏
919 ‎‡a perceivedbarrierstoandbenefitsofattendingastopsmokingcourseduringpregnancy‏ ‎‡A Perceived barriers to and benefits of attending a stop smoking course during pregnancy.‏ ‎‡9 1‏
919 ‎‡a populationlevelpredictorsofchangesinsuccessratesofsmokingquitattemptsinenglandatimeseriesanalysis‏ ‎‡A Population-level predictors of changes in success rates of smoking quit attempts in England: a time series analysis‏ ‎‡9 1‏
919 ‎‡a predictorsof3monthabstinenceinsmokersattendingstopsmokingclinicsinmalaysia‏ ‎‡A Predictors of 3-month abstinence in smokers attending stop-smoking clinics in Malaysia‏ ‎‡9 1‏
919 ‎‡a predictorsofengagementresponsetofollowupandextentofalcoholreductioninusersofasmartphoneappdrinklesspreprint‏ ‎‡A Predictors of engagement, response to follow-up and extent of alcohol reduction in users of a smartphone app (Drink Less) (Preprint)‏ ‎‡9 1‏
919 ‎‡a preferencesforscalestructureinmelodicsequences‏ ‎‡A Preferences for scale structure in melodic sequences‏ ‎‡9 1‏
919 ‎‡a prevalencediagnosisandrelationtotobaccodependenceofchronicobstructivepulmonarydiseaseinanationallyrepresentativepopulationsample‏ ‎‡A Prevalence, diagnosis and relation to tobacco dependence of chronic obstructive pulmonary disease in a nationally representative population sample.‏ ‎‡9 1‏
919 ‎‡a preventingtobaccocompaniesfromadvertisingusingtheirpackagingcouldbeanimportantcomponentofcomprehensivetobaccocontrolacommentaryonaustraliasplainpackagingofcigarettes‏ ‎‡A Preventing tobacco companies from advertising using their packaging could be an important component of comprehensive tobacco control: a commentary on Australia's plain packaging of cigarettes‏ ‎‡9 1‏
919 ‎‡a providingfullmanualsandinterventiondescriptionsaddictionpolicy‏ ‎‡A Providing full manuals and intervention descriptions: Addiction policy.‏ ‎‡9 1‏
919 ‎‡a psychologyandpharmacologyincigarettewithdrawal‏ ‎‡A Psychology and pharmacology in cigarette withdrawal.‏ ‎‡9 1‏
919 ‎‡a publicsupportinenglandforraisingthepriceofcigarettestofundtobaccocontrolactivities‏ ‎‡A Public support in England for raising the price of cigarettes to fund tobacco control activities‏ ‎‡9 1‏
919 ‎‡a publishercorrectionasmartphoneapptoreduceexcessivealcoholconsumptionidentifyingtheeffectivenessofinterventioncomponentsinafactorialrandomisedcontroltrial‏ ‎‡A Publisher Correction: A smartphone app to reduce excessive alcohol consumption: Identifying the effectiveness of intervention components in a factorial randomised control trial.‏ ‎‡9 1‏
919 ‎‡a randomisedcontrolledtrialofondansetroninsmokingcessation‏ ‎‡A Randomised controlled trial of ondansetron in smoking cessation‏ ‎‡9 1‏
919 ‎‡a randomizedcomparativetrialofnicotinepolacrilexatransdermalpatchnasalsprayandaninhaler‏ ‎‡A Randomized Comparative Trial of Nicotine Polacrilex, a Transdermal Patch, Nasal Spray, and an Inhaler‏ ‎‡9 1‏
