VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q61136041 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010731.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q61136041‏
024 ‎‡a 0000-0001-7447-328X‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q61136041‏
100 0 ‎‡a M Teresa Grande‏ ‎‡c researcher ORCID ID = 0000-0001-7447-328X‏ ‎‡9 en‏
375 ‎‡a 2‏ ‎‡2 iso5218‏
400 0 ‎‡a M Teresa Grande‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's Anti-inflammatory agents for smoking cessation? Focus on cognitive deficits associated with nicotine withdrawal in male mice‏
670 ‎‡a Author's Cannabinoid CB2 receptors in the mouse brain: relevance for Alzheimer's disease.‏
670 ‎‡a Author's Deletion of H-Ras decreases renal fibrosis and myofibroblast activation following ureteral obstruction in mice‏
670 ‎‡a Author's Effect of angiotensin II and small GTPase Ras signaling pathway inhibition on early renal changes in a murine model of obstructive nephropathy.‏
670 ‎‡a Author's Endocannabinoid regulation of amyloid-induced neuroinflammation.‏
670 ‎‡a Author's Increased oxidative stress, the renin-angiotensin system, and sympathetic overactivation induce hypertension in kidney androgen-regulated protein transgenic mice‏
670 ‎‡a Author's Kidney androgen-regulated protein transgenic mice show hypertension and renal alterations mediated by oxidative stress.‏
670 ‎‡a Author's Protective effect of new nitrosothiols on the early inflammatory response to kidney ischemia/reperfusion and transplantation in rats.‏
670 ‎‡a Author's Role of interleukin 1-beta in the inflammatory response in a fatty acid amide hydrolase-knockout mouse model of Alzheimer's disease‏
670 ‎‡a Author's Snail1-induced partial epithelial-to-mesenchymal transition drives renal fibrosis in mice and can be targeted to reverse established disease‏
670 ‎‡a Author's Targeted genomic disruption of h-ras induces hypotension through a NO-cGMP-PKG pathway-dependent mechanism.‏
670 ‎‡a Author's Therapeutical relevance of MAP-kinase inhibitors in renal diseases: current knowledge and future clinical perspectives.‏
670 ‎‡a Author's Tyrosine hydroxylase haploinsufficiency prevents age-associated arterial pressure elevation and increases half-life in mice.‏
909 ‎‡a (orcid) 000000017447328x‏ ‎‡9 1‏
919 ‎‡a tyrosinehydroxylasehaploinsufficiencypreventsageassociatedarterialpressureelevationandincreaseshalflifeinmice‏ ‎‡A Tyrosine hydroxylase haploinsufficiency prevents age-associated arterial pressure elevation and increases half-life in mice.‏ ‎‡9 1‏
919 ‎‡a therapeuticalrelevanceofmapkinaseinhibitorsinrenaldiseasescurrentknowledgeandfutureclinicalperspectives‏ ‎‡A Therapeutical relevance of MAP-kinase inhibitors in renal diseases: current knowledge and future clinical perspectives.‏ ‎‡9 1‏
919 ‎‡a targetedgenomicdisruptionofhrasinduceshypotensionthroughanocgmppkgpathwaydependentmechanism‏ ‎‡A Targeted genomic disruption of h-ras induces hypotension through a NO-cGMP-PKG pathway-dependent mechanism.‏ ‎‡9 1‏
919 ‎‡a snail1inducedpartialepithelialtomesenchymaltransitiondrivesrenalfibrosisinmiceandcanbetargetedtoreverseestablisheddisease‏ ‎‡A Snail1-induced partial epithelial-to-mesenchymal transition drives renal fibrosis in mice and can be targeted to reverse established disease‏ ‎‡9 1‏
919 ‎‡a roleofinterleukin1betaintheinflammatoryresponseinafattyacidamidehydrolaseknockoutmousemodelofalzheimersdisease‏ ‎‡A Role of interleukin 1-beta in the inflammatory response in a fatty acid amide hydrolase-knockout mouse model of Alzheimer's disease‏ ‎‡9 1‏
919 ‎‡a protectiveeffectofnewnitrosothiolsontheearlyinflammatoryresponsetokidneyischemiareperfusionandtransplantationinrats‏ ‎‡A Protective effect of new nitrosothiols on the early inflammatory response to kidney ischemia/reperfusion and transplantation in rats.‏ ‎‡9 1‏
919 ‎‡a kidneyandrogenregulatedproteintransgenicmiceshowhypertensionandrenalalterationsmediatedbyoxidativestress‏ ‎‡A Kidney androgen-regulated protein transgenic mice show hypertension and renal alterations mediated by oxidative stress.‏ ‎‡9 1‏
