Search
Leader | 00000nz a2200037n 45 0 | ||
---|---|---|---|
001 | WKP|Q61136041 (VIAF cluster) (Authority/Source Record) | ||
003 | WKP | ||
005 | 20241221010731.0 | ||
008 | 241221nneanz||abbn n and d | ||
035 | ‡a (WKP)Q61136041 | ||
024 | ‡a 0000-0001-7447-328X ‡2 orcid | ||
035 | ‡a (OCoLC)Q61136041 | ||
100 | 0 | ‡a M Teresa Grande ‡c researcher ORCID ID = 0000-0001-7447-328X ‡9 en | |
375 | ‡a 2 ‡2 iso5218 | ||
400 | 0 | ‡a M Teresa Grande ‡c wetenschapper ‡9 nl | |
670 | ‡a Author's Anti-inflammatory agents for smoking cessation? Focus on cognitive deficits associated with nicotine withdrawal in male mice | ||
670 | ‡a Author's Cannabinoid CB2 receptors in the mouse brain: relevance for Alzheimer's disease. | ||
670 | ‡a Author's Deletion of H-Ras decreases renal fibrosis and myofibroblast activation following ureteral obstruction in mice | ||
670 | ‡a Author's Effect of angiotensin II and small GTPase Ras signaling pathway inhibition on early renal changes in a murine model of obstructive nephropathy. | ||
670 | ‡a Author's Endocannabinoid regulation of amyloid-induced neuroinflammation. | ||
670 | ‡a Author's Increased oxidative stress, the renin-angiotensin system, and sympathetic overactivation induce hypertension in kidney androgen-regulated protein transgenic mice | ||
670 | ‡a Author's Kidney androgen-regulated protein transgenic mice show hypertension and renal alterations mediated by oxidative stress. | ||
670 | ‡a Author's Protective effect of new nitrosothiols on the early inflammatory response to kidney ischemia/reperfusion and transplantation in rats. | ||
670 | ‡a Author's Role of interleukin 1-beta in the inflammatory response in a fatty acid amide hydrolase-knockout mouse model of Alzheimer's disease | ||
670 | ‡a Author's Snail1-induced partial epithelial-to-mesenchymal transition drives renal fibrosis in mice and can be targeted to reverse established disease | ||
670 | ‡a Author's Targeted genomic disruption of h-ras induces hypotension through a NO-cGMP-PKG pathway-dependent mechanism. | ||
670 | ‡a Author's Therapeutical relevance of MAP-kinase inhibitors in renal diseases: current knowledge and future clinical perspectives. | ||
670 | ‡a Author's Tyrosine hydroxylase haploinsufficiency prevents age-associated arterial pressure elevation and increases half-life in mice. | ||
909 | ‡a (orcid) 000000017447328x ‡9 1 | ||
919 | ‡a tyrosinehydroxylasehaploinsufficiencypreventsageassociatedarterialpressureelevationandincreaseshalflifeinmice ‡A Tyrosine hydroxylase haploinsufficiency prevents age-associated arterial pressure elevation and increases half-life in mice. ‡9 1 | ||
919 | ‡a therapeuticalrelevanceofmapkinaseinhibitorsinrenaldiseasescurrentknowledgeandfutureclinicalperspectives ‡A Therapeutical relevance of MAP-kinase inhibitors in renal diseases: current knowledge and future clinical perspectives. ‡9 1 | ||
919 | ‡a targetedgenomicdisruptionofhrasinduceshypotensionthroughanocgmppkgpathwaydependentmechanism ‡A Targeted genomic disruption of h-ras induces hypotension through a NO-cGMP-PKG pathway-dependent mechanism. ‡9 1 | ||