919 ‎‡a randomizedcontrolledtrialofasocialsupportbuddyinterventionforsmokingcessation‏ ‎‡A Randomized controlled trial of a social support ('buddy') intervention for smoking cessation‏ ‎‡9 1‏
919 ‎‡a randomizedcontrolledtrialofphysicalactivitycounselingasanaidtosmokingcessation12monthfollowup‏ ‎‡A Randomized controlled trial of physical activity counseling as an aid to smoking cessation: 12 month follow-up.‏ ‎‡9 1‏
919 ‎‡a rapidreductionversusabruptquittingforsmokerswhowanttostopsoonarandomisedcontrollednoninferioritytrial‏ ‎‡A Rapid reduction versus abrupt quitting for smokers who want to stop soon: a randomised controlled non-inferiority trial‏ ‎‡9 1‏
919 ‎‡a rctofaclientcentredcaseworkerdeliveredsmokingcessationinterventionforasociallydisadvantagedpopulation‏ ‎‡A RCT of a client-centred, caseworker-delivered smoking cessation intervention for a socially disadvantaged population‏ ‎‡9 1‏
919 ‎‡a recommendationfortheassessmentoftobaccocravingandwithdrawalinsmokingcessationtrials‏ ‎‡A Recommendation for the assessment of tobacco craving and withdrawal in smoking cessation trials.‏ ‎‡9 1‏
919 ‎‡a reducingsarscov2transmissionintheukabehaviouralscienceapproachtoidentifyingoptionsforincreasingadherencetosocialdistancingandshieldingvulnerablepeople‏ ‎‡A Reducing SARS-CoV-2 transmission in the UK: A behavioural science approach to identifying options for increasing adherence to social distancing and shielding vulnerable people‏ ‎‡9 1‏
919 ‎‡a reductionincortisolaftersmokingcessationamongusersofnicotinepatches‏ ‎‡A Reduction in Cortisol After Smoking Cessation Among Users of Nicotine Patches‏ ‎‡9 1‏
919 ‎‡a reflectionsonaddictionresearchcentresandthenurturingofcreativity‏ ‎‡A Reflections on Addiction Research Centres and the Nurturing of Creativity.‏ ‎‡9 1‏
919 ‎‡a regularsmokerslifetimeverylightsmokersandreducedsmokerscomparisonofpsychosocialandsmokingcharacteristicsinwomen‏ ‎‡A Regular smokers, lifetime very light smokers, and reduced smokers: Comparison of psychosocial and smoking characteristics in women‏ ‎‡9 1‏
919 ‎‡a relapsepreventioninterventionsforsmokingcessation‏ ‎‡A Relapse prevention interventions for smoking cessation‏ ‎‡9 1‏
919 ‎‡a relativeeffectivenessofafullversusreducedversionofthesmokefreemobileapplicationforsmokingcessationarandomisedcontrolledtrial‏ ‎‡A Relative effectiveness of a full versus reduced version of the ‘Smoke Free’ mobile application for smoking cessation: a randomised controlled trial‏ ‎‡9 1‏
919 ‎‡a relativeeffectivenessofafullversusreducedversionofthesmokefreemobileapplicationforsmokingcessationanexploratoryrandomisedcontrolledtrial‏ ‎‡A Relative effectiveness of a full versus reduced version of the 'Smoke Free' mobile application for smoking cessation: an exploratory randomised controlled trial‏ ‎‡9 1‏
919 ‎‡a replytosmokefreebutdependentonnicotinekaramhage‏ ‎‡A Reply to 'Smoke free, but dependent on nicotine' (Karam-Hage 2019)‏ ‎‡9 1‏
