VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q46664008 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010718.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q46664008‏
024 ‎‡a 0000-0002-9815-8636‏ ‎‡2 orcid‏
024 ‎‡a 7402837119‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q46664008‏
100 0 ‎‡a Jason Matthews‏ ‎‡9 es‏ ‎‡9 sl‏ ‎‡9 ast‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a জেসন ম্যাথুজ‏ ‎‡c গবেষক‏ ‎‡9 bn‏
400 0 ‎‡a Jason Matthews‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Jason Matthews‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 3-Methylcholanthrene Induces Chylous Ascites in TCDD-Inducible Poly-ADP-Ribose Polymerase (Tiparp) Knockout Mice‏
670 ‎‡a Author's 3-methylcholanthrene induces differential recruitment of aryl hydrocarbon receptor to human promoters‏
670 ‎‡a Author's A new class of estrogen receptor beta-selective activators.‏
670 ‎‡a Author's Ability of structurally diverse natural products and synthetic chemicals to induce gene expression mediated by estrogen receptors from various species.‏
670 ‎‡a Author's Aminoflavone upregulates putative tumor suppressor miR-125b-2-3p to inhibit luminal A breast cancer stem cell-like properties‏
670 ‎‡a Author's Aryl hydrocarbon receptor (AhR)-dependent regulation of pulmonary miRNA by chronic cigarette smoke exposure.‏
670 ‎‡a Author's Aryl hydrocarbon receptor-dependent induction of flavin-containing monooxygenase mRNAs in mouse liver‏
670 ‎‡a Author's Aryl Hydrocarbon Receptor-Dependent Metabolism Plays a Significant Role in Estrogen-Like Effects of Polycyclic Aromatic Hydrocarbons on Cell Proliferation‏
670 ‎‡a Author's Aryl hydrocarbon receptor repressor and TiPARP (ARTD14) use similar, but also distinct mechanisms to repress aryl hydrocarbon receptor signaling.‏
670 ‎‡a Author's Characterization of TCDD-Inducible Poly-ADP-Ribose Polymerase‏
670 ‎‡a Author's Characterization of TCDD-Inducible Poly-ADP-Ribose Polymerase (TIPARP/ARTD14) Catalytic Activity‏
670 ‎‡a Author's Co-planar 3,3',4,4',5-pentachlorinated biphenyl and non-co-planar 2,2',4,6,6'-pentachlorinated biphenyl differentially induce recruitment of oestrogen receptor alpha to aryl hydrocarbon receptor target genes.‏
670 ‎‡a Author's Constitutive aryl hydrocarbon receptor signaling constrains type I interferon-mediated antiviral innate defense.‏
670 ‎‡a Author's Convergence of hepcidin deficiency, systemic iron overloading, heme accumulation, and REV-ERBα/β activation in aryl hydrocarbon receptor-elicited hepatotoxicity.‏
670 ‎‡a Author's Corrigendum to "Convergence of hepcidin deficiency, systemic iron overloading, heme accumulation, and REV-ERBα/β activation in aryl hydrocarbon receptor-elicited hepatotoxicity" [Toxicol. Appl. Pharmacol. 321 (2017) 1-17].‏
670 ‎‡a Author's Deoxyribonucleic acid response element-dependent regulation of transcription by orphan nuclear receptor estrogen receptor-related receptor gamma‏
670 ‎‡a Author's Differential ligand-dependent activation and a role for Y322 in aryl hydrocarbon receptor-mediated regulation of gene expression.‏
