Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q57342996 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241120235920.0 | ||
| 008 | 241120nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q57342996 | ||
| 024 | ‡a 0000-0003-0509-0562 ‡2 orcid | ||
| 024 | ‡a 55976880300 ‡2 scopus | ||
| 035 | ‡a (OCoLC)Q57342996 | ||
| 100 | 0 | ‡a Tiago Gil Oliveira ‡c researcher ‡9 en | |
| 375 | ‡a 1 ‡2 iso5218 | ||
| 400 | 0 | ‡a Tiago Gil Oliveira ‡c onderzoeker ‡9 nl | |
| 670 | ‡a Author's Brain MRI in a patient with classical galactosemia: acute event of unilateral hemispheric cerebral edema. | ||
| 670 | ‡a Author's Comparative lipidomic analysis of mouse and human brain with Alzheimer disease. | ||
| 670 | ‡a Author's Differential impact of chronic stress along the hippocampal dorsal-ventral axis. | ||
| 670 | ‡a Author's Differential lipid composition and regulation along the hippocampal longitudinal axis | ||
| 670 | ‡a Author's Dynamic myelopathy in Hirayama disease | ||
| 670 | ‡a Author's Effects of the LPA1 Receptor Deficiency and Stress on the Hippocampal LPA Species in Mice | ||
| 670 | ‡a Author's How useful is the assessment of lymphatic vascular density in oral carcinoma prognosis? | ||
| 670 | ‡a Author's Influence of Metabolic Syndrome on the Recovery from Idiopathic Sudden Sensorineural Hearing Loss | ||
| 670 | ‡a Author's Interplay between Depressive-Like Behavior and the Immune System in an Animal Model of Prenatal Dexamethasone Administration | ||
| 670 | ‡a Author's Lipids under stress--a lipidomic approach for the study of mood disorders. | ||
| 670 | ‡a Author's Lipocalin 2 modulates the cellular response to amyloid beta. | ||
| 670 | ‡a Author's Magnetic resonance imaging brain atrophy assessment in primary age-related tauopathy (PART) | ||
| 670 | ‡a Author's Neuronal lysosomal dysfunction releases exosomes harboring APP C-terminal fragments and unique lipid signatures | ||
| 670 | ‡a Author's Phospholipase D functional ablation has a protective effect in an Alzheimer's disease Caenorhabditis elegans model | ||
| 670 | ‡a Author's Phospholipase D in brain function and Alzheimer's disease. | ||
| 670 | ‡a Author's Phospholipase d2 ablation ameliorates Alzheimer's disease-linked synaptic dysfunction and cognitive deficits | ||
| 670 | ‡a Author's Soccer heading and concussion are not associated with reduced brain volume or cortical thickness | ||
| 670 | ‡a Author's The impact of chronic stress on the rat brain lipidome | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/viaf/6397164479565026210004 | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/processed/SUDOC|259283932 | ||
| 909 | ‡a (scopus) 55976880300 ‡9 1 | ||
| 909 | ‡a (orcid) 0000000305090562 ‡9 1 | ||
| 919 | ‡a impactofchronicstressontheratbrainlipidome ‡A The impact of chronic stress on the rat brain lipidome ‡9 1 | ||
| 919 | ‡a soccerheadingandconcussionarenotassociatedwithreducedbrainvolumeorcorticalthickness ‡A Soccer heading and concussion are not associated with reduced brain volume or cortical thickness ‡9 1 | ||
| 919 | ‡a phospholipased2ablationamelioratesalzheimersdiseaselinkedsynapticdysfunctionandcognitivedeficits ‡A Phospholipase d2 ablation ameliorates Alzheimer's disease-linked synaptic dysfunction and cognitive deficits ‡9 1 | ||
| 919 | ‡a phospholipase500inbrainfunctionandalzheimersdisease ‡A Phospholipase D in brain function and Alzheimer's disease. ‡9 1 | ||