919 ‎‡a representationofbehaviourchangeinterventionsandtheirevaluationdevelopmentoftheupperlevelofthebehaviourchangeinterventionontology‏ ‎‡A Representation of behaviour change interventions and their evaluation: Development of the Upper Level of the Behaviour Change Intervention Ontology‏ ‎‡9 1‏
919 ‎‡a roiinpublichealthpolicysupportingdecisionmakingsubhashpokhrellesleyowenkathryncoyleanddougcoyleswitzerlandpalgravemacmillan2018isbn9783319688978‏ ‎‡A ROI in Public Health Policy: Supporting Decision MakingSubhash Pokhrel, Lesley Owen, Kathryn Coyle & Doug Coyle Switzerland: Palgrave Macmillan, 2018 ISBN: 978-3-319-68897-8‏ ‎‡9 1‏
919 ‎‡a roleofformalinstructionandinformalpracticeinlearningtodrive‏ ‎‡A Role of formal instruction and informal practice in learning to drive.‏ ‎‡9 1‏
919 ‎‡a sshapedcurvemodellingtrendsinsmokingprevalenceuptakeandcessationingreatbritainfrom1973to‏ ‎‡A 'S'-shaped curve: modelling trends in smoking prevalence, uptake and cessation in Great Britain from 1973 to 2016‏ ‎‡9 1‏
919 ‎‡a selfreportedpracticesattitudesandlevelsoftrainingofpractitionersintheenglishnhsstopsmokingservices‏ ‎‡A Self-reported practices, attitudes and levels of training of practitioners in the English NHS Stop Smoking Services.‏ ‎‡9 1‏
919 ‎‡a shouldsmokersbeofferedassistancewithstopping‏ ‎‡A Should smokers be offered assistance with stopping?‏ ‎‡9 1‏
919 ‎‡a significanteffectsapersonalperspectiveonhowhealthpsychologistscaninfluencepolicyandpractice‏ ‎‡A Significant effects: A personal perspective on how health psychologists can influence policy and practice‏ ‎‡9 1‏
919 ‎‡a smokelesstobaccocessationguidelinesforhealthprofessionalsinengland‏ ‎‡A Smokeless tobacco cessation guidelines for health professionals in England.‏ ‎‡9 1‏
919 ‎‡a smokingcessationguidelinesforhealthprofessionalsanupdatehealtheducationauthority‏ ‎‡A Smoking cessation guidelines for health professionals: an update. Health Education Authority‏ ‎‡9 1‏
919 ‎‡a smokingintentionsandmoodprecedinglapseaftercompletionoftreatmenttoaidsmokingcessation‏ ‎‡A Smoking intentions and mood preceding lapse after completion of treatment to aid smoking cessation‏ ‎‡9 1‏
919 ‎‡a smokingstatusofstepparentsasariskfactorforsmokinginadolescence‏ ‎‡A Smoking status of step-parents as a risk factor for smoking in adolescence.‏ ‎‡9 1‏
919 ‎‡a specifyingwhodeliversbehaviourchangeinterventionsdevelopmentofaninterventionsourceontology‏ ‎‡A Specifying who delivers behaviour change interventions: development of an Intervention Source Ontology‏ ‎‡9 1‏
919 ‎‡a stopsmokingclinicsinmalaysiacharacteristicsofattendeesandpredictorsofsuccess‏ ‎‡A Stop smoking clinics in Malaysia: characteristics of attendees and predictors of success‏ ‎‡9 1‏
919 ‎‡a strengthofurgestosmokeasameasureofseverityofcigarettedependencecomparisonwiththefagerstromtestfornicotinedependenceanditscomponents‏ ‎‡A Strength of urges to smoke as a measure of severity of cigarette dependence: comparison with the Fagerström Test for Nicotine Dependence and its components.‏ ‎‡9 1‏