670 ‎‡a Author's Dioxin increases the interaction between aryl hydrocarbon receptor and estrogen receptor alpha at human promoters‏
670 ‎‡a Author's Distribution of androgen receptor mRNA expression and immunoreactivity in the brain of the green anole lizard.‏
670 ‎‡a Author's Dose-Dependent Metabolic Reprogramming and Differential Gene Expression in TCDD-Elicited Hepatic Fibrosis‏
670 ‎‡a Author's EID3 is a novel EID family member and an inhibitor of CBP-dependent co-activation‏
670 ‎‡a Author's Estrogen receptor beta2 negatively regulates the transactivation of estrogen receptor alpha in human breast cancer cells‏
670 ‎‡a Author's Estrogen receptor-dependent regulation of CYP2B6 in human breast cancer cells‏
670 ‎‡a Author's Estrogen receptor subtype- and promoter-specific modulation of aryl hydrocarbon receptor-dependent transcription.‏
670 ‎‡a Author's Examination of the in vitro and in vivo estrogenic activities of eight commercial phthalate esters‏
670 ‎‡a Author's Flavin-containing monooxygenase-3: induction by 3-methylcholanthrene and complex regulation by xenobiotic chemicals in hepatoma cells and mouse liver.‏
670 ‎‡a Author's FOXA1 is essential for aryl hydrocarbon receptor-dependent regulation of cyclin G2.‏
670 ‎‡a Author's Functional analysis of six human aryl hydrocarbon receptor variants in human breast cancer and mouse hepatoma cell lines.‏
670 ‎‡a Author's Genome-wide mapping and analysis of aryl hydrocarbon receptor‏
670 ‎‡a Author's Genome-wide mapping and analysis of aryl hydrocarbon receptor (AHR)- and aryl hydrocarbon receptor repressor (AHRR)-binding sites in human breast cancer cells.‏
670 ‎‡a Author's Hepatocyte-Specific Deletion of TIPARP, a Negative Regulator of the Aryl Hydrocarbon Receptor, Is Sufficient to Increase Sensitivity to Dioxin-Induced Wasting Syndrome‏
670 ‎‡a Author's Identification of aryl hydrocarbon receptor binding targets in mouse hepatic tissue treated with 2,3,7,8-tetrachlorodibenzo-p-dioxin‏
670 ‎‡a Author's In vitro and in vivo interactions of bisphenol A and its metabolite, bisphenol A glucuronide, with estrogen receptors alpha and beta.‏
670 ‎‡a Author's Induction of multidrug resistance transporter ABCG2 by prolactin in human breast cancer cells.‏
670 ‎‡a Author's Inhibition of aryl hydrocarbon receptor-dependent transcription by resveratrol or kaempferol is independent of estrogen receptor α expression in human breast cancer cells.‏
670 ‎‡a Author's Integration of genome-wide computation DRE search, AhR ChIP-chip and gene expression analyses of TCDD-elicited responses in the mouse liver‏
670 ‎‡a Author's Liver X receptor regulates hepatic nuclear O-GlcNAc signaling and carbohydrate responsive element-binding protein activity‏
670 ‎‡a Author's Loss of the Mono-ADP-ribosyltransferase, Tiparp, Increases Sensitivity to Dioxin-induced Steatohepatitis and Lethality‏
670 ‎‡a Author's LXRα Regulates ChREBPα Transactivity in a Target Gene-Specific Manner through an Agonist-Modulated LBD-LID Interaction‏
670 ‎‡a Author's LXRα Regulates Hepatic ChREBPα Activity and Lipogenesis upon Glucose, but Not Fructose Feeding in Mice‏