919 | ‡a snail1inducedpartialepithelialtomesenchymaltransitiondrivesrenalfibrosisinmiceandcanbetargetedtoreverseestablisheddisease ‡A Snail1-induced partial epithelial-to-mesenchymal transition drives renal fibrosis in mice and can be targeted to reverse established disease ‡9 1 | ||
919 | ‡a roleofinterleukin1betaintheinflammatoryresponseinafattyacidamidehydrolaseknockoutmousemodelofalzheimersdisease ‡A Role of interleukin 1-beta in the inflammatory response in a fatty acid amide hydrolase-knockout mouse model of Alzheimer's disease ‡9 1 | ||
919 | ‡a protectiveeffectofnewnitrosothiolsontheearlyinflammatoryresponsetokidneyischemiareperfusionandtransplantationinrats ‡A Protective effect of new nitrosothiols on the early inflammatory response to kidney ischemia/reperfusion and transplantation in rats. ‡9 1 | ||
919 | ‡a kidneyandrogenregulatedproteintransgenicmiceshowhypertensionandrenalalterationsmediatedbyoxidativestress ‡A Kidney androgen-regulated protein transgenic mice show hypertension and renal alterations mediated by oxidative stress. ‡9 1 | ||
919 | ‡a increasedoxidativestressthereninangiotensinsystemandsympatheticoveractivationinducehypertensioninkidneyandrogenregulatedproteintransgenicmice ‡A Increased oxidative stress, the renin-angiotensin system, and sympathetic overactivation induce hypertension in kidney androgen-regulated protein transgenic mice ‡9 1 | ||
919 | ‡a endocannabinoidregulationofamyloidinducedneuroinflammation ‡A Endocannabinoid regulation of amyloid-induced neuroinflammation. ‡9 1 | ||
919 | ‡a effectofangiotensin2andsmallgtpaserassignalingpathwayinhibitiononearlyrenalchangesinamurinemodelofobstructivenephropathy ‡A Effect of angiotensin II and small GTPase Ras signaling pathway inhibition on early renal changes in a murine model of obstructive nephropathy. ‡9 1 | ||
919 | ‡a deletionofhrasdecreasesrenalfibrosisandmyofibroblastactivationfollowingureteralobstructioninmice ‡A Deletion of H-Ras decreases renal fibrosis and myofibroblast activation following ureteral obstruction in mice ‡9 1 | ||
919 | ‡a cannabinoidcb2receptorsinthemousebrainrelevanceforalzheimersdisease ‡A Cannabinoid CB2 receptors in the mouse brain: relevance for Alzheimer's disease. ‡9 1 | ||
919 | ‡a antiinflammatoryagentsforsmokingcessationfocusoncognitivedeficitsassociatedwithnicotinewithdrawalinmalemice ‡A Anti-inflammatory agents for smoking cessation? Focus on cognitive deficits associated with nicotine withdrawal in male mice ‡9 1 | ||
946 | ‡a a ‡9 1 | ||
996 | ‡2 BNC|981058604950406706 | ||
996 | ‡2 J9U|987007339524705171 | ||
996 | ‡2 BNE|XX927876 | ||
996 | ‡2 DNB|126971129 | ||
996 | ‡2 LC|nr 96027198 | ||
996 | ‡2 DNB|1067834435 | ||
996 | ‡2 NUKAT|n 2017022234 | ||
996 | ‡2 BNC|981061195074206706 | ||
996 | ‡2 BNF|12518762 | ||
996 | ‡2 DNB|1136958738 | ||
996 | ‡2 NUKAT|n 2021021603 | ||
996 | ‡2 BNE|XX1550149 | ||
996 | ‡2 PLWABN|9810563762605606 | ||
996 | ‡2 LC|n 80014989 | ||
996 | ‡2 LC|no2003124011 | ||
996 | ‡2 LC|no2014099058 | ||
996 | ‡2 PTBNP|175961 | ||
996 | ‡2 ISNI|0000000362886444 | ||
996 | ‡2 SUDOC|029191440 | ||
996 | ‡2 BLBNB|000272427 | ||
996 | ‡2 NUKAT|n 2002019214 | ||