919 ‎‡a subjectiveeffectsofcigarettesmokinginadolescents‏ ‎‡A Subjective effects of cigarette smoking in adolescents‏ ‎‡9 1‏
919 ‎‡a sustainedbehaviorchangeiskeytopreventingandtacklingfuturepandemics‏ ‎‡A Sustained behavior change is key to preventing and tackling future pandemics‏ ‎‡9 1‏
919 ‎‡a symptomattributionandtherecognitionofpsychiatricmorbidity‏ ‎‡A Symptom attribution and the recognition of psychiatric morbidity‏ ‎‡9 1‏
919 ‎‡a testforassessingtarnicotineyields‏ ‎‡A Test for assessing tar/nicotine yields‏ ‎‡9 1‏
919 ‎‡a attitudeofmaternitystafftoandsmokingcessationinterventionswithchildbearingwomeninlondon‏ ‎‡A The attitude of maternity staff to, and smoking cessation interventions with, childbearing women in London‏ ‎‡9 1‏
919 ‎‡a behaviourchangetechniqueontologytransformingthebehaviourchangetechniquetaxonomyv1‏ ‎‡A The Behaviour Change Technique Ontology: Transforming the Behaviour Change Technique Taxonomy v1‏ ‎‡9 1‏
919 ‎‡a behaviourchangewheelanewmethodforcharacterisinganddesigningbehaviourchangeinterventions‏ ‎‡A The behaviour change wheel: a new method for characterising and designing behaviour change interventions‏ ‎‡9 1‏
919 ‎‡a casefordevelopmentofanecigaretteontologyecigotoimprovequalityefficiencyandclarityintheconductandinterpretationofresearch‏ ‎‡A The case for development of an E-cigarette Ontology (E-CigO) to improve quality, efficiency and clarity in the conduct and interpretation of research‏ ‎‡9 1‏
919 ‎‡a clinicalsignificanceofsmalleffectsofsmokingcessationtreatments‏ ‎‡A The clinical significance of "small" effects of smoking cessation treatments.‏ ‎‡9 1‏
919 ‎‡a detectionofnotesincompatiblewithscalarstructure‏ ‎‡A The detection of notes incompatible with scalar structure‏ ‎‡9 1‏
919 ‎‡a effectofdurationofbreathholdingonexpiredaircarbonmonoxideconcentrationincigarettesmokers‏ ‎‡A The effect of duration of breath-holding on expired air carbon monoxide concentration in cigarette smokers‏ ‎‡9 1‏
919 ‎‡a futureofnicotinereplacementinsmokingcessation‏ ‎‡A The future of nicotine replacement in smoking cessation?‏ ‎‡9 1‏
919 ‎‡a impactofchangingnicotinereplacementtherapylicensinglawsintheunitedkingdomfindingsfromtheinternationaltobaccocontrol4countrysurvey‏ ‎‡A The impact of changing nicotine replacement therapy licensing laws in the United Kingdom: findings from the International Tobacco Control Four Country Survey.‏ ‎‡9 1‏
919 ‎‡a needformoreconsistentevidentialstandardsincannabispolicyevaluations‏ ‎‡A The need for more consistent evidential standards in cannabis policy evaluations‏ ‎‡9 1‏
919 ‎‡a roleofpersonalityandattitudesintrafficaccidentrisk‏ ‎‡A The Role of Personality and Attitudes in Traffic Accident Risk‏ ‎‡9 1‏
919 ‎‡a smokingtoolkitstudyanationalstudyofsmokingandsmokingcessationinengland‏ ‎‡A 'The smoking toolkit study': a national study of smoking and smoking cessation in England‏ ‎‡9 1‏