670 ‎‡a Author's Methods to Study TCDD-Inducible Poly-ADP-Ribose Polymerase (TIPARP) Mono-ADP-Ribosyltransferase Activity‏
670 ‎‡a Author's Pyruvate Kinase Isoform Switching and Hepatic Metabolic Reprogramming by the Environmental Contaminant 2,3,7,8-Tetrachlorodibenzo-p-Dioxin‏
670 ‎‡a Author's Quantification of rainbow trout‏
670 ‎‡a Author's Quantification of rainbow trout (Oncorhynchus mykiss) zona radiata and vitellogenin mRNA levels using real-time PCR after in vivo treatment with estradiol-17 beta or alpha-zearalenol‏
670 ‎‡a Author's Reciprocal mutagenesis between human alpha(L349, M528) and rainbow trout (M317, I496) estrogen receptor residues demonstrates their importance in ligand binding and gene expression at different temperatures.‏
670 ‎‡a Author's TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.‏
670 ‎‡a Author's The Ah receptor inhibits estrogen-induced estrogen receptor beta in breast cancer cells.‏
670 ‎‡a Author's The aryl hydrocarbon receptor and estrogen receptor alpha differentially modulate nuclear factor erythroid-2-related factor 2 transactivation in MCF-7 breast cancer cells.‏
670 ‎‡a Author's The aryl hydrocarbon receptor regulates the expression of TIPARP and its cis long non-coding RNA, TIPARP-AS1.‏
670 ‎‡a Author's The aryl hydrocarbon receptor suppresses cigarette-smoke-induced oxidative stress in association with dioxin response element‏
670 ‎‡a Author's The aryl hydrocarbon receptor suppresses cigarette-smoke-induced oxidative stress in association with dioxin response element (DRE)-independent regulation of sulfiredoxin 1.‏
670 ‎‡a Author's The basic helix-loop-helix-PAS protein ARNT functions as a potent coactivator of estrogen receptor-dependent transcription‏
670 ‎‡a Author's The human RAP250 gene: genomic structure and promoter analysis.‏
670 ‎‡a Author's Use of Xenopus laevis as a model for investigating in vitro and in vivo endocrine disruption in amphibians‏
670 ‎‡a Author's Zinc finger nuclease-mediated knockout of AHR or ARNT in human breast cancer cells abolishes basal and ligand-dependent regulation of CYP1B1 and differentially affects estrogen receptor α transactivation‏
909 ‎‡a (orcid) 0000000298158636‏ ‎‡9 1‏
909 ‎‡a (scopus) 7402837119‏ ‎‡9 1‏
919 ‎‡a corrigendumtoconvergenceofhepcidindeficiencysystemicironoverloadinghemeaccumulationandreverbαβactivationinarylhydrocarbonreceptorelicitedhepatotoxicity‏ ‎‡A Corrigendum to "Convergence of hepcidin deficiency, systemic iron overloading, heme accumulation, and REV-ERBα/β activation in aryl hydrocarbon receptor-elicited hepatotoxicity" [Toxicol. Appl. Pharmacol. 321 (2017) 1-17].‏ ‎‡9 1‏
919 ‎‡a deoxyribonucleicacidresponseelementdependentregulationoftranscriptionbyorphannuclearreceptorestrogenreceptorrelatedreceptorgamma‏ ‎‡A Deoxyribonucleic acid response element-dependent regulation of transcription by orphan nuclear receptor estrogen receptor-related receptor gamma‏ ‎‡9 1‏
919 ‎‡a differentialliganddependentactivationandarolefory322inarylhydrocarbonreceptormediatedregulationofgeneexpression‏ ‎‡A Differential ligand-dependent activation and a role for Y322 in aryl hydrocarbon receptor-mediated regulation of gene expression.‏ ‎‡9 1‏