996 | ‡2 SUDOC|130417343 | ||
996 | ‡2 ISNI|0000000108161050 | ||
996 | ‡2 BNE|XX952947 | ||
996 | ‡2 ISNI|0000000000732122 | ||
996 | ‡2 DE633|pe40211561 | ||
996 | ‡2 BNE|XX1634676 | ||
996 | ‡2 SUDOC|165116986 | ||
996 | ‡2 BNE|XX1478852 | ||
996 | ‡2 W2Z|62758 | ||
996 | ‡2 BIBSYS|5059181 | ||
996 | ‡2 NUKAT|n 2010142051 | ||
996 | ‡2 LC|n 95043810 | ||
996 | ‡2 DNB|141208848 | ||
996 | ‡2 CAOONL|ncf11884138 | ||
996 | ‡2 SUDOC|105639052 | ||
996 | ‡2 PLWABN|9814007785005606 | ||
996 | ‡2 CAOONL|ncf11600733 | ||
996 | ‡2 W2Z|9039749 | ||
996 | ‡2 BNE|XX1070106 | ||
996 | ‡2 DNB|1090925271 | ||
996 | ‡2 BNE|XX1050562 | ||
996 | ‡2 LC|n 2006062582 | ||
996 | ‡2 BIBSYS|98057285 | ||
996 | ‡2 LC|no2011071012 | ||
996 | ‡2 ISNI|0000000379440043 | ||
996 | ‡2 NTA|332740838 | ||
996 | ‡2 LC|no2016018619 | ||
996 | ‡2 SELIBR|237983 | ||
996 | ‡2 DNB|122205421 | ||
996 | ‡2 LC|n 2004008311 | ||
996 | ‡2 NSK|000646407 | ||
996 | ‡2 ISNI|0000000039485261 | ||
996 | ‡2 BNE|XX5409477 | ||
996 | ‡2 ICCU|CFIV022266 | ||
996 | ‡2 BIBSYS|9039749 | ||
996 | ‡2 SUDOC|030866375 | ||
996 | ‡2 J9U|987007443894205171 | ||
996 | ‡2 BNF|13757603 | ||
996 | ‡2 NUKAT|n 2008127760 | ||
996 | ‡2 ISNI|0000000037893288 | ||
996 | ‡2 ISNI|0000000070406912 | ||
996 | ‡2 BNE|XX1505788 | ||
996 | ‡2 NYNYRILM|255941 | ||
996 | ‡2 DNB|1056527935 | ||
996 | ‡2 BNE|XX1166403 | ||
996 | ‡2 SUDOC|243840403 | ||
996 | ‡2 ISNI|0000000037061107 | ||
996 | ‡2 SUDOC|058654976 | ||
996 | ‡2 NTA|297852965 | ||
996 | ‡2 NUKAT|n 2015045507 | ||
996 | ‡2 LC|n 2002070752 | ||
996 | ‡2 ISNI|0000000123207803 | ||
996 | ‡2 LC|no 93038699 | ||
996 | ‡2 BNCHL|10000000000000000075988 | ||
996 | ‡2 SUDOC|073970700 | ||
996 | ‡2 BNE|XX1350305 | ||
996 | ‡2 ISNI|0000000447618908 | ||
996 | ‡2 BAV|495_108592 | ||
996 | ‡2 BNF|15574697 | ||
996 | ‡2 BAV|495_96309 | ||
996 | ‡2 ARBABN|000042151 | ||
996 | ‡2 ISNI|0000000025844163 | ||
996 | ‡2 ISNI|0000000060839802 | ||
996 | ‡2 LC|no2011141277 | ||
996 | ‡2 BNE|XX1556335 | ||
996 | ‡2 SUDOC|170802248 | ||
996 | ‡2 J9U|987007281439405171 | ||
996 | ‡2 BIBSYS|9078097 | ||
996 | ‡2 RERO|A025030517 | ||
996 | ‡2 BNE|XX838503 | ||
996 | ‡2 ARBABN|000056013 | ||
996 | ‡2 LC|n 2019043861 | ||
996 | ‡2 BIBSYS|1707990461020 | ||
996 | ‡2 ISNI|0000000437087314 | ||
996 | ‡2 ISNI|0000000060438371 | ||
996 | ‡2 SUDOC|070332746 | ||
996 | ‡2 ISNI|0000000042409737 | ||
996 | ‡2 BNE|XX4918345 | ||
996 | ‡2 SUDOC|118410946 | ||
996 | ‡2 PTBNP|1257950 | ||
996 | ‡2 BNCHL|10000000000000000181268 | ||
996 | ‡2 LC|n 91005221 | ||
996 | ‡2 ISNI|0000000117179666 | ||
996 | ‡2 DNB|129598445 | ||
996 | ‡2 DNB|14384654X | ||
996 | ‡2 BNF|16952191 | ||
996 | ‡2 SUDOC|170529924 | ||
996 | ‡2 CAOONL|ncf10729081 | ||
996 | ‡2 ISNI|0000000083558798 | ||
996 | ‡2 BNE|XX1145771 | ||
996 | ‡2 NKC|xx0045023 | ||
996 | ‡2 ISNI|0000000052439454 | ||
996 | ‡2 BNC|981058514764206706 | ||
996 | ‡2 BNF|16196657 | ||
996 | ‡2 ISNI|0000000059322670 | ||
996 | ‡2 ISNI|0000000354435299 | ||
996 | ‡2 BNE|XX5666390 | ||
996 | ‡2 ISNI|000000011545955X | ||
996 | ‡2 DNB|129979651 | ||
996 | ‡2 SUDOC|108449181 | ||