| 919 | ‡a phospholipase500functionalablationhasaprotectiveeffectinanalzheimersdiseasecaenorhabditiselegansmodel ‡A Phospholipase D functional ablation has a protective effect in an Alzheimer's disease Caenorhabditis elegans model ‡9 1 | ||
| 919 | ‡a neuronallysosomaldysfunctionreleasesexosomesharboringapp100terminalfragmentsanduniquelipidsignatures ‡A Neuronal lysosomal dysfunction releases exosomes harboring APP C-terminal fragments and unique lipid signatures ‡9 1 | ||
| 919 | ‡a magneticresonanceimagingbrainatrophyassessmentinprimaryagerelatedtauopathypart ‡A Magnetic resonance imaging brain atrophy assessment in primary age-related tauopathy (PART) ‡9 1 | ||
| 919 | ‡a lipocalin2modulatesthecellularresponsetoamyloidbeta ‡A Lipocalin 2 modulates the cellular response to amyloid beta. ‡9 1 | ||
| 919 | ‡a lipidsunderstressalipidomicapproachforthestudyofmooddisorders ‡A Lipids under stress--a lipidomic approach for the study of mood disorders. ‡9 1 | ||
| 919 | ‡a interplaybetweendepressivelikebehaviorandtheimmunesysteminananimalmodelofprenataldexamethasoneadministration ‡A Interplay between Depressive-Like Behavior and the Immune System in an Animal Model of Prenatal Dexamethasone Administration ‡9 1 | ||
| 919 | ‡a influenceofmetabolicsyndromeontherecoveryfromidiopathicsuddensensorineuralhearingloss ‡A Influence of Metabolic Syndrome on the Recovery from Idiopathic Sudden Sensorineural Hearing Loss ‡9 1 | ||
| 919 | ‡a howusefulistheassessmentoflymphaticvasculardensityinoralcarcinomaprognosis ‡A How useful is the assessment of lymphatic vascular density in oral carcinoma prognosis? ‡9 1 | ||
| 919 | ‡a effectsofthelpa1receptordeficiencyandstressonthehippocampallpaspeciesinmice ‡A Effects of the LPA1 Receptor Deficiency and Stress on the Hippocampal LPA Species in Mice ‡9 1 | ||
| 919 | ‡a dynamicmyelopathyinhirayamadisease ‡A Dynamic myelopathy in Hirayama disease ‡9 1 | ||
| 919 | ‡a differentiallipidcompositionandregulationalongthehippocampallongitudinalaxis ‡A Differential lipid composition and regulation along the hippocampal longitudinal axis ‡9 1 | ||
| 919 | ‡a differentialimpactofchronicstressalongthehippocampaldorsalventralaxis ‡A Differential impact of chronic stress along the hippocampal dorsal-ventral axis. ‡9 1 | ||
| 919 | ‡a comparativelipidomicanalysisofmouseandhumanbrainwithalzheimerdisease ‡A Comparative lipidomic analysis of mouse and human brain with Alzheimer disease. ‡9 1 | ||
| 919 | ‡a brainmriinapatientwithclassicalgalactosemiaacuteeventofunilateralhemisphericcerebraledema ‡A Brain MRI in a patient with classical galactosemia: acute event of unilateral hemispheric cerebral edema. ‡9 1 | ||
| 946 | ‡a b ‡9 1 | ||
| 996 | ‡2 BLBNB|001277455 | ||
| 996 | ‡2 BLBNB|000489619 | ||
| 996 | ‡2 NUKAT|n 2003034800 | ||
| 996 | ‡2 LC|no2018006797 | ||
| 996 | ‡2 BLBNB|001480287 | ||
| 996 | ‡2 ISNI|000000007013171X | ||
| 996 | ‡2 DNB|1163254665 | ||
| 996 | ‡2 SUDOC|255508751 | ||
| 996 | ‡2 PTBNP|1352615 | ||
| 996 | ‡2 ISNI|000000011410241X | ||
| 996 | ‡2 DNB|121185437X | ||
| 996 | ‡2 LC|n 90689401 | ||
| 996 | ‡2 PTBNP|1912102 | ||
| 996 | ‡2 J9U|987007452490005171 | ||
| 996 | ‡2 BLBNB|000542569 | ||
| 996 | ‡2 DNB|125277138X | ||
| 996 | ‡2 LC|n 2020030839 | ||
| 996 | ‡2 PTBNP|1661551 | ||
| 996 | ‡2 NII|DA03425990 | ||
| 996 | ‡2 BIBSYS|1459181431780 | ||
| 996 | ‡2 PTBNP|1718350 | ||
| 996 | ‡2 LC|n 2011205108 | ||
| 996 | ‡2 DNB|1293986917 | ||
| 996 | ‡2 PTBNP|1741721 | ||