919 ‎‡a uknationalinstituteforhealthandclinicalexcellencepublichealthguidanceonbehaviourchangeabriefintroduction‏ ‎‡A The UK national institute for health and clinical excellence public health guidance on behaviour change: A brief introduction‏ ‎‡9 1‏
919 ‎‡a useofheartrateasamarkerfortoleranceinstudieswithsmokers‏ ‎‡A The use of heart rate as a marker for tolerance in studies with smokers‏ ‎‡9 1‏
919 ‎‡a useofnicotinereplacementtherapyforsmokingreductionandtemporaryabstinenceaninterviewstudy‏ ‎‡A The Use of Nicotine Replacement Therapy for Smoking Reduction and Temporary Abstinence: An Interview Study‏ ‎‡9 1‏
919 ‎‡a useofvideostoinformsmokersaboutdifferentnicotinereplacementproducts‏ ‎‡A The use of videos to inform smokers about different nicotine replacement products.‏ ‎‡9 1‏
919 ‎‡a timecourseofcigarettewithdrawalsymptomsduring4weeksoftreatmentwithnicotinechewinggum‏ ‎‡A Time course of cigarette withdrawal symptoms during four weeks of treatment with nicotine chewing gum‏ ‎‡9 1‏
919 ‎‡a timeforachangeputtingthetranstheoretical‏ ‎‡A Time for a change: putting the Transtheoretical‏ ‎‡9 1‏
919 ‎‡a timeforachangeputtingthetranstheoreticalstagesofchangemodeltorest‏ ‎‡A Time for a change: putting the Transtheoretical (Stages of Change) Model to rest.‏ ‎‡9 1‏
919 ‎‡a tobaccouseanddementiaevidencefromthe1066dementiapopulationbasedsurveysinlatinamericachinaandindia‏ ‎‡A Tobacco use and dementia: evidence from the 1066 dementia population-based surveys in Latin America, China and India.‏ ‎‡9 1‏
919 ‎‡a transitiontowardsanonsmokeridentityfollowingsmokingcessationaninterpretativephenomenologicalanalysis‏ ‎‡A Transition towards a 'non-smoker' identity following smoking cessation: an interpretative phenomenological analysis‏ ‎‡9 1‏
919 ‎‡a triggeringantismokingadvicebygpsmodeofactionofaninterventionstimulatingsmokingcessationadvicebygps‏ ‎‡A Triggering anti-smoking advice by GPs: mode of action of an intervention stimulating smoking cessation advice by GPs.‏ ‎‡9 1‏
919 ‎‡a underreportingoftheactivecontentofbehaviouralinterventionsasystematicreviewandmetaanalysisofrandomisedtrialsofsmokingcessationinterventions‏ ‎‡A Underreporting of the active content of behavioural interventions: a systematic review and meta-analysis of randomised trials of smoking cessation interventions‏ ‎‡9 1‏
919 ‎‡a understandingandusingtimeseriesanalysesinaddictionresearch‏ ‎‡A Understanding and using time series analyses in addiction research‏ ‎‡9 1‏
919 ‎‡a updatingtheevidenceontheeffectivenessofthealcoholreductionappdrinklessusingbayesfactorstoanalysetrialdatasetssupplementedwithextendedrecruitment‏ ‎‡A Updating the evidence on the effectiveness of the alcohol reduction app, Drink Less: using Bayes factors to analyse trial datasets supplemented with extended recruitment‏ ‎‡9 1‏