919 ‎‡a zincfingernucleasemediatedknockoutofahrorarntinhumanbreastcancercellsabolishesbasalandliganddependentregulationofcyp1b1anddifferentiallyaffectsestrogenreceptorαtransactivation‏ ‎‡A Zinc finger nuclease-mediated knockout of AHR or ARNT in human breast cancer cells abolishes basal and ligand-dependent regulation of CYP1B1 and differentially affects estrogen receptor α transactivation‏ ‎‡9 1‏
919 ‎‡a useofxenopuslaevisasamodelforinvestigatinginvitroandinvivoendocrinedisruptioninamphibians‏ ‎‡A Use of Xenopus laevis as a model for investigating in vitro and in vivo endocrine disruption in amphibians‏ ‎‡9 1‏
919 ‎‡a humanrap250genegenomicstructureandpromoteranalysis‏ ‎‡A The human RAP250 gene: genomic structure and promoter analysis.‏ ‎‡9 1‏
919 ‎‡a basichelixloophelixpasproteinarntfunctionsasapotentcoactivatorofestrogenreceptordependenttranscription‏ ‎‡A The basic helix-loop-helix-PAS protein ARNT functions as a potent coactivator of estrogen receptor-dependent transcription‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptorsuppressescigarettesmokeinducedoxidativestressinassociationwithdioxinresponseelementdreindependentregulationofsulfiredoxin1‏ ‎‡A The aryl hydrocarbon receptor suppresses cigarette-smoke-induced oxidative stress in association with dioxin response element (DRE)-independent regulation of sulfiredoxin 1.‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptorsuppressescigarettesmokeinducedoxidativestressinassociationwithdioxinresponseelement‏ ‎‡A The aryl hydrocarbon receptor suppresses cigarette-smoke-induced oxidative stress in association with dioxin response element‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptorregulatestheexpressionoftiparpanditscislongnoncodingrnatiparpas1‏ ‎‡A The aryl hydrocarbon receptor regulates the expression of TIPARP and its cis long non-coding RNA, TIPARP-AS1.‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptorandestrogenreceptoralphadifferentiallymodulatenuclearfactorerythroid2relatedfactor2transactivationinmcf7breastcancercells‏ ‎‡A The aryl hydrocarbon receptor and estrogen receptor alpha differentially modulate nuclear factor erythroid-2-related factor 2 transactivation in MCF-7 breast cancer cells.‏ ‎‡9 1‏
919 ‎‡a ahreceptorinhibitsestrogeninducedestrogenreceptorbetainbreastcancercells‏ ‎‡A The Ah receptor inhibits estrogen-induced estrogen receptor beta in breast cancer cells.‏ ‎‡9 1‏
919 ‎‡a tcddinduciblepolyadpribosepolymerasetiparpparp7monoadpribosylatesandcoactivatesliver10receptors‏ ‎‡A TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.‏ ‎‡9 1‏
919 ‎‡a reciprocalmutagenesisbetweenhumanalphal349m528andrainbowtroutm317i496estrogenreceptorresiduesdemonstratestheirimportanceinligandbindingandgeneexpressionatdifferenttemperatures‏ ‎‡A Reciprocal mutagenesis between human alpha(L349, M528) and rainbow trout (M317, I496) estrogen receptor residues demonstrates their importance in ligand binding and gene expression at different temperatures.‏ ‎‡9 1‏