| 996 | ‡2 DNB|1120039126 | ||
| 996 | ‡2 BLBNB|001542050 | ||
| 996 | ‡2 PTBNP|285660 | ||
| 996 | ‡2 PTBNP|1824997 | ||
| 996 | ‡2 BLBNB|001586962 | ||
| 996 | ‡2 BLBNB|001488643 | ||
| 996 | ‡2 BLBNB|001483792 | ||
| 996 | ‡2 SUDOC|249751763 | ||
| 996 | ‡2 SUDOC|088448533 | ||
| 996 | ‡2 RERO|A000130974 | ||
| 996 | ‡2 PTBNP|65747 | ||
| 996 | ‡2 DNB|132500734X | ||
| 996 | ‡2 DNB|1255317329 | ||
| 996 | ‡2 BLBNB|001504804 | ||
| 996 | ‡2 CAOONL|ncf11899014 | ||
| 996 | ‡2 PTBNP|1625396 | ||
| 996 | ‡2 BLBNB|000463173 | ||
| 996 | ‡2 BLBNB|000404693 | ||
| 996 | ‡2 SUDOC|236003712 | ||
| 996 | ‡2 BLBNB|001524829 | ||
| 996 | ‡2 SUDOC|250352567 | ||
| 996 | ‡2 SUDOC|259283932 | ||
| 996 | ‡2 BNC|981058518780906706 | ||
| 996 | ‡2 SZ|105983295X | ||
| 996 | ‡2 DNB|105983295X | ||
| 996 | ‡2 LC|n 2022253422 | ||
| 996 | ‡2 LC|no2015022332 | ||
| 996 | ‡2 SUDOC|275606368 | ||
| 996 | ‡2 SUDOC|265702682 | ||
| 996 | ‡2 ISNI|0000000397003998 | ||
| 996 | ‡2 LC|n 2017251239 | ||
| 996 | ‡2 PLWABN|9812680394905606 | ||
| 996 | ‡2 ISNI|0000000501133697 | ||
| 996 | ‡2 NUKAT|n 2021007155 | ||
| 996 | ‡2 DNB|1276062311 | ||
| 996 | ‡2 PTBNP|1494052 | ||
| 996 | ‡2 DNB|1056380187 | ||
| 996 | ‡2 NTA|094922217 | ||
| 996 | ‡2 PTBNP|1492271 | ||
| 996 | ‡2 LC|no2014126012 | ||
| 996 | ‡2 DNB|1311059032 | ||
| 996 | ‡2 PTBNP|1709466 | ||
| 996 | ‡2 PTBNP|1565042 | ||
| 996 | ‡2 PTBNP|1831202 | ||
| 996 | ‡2 ISNI|0000000066617880 | ||
| 996 | ‡2 DNB|1299320368 | ||
| 996 | ‡2 DNB|1105505111 | ||
| 996 | ‡2 LC|no2020133795 | ||
| 996 | ‡2 ISNI|0000000423284755 | ||
| 996 | ‡2 BLBNB|001427471 | ||
| 996 | ‡2 ISNI|0000000115031887 | ||
| 996 | ‡2 BLBNB|001277416 | ||
| 996 | ‡2 PTBNP|800442 | ||
| 996 | ‡2 LC|n 2018252026 | ||
| 996 | ‡2 DNB|1188748351 | ||
| 996 | ‡2 DNB|1139667157 | ||
| 996 | ‡2 RERO|A019228930 | ||
| 996 | ‡2 SUDOC|188524096 | ||
| 996 | ‡2 SUDOC|244274584 | ||
| 996 | ‡2 BLBNB|001448862 | ||
| 996 | ‡2 BLBNB|000444823 | ||
| 996 | ‡2 LC|n 2023255756 | ||
| 996 | ‡2 ISNI|0000000070632936 | ||
| 996 | ‡2 ISNI|0000000428259057 | ||
| 996 | ‡2 PTBNP|1869441 | ||
| 996 | ‡2 BLBNB|001489964 | ||
| 996 | ‡2 BNF|14216269 | ||
| 996 | ‡2 BLBNB|000225035 | ||
| 996 | ‡2 SUDOC|276529464 | ||
| 996 | ‡2 SUDOC|265602394 | ||
| 996 | ‡2 DNB|1327371308 | ||
| 996 | ‡2 NKC|jx20100106022 | ||
| 996 | ‡2 LC|n 2023253544 | ||
| 996 | ‡2 BNF|18049965 | ||
| 996 | ‡2 ISNI|0000000115883529 | ||
| 996 | ‡2 PTBNP|1434422 | ||
| 996 | ‡2 ISNI|0000000110400831 | ||
| 996 | ‡2 ISNI|0000000499551012 | ||
| 996 | ‡2 ISNI|0000000068794880 | ||
| 996 | ‡2 BLBNB|001452478 | ||
| 996 | ‡2 PTBNP|1670903 | ||
| 996 | ‡2 SELIBR|196351 | ||
| 996 | ‡2 LC|n 2022254638 | ||
| 996 | ‡2 BLBNB|001487321 | ||
| 996 | ‡2 NTA|363908781 | ||
| 996 | ‡2 DNB|1272427579 | ||
| 996 | ‡2 BLBNB|001497310 | ||
| 996 | ‡2 BLBNB|001520983 | ||
| 996 | ‡2 LC|no2019085232 | ||
| 996 | ‡2 PTBNP|1703991 | ||
| 996 | ‡2 BLBNB|001542108 | ||
| 996 | ‡2 LC|no2018110123 | ||
| 996 | ‡2 LC|no2020003496 | ||
| 996 | ‡2 LC|no2021095243 | ||
| 996 | ‡2 BLBNB|000520868 | ||
| 996 | ‡2 DNB|1241275947 | ||
| 996 | ‡2 LC|no2024107640 | ||
| 996 | ‡2 NSK|000612828 | ||
| 996 | ‡2 PTBNP|811000 | ||
| 996 | ‡2 DNB|1173662456 | ||
| 996 | ‡2 BLBNB|001466912 | ||
| 996 | ‡2 ISNI|0000000509500826 | ||
| 996 | ‡2 BLBNB|001019861 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 | ||
| 998 | ‡a Oliveira, Tiago Gil, ‡2 SUDOC|259283932 ‡3 suggested |