919 ‎‡a urinaryadrenalineconcentrationsduring10daysofsmokingabstinence‏ ‎‡A Urinary adrenaline concentrations during 10 days of smoking abstinence‏ ‎‡9 1‏
919 ‎‡a useofnicotinereplacementtherapyforsmokingreductionandduringenforcedtemporaryabstinenceanationalsurveyofenglishsmokers‏ ‎‡A Use of nicotine replacement therapy for smoking reduction and during enforced temporary abstinence: a national survey of English smokers.‏ ‎‡9 1‏
919 ‎‡a variabilityandeffectivenessofcomparatorgroupinterventionsinsmokingcessationtrialsasystematicreviewandmetaanalysis‏ ‎‡A Variability and effectiveness of comparator group interventions in smoking cessation trials: a systematic review and meta-analysis‏ ‎‡9 1‏
919 ‎‡a whatisthepurposeofdiagnosingaddictionordependenceandwhatdoesthismeanforestablishingdiagnosticcriteria‏ ‎‡A What is the purpose of diagnosing addiction or dependence and what does this mean for establishing diagnostic criteria?‏ ‎‡9 1‏
919 ‎‡a whatlessonscanbelearnedfromtobaccocontrolforcombatingthegrowingprevalenceofobesity‏ ‎‡A What lessons can be learned from tobacco control for combating the growing prevalence of obesity?‏ ‎‡9 1‏
919 ‎‡a whatmakesforaneffectivestopsmokingservice‏ ‎‡A What makes for an effective stop-smoking service?‏ ‎‡9 1‏
919 ‎‡a whatmediatestheeffectofconfrontationalcounsellingonsmokingcessationinsmokerswithcopd‏ ‎‡A What mediates the effect of confrontational counselling on smoking cessation in smokers with COPD?‏ ‎‡9 1‏
919 ‎‡a whatroledoesdopaminereallyplayintobaccoaddiction‏ ‎‡A What role does dopamine really play in tobacco addiction?‏ ‎‡9 1‏
919 ‎‡a whycombatingtobaccosmugglingisapriority‏ ‎‡A Why combating tobacco smuggling is a priority‏ ‎‡9 1‏
919 ‎‡a effectofbuspironeoncigarettewithdrawalsymptomsandshorttermabstinenceratesinasmokersclinic‏ ‎‡A Effect of buspirone on cigarette withdrawal symptoms and short-term abstinence rates in a smokers clinic‏ ‎‡9 1‏
919 ‎‡a effectofcigarettesonmemorysearchandsubjectiveratings‏ ‎‡A Effect of cigarettes on memory search and subjective ratings.‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2017‏ ‎‡9 4‏
946 ‎‡a b‏ ‎‡9 1‏
947 ‎‡a GB‏ ‎‡9 1‏
996 ‎‡2 DNB|1333964633‏
996 ‎‡2 ISNI|000000006882295X‏
996 ‎‡2 ISNI|0000000384694873‏
996 ‎‡2 NII|DA03266139‏
996 ‎‡2 LC|n 2022039975‏
996 ‎‡2 DNB|1162207116‏
996 ‎‡2 ISNI|0000000027450571‏
996 ‎‡2 J9U|987007364343305171‏
996 ‎‡2 NII|DA02650051‏
996 ‎‡2 CAOONL|ncf12140860‏
996 ‎‡2 RERO|A011707294‏
996 ‎‡2 LC|n 86025172‏
996 ‎‡2 DNB|137768176‏
996 ‎‡2 BIBSYS|90968605‏
996 ‎‡2 SUDOC|08330987X‏
996 ‎‡2 NII|DA18712260‏
996 ‎‡2 LC|nb2011009300‏
996 ‎‡2 NTA|321135857‏
996 ‎‡2 LC|n 2019058626‏
996 ‎‡2 LC|no2020106293‏
996 ‎‡2 ISNI|000000004179758X‏
996 ‎‡2 LC|n 96024337‏
996 ‎‡2 BNF|12298476‏
996 ‎‡2 ISNI|0000000066728708‏
996 ‎‡2 DNB|104258964X‏
996 ‎‡2 NII|DA0819521X‏
996 ‎‡2 RERO|A022797119‏
996 ‎‡2 SUDOC|159341612‏
996 ‎‡2 LC|n 79030071‏
996 ‎‡2 SIMACOB|31366243‏
996 ‎‡2 ISNI|0000000067100314‏