919 ‎‡a quantificationofrainbowtroutoncorhynchusmykisszonaradiataandvitellogeninmrnalevelsusingrealtimepcrafterinvivotreatmentwithestradiol17betaoralphazearalenol‏ ‎‡A Quantification of rainbow trout (Oncorhynchus mykiss) zona radiata and vitellogenin mRNA levels using real-time PCR after in vivo treatment with estradiol-17 beta or alpha-zearalenol‏ ‎‡9 1‏
919 ‎‡a quantificationofrainbowtrout‏ ‎‡A Quantification of rainbow trout‏ ‎‡9 1‏
919 ‎‡a pyruvatekinaseisoformswitchingandhepaticmetabolicreprogrammingbytheenvironmentalcontaminant2378tetrachlorodibenzopdioxin‏ ‎‡A Pyruvate Kinase Isoform Switching and Hepatic Metabolic Reprogramming by the Environmental Contaminant 2,3,7,8-Tetrachlorodibenzo-p-Dioxin‏ ‎‡9 1‏
919 ‎‡a methodstostudytcddinduciblepolyadpribosepolymerasetiparpmonoadpribosyltransferaseactivity‏ ‎‡A Methods to Study TCDD-Inducible Poly-ADP-Ribose Polymerase (TIPARP) Mono-ADP-Ribosyltransferase Activity‏ ‎‡9 1‏
919 ‎‡a lxrαregulateshepaticchrebpαactivityandlipogenesisuponglucosebutnotfructosefeedinginmice‏ ‎‡A LXRα Regulates Hepatic ChREBPα Activity and Lipogenesis upon Glucose, but Not Fructose Feeding in Mice‏ ‎‡9 1‏
919 ‎‡a lxrαregulateschrebpαtransactivityinatargetgenespecificmannerthroughanagonistmodulatedlbdlidinteraction‏ ‎‡A LXRα Regulates ChREBPα Transactivity in a Target Gene-Specific Manner through an Agonist-Modulated LBD-LID Interaction‏ ‎‡9 1‏
919 ‎‡a lossofthemonoadpribosyltransferasetiparpincreasessensitivitytodioxininducedsteatohepatitisandlethality‏ ‎‡A Loss of the Mono-ADP-ribosyltransferase, Tiparp, Increases Sensitivity to Dioxin-induced Steatohepatitis and Lethality‏ ‎‡9 1‏
919 ‎‡a liver10receptorregulateshepaticnuclearoglcnacsignalingandcarbohydrateresponsiveelementbindingproteinactivity‏ ‎‡A Liver X receptor regulates hepatic nuclear O-GlcNAc signaling and carbohydrate responsive element-binding protein activity‏ ‎‡9 1‏
919 ‎‡a integrationofgenomewidecomputationdresearchahrchipchipandgeneexpressionanalysesoftcddelicitedresponsesinthemouseliver‏ ‎‡A Integration of genome-wide computation DRE search, AhR ChIP-chip and gene expression analyses of TCDD-elicited responses in the mouse liver‏ ‎‡9 1‏
919 ‎‡a inhibitionofarylhydrocarbonreceptordependenttranscriptionbyresveratrolorkaempferolisindependentofestrogenreceptorαexpressioninhumanbreastcancercells‏ ‎‡A Inhibition of aryl hydrocarbon receptor-dependent transcription by resveratrol or kaempferol is independent of estrogen receptor α expression in human breast cancer cells.‏ ‎‡9 1‏
919 ‎‡a inductionofmultidrugresistancetransporterabcg2byprolactininhumanbreastcancercells‏ ‎‡A Induction of multidrug resistance transporter ABCG2 by prolactin in human breast cancer cells.‏ ‎‡9 1‏
919 ‎‡a invitroandinvivointeractionsofbisphenolaanditsmetabolitebisphenolaglucuronidewithestrogenreceptorsalphaandbeta‏ ‎‡A In vitro and in vivo interactions of bisphenol A and its metabolite, bisphenol A glucuronide, with estrogen receptors alpha and beta.‏ ‎‡9 1‏
919 ‎‡a identificationofarylhydrocarbonreceptorbindingtargetsinmousehepatictissuetreatedwith2378tetrachlorodibenzopdioxin‏ ‎‡A Identification of aryl hydrocarbon receptor binding targets in mouse hepatic tissue treated with 2,3,7,8-tetrachlorodibenzo-p-dioxin‏ ‎‡9 1‏