996 | ‡2 RERO|A017932406 | ||
996 | ‡2 DNB|1157232981 | ||
996 | ‡2 BNC|981061121467006706 | ||
996 | ‡2 BNE|XX952466 | ||
996 | ‡2 ISNI|0000000119237575 | ||
996 | ‡2 DNB|1057596329 | ||
996 | ‡2 BNE|XX1037439 | ||
996 | ‡2 RERO|A003164826 | ||
996 | ‡2 LC|n 2004142052 | ||
996 | ‡2 BNE|XX835273 | ||
996 | ‡2 BNE|XX4889238 | ||
996 | ‡2 J9U|987007394386205171 | ||
996 | ‡2 BNE|XX1709841 | ||
996 | ‡2 SUDOC|082328013 | ||
996 | ‡2 BAV|495_328157 | ||
996 | ‡2 RERO|A003314138 | ||
996 | ‡2 RERO|A003314139 | ||
996 | ‡2 LC|n 85078611 | ||
996 | ‡2 BNF|17955200 | ||
996 | ‡2 BNE|XX1077126 | ||
996 | ‡2 ICCU|CFIV252714 | ||
996 | ‡2 ISNI|000000005928351X | ||
996 | ‡2 LC|n 2004140459 | ||
996 | ‡2 NUKAT|n 2018282117 | ||
996 | ‡2 LC|n 92087339 | ||
996 | ‡2 CAOONL|ncf11430647 | ||
996 | ‡2 NKC|jk01032597 | ||
996 | ‡2 ISNI|0000000454351498 | ||
996 | ‡2 ISNI|0000000066790667 | ||
996 | ‡2 ISNI|0000000061572409 | ||
996 | ‡2 LC|no2002070986 | ||
996 | ‡2 DNB|1143851161 | ||
996 | ‡2 LC|n 94004534 | ||
996 | ‡2 ISNI|0000000433819901 | ||
996 | ‡2 BAV|495_90241 | ||
996 | ‡2 RERO|A026494017 | ||
996 | ‡2 ISNI|0000000031410476 | ||
996 | ‡2 BIBSYS|90953377 | ||
996 | ‡2 BNE|XX928649 | ||
996 | ‡2 BIBSYS|90073561 | ||
996 | ‡2 SUDOC|147619831 | ||
996 | ‡2 BNC|981060965432306706 | ||
996 | ‡2 BNF|14584576 | ||
996 | ‡2 BNE|XX1519872 | ||
996 | ‡2 LC|no2014049448 | ||
996 | ‡2 LC|n 2001105619 | ||
996 | ‡2 ISNI|0000000044509555 | ||
996 | ‡2 ISNI|000000003546093X | ||
996 | ‡2 SZ|1115361988 | ||
996 | ‡2 ISNI|0000000060987338 | ||
996 | ‡2 NII|DA11047378 | ||
996 | ‡2 RERO|A011866913 | ||
996 | ‡2 BNE|XX1294641 | ||
996 | ‡2 BNF|12086941 | ||
996 | ‡2 SUDOC|188332243 | ||
996 | ‡2 BNE|XX836380 | ||
996 | ‡2 ICCU|SBNV015140 | ||
996 | ‡2 SUDOC|086829955 | ||
996 | ‡2 ISNI|0000000059216835 | ||
996 | ‡2 LC|no2015141387 | ||
996 | ‡2 BNC|981058526472506706 | ||
996 | ‡2 DNB|173782825 | ||
996 | ‡2 J9U|987007319712405171 | ||
996 | ‡2 BNC|981058514764406706 | ||
996 | ‡2 ISNI|0000000059260705 | ||
996 | ‡2 LC|no2015106131 | ||
996 | ‡2 ISNI|0000000362777790 | ||
996 | ‡2 ISNI|0000000049581855 | ||
996 | ‡2 PLWABN|9814254812005606 | ||
996 | ‡2 RERO|A003314119 | ||
996 | ‡2 ISNI|0000000080007317 | ||
996 | ‡2 ISNI|0000000072257260 | ||
996 | ‡2 NTA|159320038 | ||
996 | ‡2 NTA|39073733X | ||
996 | ‡2 W2Z|1707990461020 | ||
996 | ‡2 BNE|XX5313302 | ||
996 | ‡2 NII|DA12302007 | ||
996 | ‡2 LC|n 2019185302 | ||
996 | ‡2 DNB|1115361988 | ||
996 | ‡2 PLWABN|9810544814005606 | ||
996 | ‡2 ISNI|0000000079707754 | ||
996 | ‡2 ISNI|0000000052658753 | ||
996 | ‡2 BNF|16048895 | ||
996 | ‡2 LC|n 2001059762 | ||
996 | ‡2 DNB|1078411409 | ||
996 | ‡2 SUDOC|254327672 | ||
996 | ‡2 NTA|400639327 | ||
996 | ‡2 BNF|12219615 | ||
996 | ‡2 BNE|XX1378088 | ||
996 | ‡2 LC|n 95920251 | ||
996 | ‡2 ISNI|0000000116705230 | ||
996 | ‡2 LC|no 97062532 | ||
996 | ‡2 NLA|000055138691 | ||
996 | ‡2 ISNI|0000000070922087 | ||
996 | ‡2 BNE|XX1075655 | ||
996 | ‡2 BNF|13481847 | ||
996 | ‡2 LC|no2015015928 | ||
996 | ‡2 BIBSYS|62758 | ||
996 | ‡2 BNC|981058609882106706 | ||
996 | ‡2 BNF|14488448 | ||
997 | ‡a 0 0 lived 0 0 ‡9 1 |