996 ‎‡2 BIBSYS|6052501‏
996 ‎‡2 ISNI|0000000409846715‏
996 ‎‡2 BIBSYS|90520383‏
996 ‎‡2 PLWABN|9810680974005606‏
996 ‎‡2 BAV|495_181303‏
996 ‎‡2 RERO|A003969517‏
996 ‎‡2 BIBSYS|90290955‏
996 ‎‡2 LC|no 96062754‏
996 ‎‡2 ISNI|0000000033489157‏
996 ‎‡2 LC|n 85342849‏
996 ‎‡2 NII|DA01790452‏
996 ‎‡2 BNE|XX5425238‏
996 ‎‡2 LNB|LNC10-000022717‏
996 ‎‡2 BIBSYS|6044817‏
996 ‎‡2 SUDOC|158147987‏
996 ‎‡2 LC|n 84028546‏
996 ‎‡2 ISNI|0000000051471604‏
996 ‎‡2 LC|no2010082955‏
996 ‎‡2 LC|no2018109415‏
996 ‎‡2 ISNI|0000000035230771‏
996 ‎‡2 NII|DA01041513‏
996 ‎‡2 BIBSYS|90792449‏
996 ‎‡2 ISNI|0000000038213088‏
996 ‎‡2 SUDOC|22350386X‏
996 ‎‡2 ICCU|SBLV303003‏
996 ‎‡2 LC|n 93804870‏
996 ‎‡2 ISNI|0000000049282652‏
996 ‎‡2 LC|nb2004009598‏
996 ‎‡2 LC|n 90690234‏
996 ‎‡2 J9U|987007364097205171‏
996 ‎‡2 CAOONL|ncf10061062‏
996 ‎‡2 LC|n 95102306‏
996 ‎‡2 LC|n 2003032481‏
996 ‎‡2 LC|n 87832311‏
996 ‎‡2 LC|n 80036220‏
996 ‎‡2 LC|n 83050680‏
996 ‎‡2 ISNI|0000000028292616‏
996 ‎‡2 PTBNP|544551‏
996 ‎‡2 DNB|1079145435‏
996 ‎‡2 NTA|06806263X‏
996 ‎‡2 ISNI|0000000070028472‏
996 ‎‡2 NTA|129743941‏
996 ‎‡2 ISNI|0000000034417200‏
996 ‎‡2 PTBNP|970529‏
996 ‎‡2 NII|DA02130211‏
996 ‎‡2 SUDOC|080806546‏
996 ‎‡2 W2Z|90256820‏
996 ‎‡2 N6I|vtls002049138‏
996 ‎‡2 ISNI|0000000036741207‏
996 ‎‡2 DNB|1124808558‏
996 ‎‡2 ISNI|0000000076677617‏
996 ‎‡2 ISNI|0000000425491950‏
996 ‎‡2 BIBSYS|8066761‏
996 ‎‡2 BIBSYS|98014710‏
996 ‎‡2 LC|n 2004113510‏
996 ‎‡2 SUDOC|229398863‏
996 ‎‡2 DNB|103799731X‏
996 ‎‡2 LC|n 2014182636‏
996 ‎‡2 ISNI|0000000067577702‏
996 ‎‡2 BIBSYS|90847105‏
996 ‎‡2 LC|nr 89014957‏
996 ‎‡2 LC|n 83015328‏
996 ‎‡2 SUDOC|139810714‏
996 ‎‡2 CAOONL|ncf11177914‏
996 ‎‡2 J9U|987007318638905171‏
996 ‎‡2 DNB|171257391‏
996 ‎‡2 NII|DA06059210‏
996 ‎‡2 LC|n 2011046132‏
996 ‎‡2 LC|n 84212251‏
996 ‎‡2 NTA|238534502‏
996 ‎‡2 J9U|987007426622605171‏
996 ‎‡2 BLBNB|000567085‏
996 ‎‡2 NSK|000345770‏
996 ‎‡2 CAOONL|ncf11296016‏
996 ‎‡2 ISNI|0000000389220220‏
996 ‎‡2 NTA|333862198‏
996 ‎‡2 SUDOC|268865213‏
996 ‎‡2 N6I|vtls000091862‏
996 ‎‡2 NUKAT|n 2017027616‏
996 ‎‡2 LC|n 87873313‏
996 ‎‡2 LIH|LNB:DPA_b_;=BN‏
996 ‎‡2 LC|no2021041027‏
996 ‎‡2 BNF|15070198‏
996 ‎‡2 NKC|mub2012715351‏
996 ‎‡2 ISNI|0000000067470702‏
996 ‎‡2 LC|no2018162926‏
996 ‎‡2 NUKAT|n 2014125234‏
996 ‎‡2 RERO|A003969519‏
996 ‎‡2 J9U|987007386735705171‏
996 ‎‡2 RERO|A023977018‏
996 ‎‡2 ISNI|0000000058055267‏
996 ‎‡2 LC|n 79022777‏
996 ‎‡2 N6I|vtls002240946‏
996 ‎‡2 BAV|495_272747‏
996 ‎‡2 LC|no2006054191‏
996 ‎‡2 BAV|495_272748‏
996 ‎‡2 SUDOC|164623299‏
996 ‎‡2 NLA|000035278527‏
996 ‎‡2 SUDOC|031845037‏
996 ‎‡2 LC|no 95028335‏
996 ‎‡2 ISNI|0000000024295721‏
996 ‎‡2 NUKAT|n 2022131223‏
996 ‎‡2 ISNI|000000011084140X‏
996 ‎‡2 PLWABN|9813272694105606‏
996 ‎‡2 CAOONL|ncf10011643‏
996 ‎‡2 NII|DA05522761‏
996 ‎‡2 ISNI|0000000043212987‏
996 ‎‡2 LC|n 85198921‏
996 ‎‡2 BNF|17025807‏
996 ‎‡2 LC|n 50004492‏
996 ‎‡2 J9U|987007378711805171‏