919 ‎‡a hepatocytespecificdeletionoftiparpanegativeregulatorofthearylhydrocarbonreceptorissufficienttoincreasesensitivitytodioxininducedwastingsyndrome‏ ‎‡A Hepatocyte-Specific Deletion of TIPARP, a Negative Regulator of the Aryl Hydrocarbon Receptor, Is Sufficient to Increase Sensitivity to Dioxin-Induced Wasting Syndrome‏ ‎‡9 1‏
919 ‎‡a genomewidemappingandanalysisofarylhydrocarbonreceptorahrandarylhydrocarbonreceptorrepressorahrrbindingsitesinhumanbreastcancercells‏ ‎‡A Genome-wide mapping and analysis of aryl hydrocarbon receptor (AHR)- and aryl hydrocarbon receptor repressor (AHRR)-binding sites in human breast cancer cells.‏ ‎‡9 1‏
919 ‎‡a genomewidemappingandanalysisofarylhydrocarbonreceptor‏ ‎‡A Genome-wide mapping and analysis of aryl hydrocarbon receptor‏ ‎‡9 1‏
919 ‎‡a functionalanalysisof6humanarylhydrocarbonreceptorvariantsinhumanbreastcancerandmousehepatomacelllines‏ ‎‡A Functional analysis of six human aryl hydrocarbon receptor variants in human breast cancer and mouse hepatoma cell lines.‏ ‎‡9 1‏
919 ‎‡a foxa1isessentialforarylhydrocarbonreceptordependentregulationofcycling2‏ ‎‡A FOXA1 is essential for aryl hydrocarbon receptor-dependent regulation of cyclin G2.‏ ‎‡9 1‏
919 ‎‡a flavincontainingmonooxygenase3inductionby3methylcholanthreneandcomplexregulationbyxenobioticchemicalsinhepatomacellsandmouseliver‏ ‎‡A Flavin-containing monooxygenase-3: induction by 3-methylcholanthrene and complex regulation by xenobiotic chemicals in hepatoma cells and mouse liver.‏ ‎‡9 1‏
919 ‎‡a examinationoftheinvitroandinvivoestrogenicactivitiesof8commercialphthalateesters‏ ‎‡A Examination of the in vitro and in vivo estrogenic activities of eight commercial phthalate esters‏ ‎‡9 1‏
919 ‎‡a estrogenreceptorsubtypeandpromoterspecificmodulationofarylhydrocarbonreceptordependenttranscription‏ ‎‡A Estrogen receptor subtype- and promoter-specific modulation of aryl hydrocarbon receptor-dependent transcription.‏ ‎‡9 1‏
919 ‎‡a estrogenreceptordependentregulationofcyp2b6inhumanbreastcancercells‏ ‎‡A Estrogen receptor-dependent regulation of CYP2B6 in human breast cancer cells‏ ‎‡9 1‏
919 ‎‡a estrogenreceptorbeta2negativelyregulatesthetransactivationofestrogenreceptoralphainhumanbreastcancercells‏ ‎‡A Estrogen receptor beta2 negatively regulates the transactivation of estrogen receptor alpha in human breast cancer cells‏ ‎‡9 1‏
919 ‎‡a 3methylcholanthreneinduceschylousascitesintcddinduciblepolyadpribosepolymerasetiparpknockoutmice‏ ‎‡A 3-Methylcholanthrene Induces Chylous Ascites in TCDD-Inducible Poly-ADP-Ribose Polymerase (Tiparp) Knockout Mice‏ ‎‡9 1‏
919 ‎‡a 3methylcholanthreneinducesdifferentialrecruitmentofarylhydrocarbonreceptortohumanpromoters‏ ‎‡A 3-methylcholanthrene induces differential recruitment of aryl hydrocarbon receptor to human promoters‏ ‎‡9 1‏
919 ‎‡a newclassofestrogenreceptorbetaselectiveactivators‏ ‎‡A A new class of estrogen receptor beta-selective activators.‏ ‎‡9 1‏