996 ‎‡2 LC|n 88001714‏
996 ‎‡2 SUDOC|251289303‏
996 ‎‡2 SUDOC|135982634‏
996 ‎‡2 LC|no2003112072‏
996 ‎‡2 DNB|137578261‏
996 ‎‡2 LC|n 90665304‏
996 ‎‡2 BNE|XX5334342‏
996 ‎‡2 LC|n 85259268‏
996 ‎‡2 LC|no2009033854‏
996 ‎‡2 ISNI|0000000508156154‏
996 ‎‡2 ISNI|0000000031246530‏
996 ‎‡2 RERO|A011557004‏
996 ‎‡2 NII|DA03314832‏
996 ‎‡2 BIBSYS|90175254‏
996 ‎‡2 J9U|987007433198105171‏
996 ‎‡2 LC|n 88200857‏
996 ‎‡2 RERO|A006218935‏
996 ‎‡2 ISNI|0000000074636758‏
996 ‎‡2 LC|nb 98082987‏
996 ‎‡2 NII|DA04157015‏
996 ‎‡2 J9U|987007288678405171‏
996 ‎‡2 ISNI|0000000035684837‏
996 ‎‡2 BIBSYS|90572942‏
996 ‎‡2 NKC|mzk2010590025‏
996 ‎‡2 ISNI|0000000083152982‏
996 ‎‡2 PLWABN|9810583152305606‏
996 ‎‡2 RERO|A005661575‏
996 ‎‡2 BNF|12276777‏
996 ‎‡2 NTA|147825512‏
996 ‎‡2 ISNI|0000000027626426‏
997 ‎‡a 1955 0 lived 0608 0‏ ‎‡9 1‏
998 ‎‡a West, Robert‏ ‎‡2 NUKAT|n 2006130887‏ ‎‡3 suggested‏ ‎‡3 title: (0.71, 'smokingcessation', 'relapsepreventioninterventionsforsmokingcessation')‏ ‎‡3 viafid‏
998 ‎‡a West, Robert‏ ‎‡2 DNB|1046386891‏ ‎‡3 suggested‏ ‎‡3 standard number‏
998 ‎‡a West, Robert‏ ‎‡2 BNE|XX5425238‏ ‎‡3 suggested‏
998 ‎‡a West, Robert‏ ‎‡2 PLWABN|9812466947005606‏ ‎‡3 partial date, partial title‏ ‎‡3 viafid‏
998 ‎‡a West, Robert‏ ‎‡2 W2Z|90256820‏ ‎‡3 viafid‏
998 ‎‡a West‏ ‎‡b Robert‏ ‎‡2 BNF|15070198‏ ‎‡3 suggested‏
998 ‎‡a West, Robert‏ ‎‡2 ISNI|000000011084140X‏ ‎‡3 suggested‏
998 ‎‡a Robert West‏ ‎‡2 ISNI|000000011084140X‏ ‎‡3 suggested‏
998 ‎‡a West, Robert‏ ‎‡2 ISNI|000000011084140X‏ ‎‡3 suggested‏
998 ‎‡a West, Robert‏ ‎‡2 ISNI|000000011084140X‏ ‎‡3 suggested‏
998 ‎‡a West, Robert‏ ‎‡2 NII|DA04157015‏ ‎‡3 suggested‏
998 ‎‡a West, Robert,‏ ‎‡2 NTA|306075571‏ ‎‡3 title: (0.71, 'smokingcessation', 'relapsepreventioninterventionsforsmokingcessation')‏ ‎‡3 suggested‏
998 ‎‡a West, Robert,‏ ‎‡2 NKC|mub2014825215‏ ‎‡3 suggested‏ ‎‡3 standard number‏
998 ‎‡a West, Robert‏ ‎‡2 SUDOC|127476164‏ ‎‡3 suggested‏ ‎‡3 title: (0.72, 'behaviourchangewheelaguidetodesigninginterventions', 'behaviourchangewheelanewmethodforcharacterisinganddesigningbehaviourchangeinterventions')‏
998 ‎‡a West, Robert‏ ‎‡2 RERO|A003969516‏ ‎‡3 title: (0.72, 'behaviourchangewheelaguidetodesigninginterventions', 'behaviourchangewheelanewmethodforcharacterisinganddesigningbehaviourchangeinterventions')‏
998 ‎‡a West, Robert,‏ ‎‡2 LNB|LNC10-000186858‏ ‎‡3 suggested‏ ‎‡3 title: (0.72, 'behaviourchangewheelaguidetodesigninginterventions', 'behaviourchangewheelanewmethodforcharacterisinganddesigningbehaviourchangeinterventions')‏
998 ‎‡a West, Robert‏ ‎‡2 BIBSYS|90256820‏ ‎‡3 suggested‏ ‎‡3 viafid‏ ‎‡3 title: (0.72, 'behaviourchangewheelaguidetodesigninginterventions', 'behaviourchangewheelanewmethodforcharacterisinganddesigningbehaviourchangeinterventions')‏
998 ‎‡a West, Robert,‏ ‎‡2 LC|n 90690234‏ ‎‡3 suggested‏
998 ‎‡a West, Robert,‏ ‎‡2 J9U|987007426622605171‏ ‎‡3 suggested‏