919 ‎‡a eid3isanoveleidfamilymemberandaninhibitorofcbpdependentcoactivation‏ ‎‡A EID3 is a novel EID family member and an inhibitor of CBP-dependent co-activation‏ ‎‡9 1‏
919 ‎‡a abilityofstructurallydiversenaturalproductsandsyntheticchemicalstoinducegeneexpressionmediatedbyestrogenreceptorsfromvariousspecies‏ ‎‡A Ability of structurally diverse natural products and synthetic chemicals to induce gene expression mediated by estrogen receptors from various species.‏ ‎‡9 1‏
919 ‎‡a aminoflavoneupregulatesputativetumorsuppressormir125b23ptoinhibitluminalabreastcancerstemcelllikeproperties‏ ‎‡A Aminoflavone upregulates putative tumor suppressor miR-125b-2-3p to inhibit luminal A breast cancer stem cell-like properties‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptorahrdependentregulationofpulmonarymirnabychroniccigarettesmokeexposure‏ ‎‡A Aryl hydrocarbon receptor (AhR)-dependent regulation of pulmonary miRNA by chronic cigarette smoke exposure.‏ ‎‡9 1‏
919 ‎‡a dosedependentmetabolicreprogramminganddifferentialgeneexpressionintcddelicitedhepaticfibrosis‏ ‎‡A Dose-Dependent Metabolic Reprogramming and Differential Gene Expression in TCDD-Elicited Hepatic Fibrosis‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptordependentinductionofflavincontainingmonooxygenasemrnasinmouseliver‏ ‎‡A Aryl hydrocarbon receptor-dependent induction of flavin-containing monooxygenase mRNAs in mouse liver‏ ‎‡9 1‏
919 ‎‡a distributionofandrogenreceptormrnaexpressionandimmunoreactivityinthebrainofthegreenanolelizard‏ ‎‡A Distribution of androgen receptor mRNA expression and immunoreactivity in the brain of the green anole lizard.‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptordependentmetabolismplaysasignificantroleinestrogenlikeeffectsofpolycyclicaromatichydrocarbonsoncellproliferation‏ ‎‡A Aryl Hydrocarbon Receptor-Dependent Metabolism Plays a Significant Role in Estrogen-Like Effects of Polycyclic Aromatic Hydrocarbons on Cell Proliferation‏ ‎‡9 1‏
919 ‎‡a arylhydrocarbonreceptorrepressorandtiparpartd14usesimilarbutalsodistinctmechanismstorepressarylhydrocarbonreceptorsignaling‏ ‎‡A Aryl hydrocarbon receptor repressor and TiPARP (ARTD14) use similar, but also distinct mechanisms to repress aryl hydrocarbon receptor signaling.‏ ‎‡9 1‏
919 ‎‡a characterizationoftcddinduciblepolyadpribosepolymerase‏ ‎‡A Characterization of TCDD-Inducible Poly-ADP-Ribose Polymerase‏ ‎‡9 1‏
919 ‎‡a dioxinincreasestheinteractionbetweenarylhydrocarbonreceptorandestrogenreceptoralphaathumanpromoters‏ ‎‡A Dioxin increases the interaction between aryl hydrocarbon receptor and estrogen receptor alpha at human promoters‏ ‎‡9 1‏
919 ‎‡a characterizationoftcddinduciblepolyadpribosepolymerasetiparpartd14catalyticactivity‏ ‎‡A Characterization of TCDD-Inducible Poly-ADP-Ribose Polymerase (TIPARP/ARTD14) Catalytic Activity‏ ‎‡9 1‏
919 ‎‡a coplanar33445pentachlorinatedbiphenylandnoncoplanar22466pentachlorinatedbiphenyldifferentiallyinducerecruitmentofoestrogenreceptoralphatoarylhydrocarbonreceptortargetgenes‏ ‎‡A Co-planar 3,3',4,4',5-pentachlorinated biphenyl and non-co-planar 2,2',4,6,6'-pentachlorinated biphenyl differentially induce recruitment of oestrogen receptor alpha to aryl hydrocarbon receptor target genes.‏ ‎‡9 1‏
919 ‎‡a constitutivearylhydrocarbonreceptorsignalingconstrainstype1interferonmediatedantiviralinnatedefense‏ ‎‡A Constitutive aryl hydrocarbon receptor signaling constrains type I interferon-mediated antiviral innate defense.‏ ‎‡9 1‏
919 ‎‡a convergenceofhepcidindeficiencysystemicironoverloadinghemeaccumulationandreverbαβactivationinarylhydrocarbonreceptorelicitedhepatotoxicity‏ ‎‡A Convergence of hepcidin deficiency, systemic iron overloading, heme accumulation, and REV-ERBα/β activation in aryl hydrocarbon receptor-elicited hepatotoxicity.‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 BIBSYS|90530777‏
996 ‎‡2 NKC|xx0192237‏
996 ‎‡2 NTA|145709833‏
996 ‎‡2 LC|n 89605784‏
996 ‎‡2 LC|nb2011009684‏
996 ‎‡2 SUDOC|262859688‏
996 ‎‡2 J9U|987007443968705171‏
996 ‎‡2 ISNI|0000000036091582‏
996 ‎‡2 PLWABN|9810651894605606‏
996 ‎‡2 ISNI|0000000023610072‏
996 ‎‡2 NLA|000057826287‏
996 ‎‡2 BIBSYS|90507643‏
996 ‎‡2 J9U|987007319609105171‏
996 ‎‡2 J9U|987007350661605171‏
996 ‎‡2 BIBSYS|90306264‏
996 ‎‡2 BNC|981058612925306706‏
996 ‎‡2 SUDOC|178092770‏
996 ‎‡2 ISNI|0000000037428458‏
996 ‎‡2 LC|no2012043530‏
996 ‎‡2 LC|n 2006085528‏
996 ‎‡2 NII|DA09098423‏
996 ‎‡2 DBC|87097919432289‏
996 ‎‡2 ISNI|0000000063298394‏
996 ‎‡2 N6I|vtls001337972‏
996 ‎‡2 ISNI|0000000367769706‏
996 ‎‡2 NUKAT|n 2014006998‏
996 ‎‡2 J9U|987007278372105171‏
996 ‎‡2 CAOONL|ncf11965406‏
996 ‎‡2 BIBSYS|2129763‏
996 ‎‡2 LC|n 84116292‏
996 ‎‡2 NTA|067813895‏
996 ‎‡2 PTBNP|1566054‏
996 ‎‡2 LC|nb2009000593‏
996 ‎‡2 RERO|A023905599‏
996 ‎‡2 LC|no2017070837‏
996 ‎‡2 ISNI|0000000021948395‏
996 ‎‡2 ISNI|0000000031508051‏
996 ‎‡2 LC|n 95072303‏
996 ‎‡2 BNF|16971644‏
996 ‎‡2 SUDOC|13204062X‏
996 ‎‡2 LC|n 2018188749‏
996 ‎‡2 ISNI|0000000375559960‏
996 ‎‡2 ISNI|000000045440895X‏
996 ‎‡2 LC|n 85339253‏
996 ‎‡2 PLWABN|9810536329205606‏
996 ‎‡2 ISNI|0000000119210663‏
996 ‎‡2 BLBNB|001036737‏
996 ‎‡2 NUKAT|n 2007151004‏
996 ‎‡2 LC|n 83018662‏
996 ‎‡2 ISNI|0000000498271537‏
996 ‎‡2 LC|no2013071613‏
996 ‎‡2 PTBNP|678472‏
996 ‎‡2 ISNI|0000000025580938‏
996 ‎‡2 RERO|A003573299‏
996 ‎‡2 NDL|001149449‏
996 ‎‡2 J9U|987007322276805171‏
996 ‎‡2 BIBSYS|90359337‏
996 ‎‡2 LC|no2015158531‏
996 ‎‡2 LC|no2003123298‏
996 ‎‡2 LIH|LNB:C_q_N6;=B_e_‏
996 ‎‡2 LC|n 77003271‏
996 ‎‡2 LC|n 2009161902‏
996 ‎‡2 SUDOC|232701792‏
996 ‎‡2 NUKAT|n 2005031466‏
996 ‎‡2 NTA|212388703‏
996 ‎‡2 SUDOC|16143715X‏
996 ‎‡2 LC|no 99029129‏
996 ‎‡2 LC|n 85057406‏
996 ‎‡2 ISNI|0000000025216132‏
996 ‎‡2 LC|nr 92038363‏
996 ‎‡2 RERO|A024376378‏
996 ‎‡2 SUDOC|078171334‏
996 ‎‡2 ISNI|0000000410094012‏
996 ‎‡2 SUDOC|069374384‏
996 ‎‡2 LC|n 2013002726‏
996 ‎‡2 LC|n 95801528‏
996 ‎‡2 RERO|A025563033‏
996 ‎‡2 DNB|1065249225‏
996 ‎‡2 NTA|364151749‏
996 ‎‡2 LC|no2010154047‏
996 ‎‡2 NII|DA1333436X‏
996 ‎‡2 PLWABN|9813500673705606‏
996 ‎‡2 ISNI|0000000074110967‏
996 ‎‡2 CAOONL|ncf10004577‏
996 ‎‡2 NKC|ola2014830336‏
996 ‎‡2 RERO|A027663258‏
996 ‎‡2 RERO|A003573300‏
996 ‎‡2 CAOONL|ncf11270502‏
996 ‎‡2 BIBSYS|90817294‏
996 ‎‡2 LC|n 2012051087‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