919 ‎‡a increasedoxidativestressthereninangiotensinsystemandsympatheticoveractivationinducehypertensioninkidneyandrogenregulatedproteintransgenicmice‏ ‎‡A Increased oxidative stress, the renin-angiotensin system, and sympathetic overactivation induce hypertension in kidney androgen-regulated protein transgenic mice‏ ‎‡9 1‏
919 ‎‡a endocannabinoidregulationofamyloidinducedneuroinflammation‏ ‎‡A Endocannabinoid regulation of amyloid-induced neuroinflammation.‏ ‎‡9 1‏
919 ‎‡a effectofangiotensin2andsmallgtpaserassignalingpathwayinhibitiononearlyrenalchangesinamurinemodelofobstructivenephropathy‏ ‎‡A Effect of angiotensin II and small GTPase Ras signaling pathway inhibition on early renal changes in a murine model of obstructive nephropathy.‏ ‎‡9 1‏
919 ‎‡a deletionofhrasdecreasesrenalfibrosisandmyofibroblastactivationfollowingureteralobstructioninmice‏ ‎‡A Deletion of H-Ras decreases renal fibrosis and myofibroblast activation following ureteral obstruction in mice‏ ‎‡9 1‏
919 ‎‡a cannabinoidcb2receptorsinthemousebrainrelevanceforalzheimersdisease‏ ‎‡A Cannabinoid CB2 receptors in the mouse brain: relevance for Alzheimer's disease.‏ ‎‡9 1‏
919 ‎‡a antiinflammatoryagentsforsmokingcessationfocusoncognitivedeficitsassociatedwithnicotinewithdrawalinmalemice‏ ‎‡A Anti-inflammatory agents for smoking cessation? Focus on cognitive deficits associated with nicotine withdrawal in male mice‏ ‎‡9 1‏
946 ‎‡a a‏ ‎‡9 1‏
996 ‎‡2 BNC|981058604950406706
996 ‎‡2 J9U|987007339524705171
996 ‎‡2 BNE|XX927876
996 ‎‡2 DNB|126971129
996 ‎‡2 LC|nr 96027198
996 ‎‡2 DNB|1067834435
996 ‎‡2 NUKAT|n 2017022234
996 ‎‡2 BNC|981061195074206706
996 ‎‡2 BNF|12518762
996 ‎‡2 DNB|1136958738
996 ‎‡2 NUKAT|n 2021021603
996 ‎‡2 BNE|XX1550149
996 ‎‡2 PLWABN|9810563762605606
996 ‎‡2 LC|n 80014989
996 ‎‡2 LC|no2003124011
996 ‎‡2 LC|no2014099058
996 ‎‡2 PTBNP|175961
996 ‎‡2 ISNI|0000000362886444
996 ‎‡2 SUDOC|029191440
996 ‎‡2 BLBNB|000272427
996 ‎‡2 NUKAT|n 2002019214
996 ‎‡2 SUDOC|130417343
996 ‎‡2 ISNI|0000000108161050
996 ‎‡2 BNE|XX952947
996 ‎‡2 ISNI|0000000000732122
996 ‎‡2 DE633|pe40211561
996 ‎‡2 BNE|XX1634676
996 ‎‡2 SUDOC|165116986
996 ‎‡2 BNE|XX1478852
996 ‎‡2 W2Z|62758
996 ‎‡2 BIBSYS|5059181
996 ‎‡2 NUKAT|n 2010142051
996 ‎‡2 LC|n 95043810
996 ‎‡2 DNB|141208848
996 ‎‡2 CAOONL|ncf11884138
996 ‎‡2 SUDOC|105639052
996 ‎‡2 PLWABN|9814007785005606
996 ‎‡2 CAOONL|ncf11600733
996 ‎‡2 W2Z|9039749
996 ‎‡2 BNE|XX1070106
996 ‎‡2 DNB|1090925271
996 ‎‡2 BNE|XX1050562
996 ‎‡2 LC|n 2006062582
996 ‎‡2 BIBSYS|98057285
996 ‎‡2 LC|no2011071012
996 ‎‡2 ISNI|0000000379440043
996 ‎‡2 NTA|332740838
996 ‎‡2 LC|no2016018619
996 ‎‡2 SELIBR|237983
996 ‎‡2 DNB|122205421
996 ‎‡2 LC|n 2004008311
996 ‎‡2 NSK|000646407
996 ‎‡2 ISNI|0000000039485261
996 ‎‡2 BNE|XX5409477
996 ‎‡2 ICCU|CFIV022266
996 ‎‡2 BIBSYS|9039749
996 ‎‡2 SUDOC|030866375
996 ‎‡2 J9U|987007443894205171
996 ‎‡2 BNF|13757603
996 ‎‡2 NUKAT|n 2008127760
996 ‎‡2 ISNI|0000000037893288
996 ‎‡2 ISNI|0000000070406912
996 ‎‡2 BNE|XX1505788
996 ‎‡2 NYNYRILM|255941
996 ‎‡2 DNB|1056527935
996 ‎‡2 BNE|XX1166403
996 ‎‡2 SUDOC|243840403
996 ‎‡2 ISNI|0000000037061107
996 ‎‡2 SUDOC|058654976
996 ‎‡2 NTA|297852965
996 ‎‡2 NUKAT|n 2015045507
996 ‎‡2 LC|n 2002070752
996 ‎‡2 ISNI|0000000123207803
996 ‎‡2 LC|no 93038699
996 ‎‡2 BNCHL|10000000000000000075988
996 ‎‡2 SUDOC|073970700
996 ‎‡2 BNE|XX1350305
996 ‎‡2 ISNI|0000000447618908
996 ‎‡2 BAV|495_108592
996 ‎‡2 BNF|15574697
996 ‎‡2 BAV|495_96309
996 ‎‡2 ARBABN|000042151
996 ‎‡2 ISNI|0000000025844163
996 ‎‡2 ISNI|0000000060839802
996 ‎‡2 LC|no2011141277
996 ‎‡2 BNE|XX1556335
996 ‎‡2 SUDOC|170802248
996 ‎‡2 J9U|987007281439405171
996 ‎‡2 BIBSYS|9078097
996 ‎‡2 RERO|A025030517
996 ‎‡2 BNE|XX838503
996 ‎‡2 ARBABN|000056013
996 ‎‡2 LC|n 2019043861
996 ‎‡2 BIBSYS|1707990461020
996 ‎‡2 ISNI|0000000437087314
996 ‎‡2 ISNI|0000000060438371
996 ‎‡2 SUDOC|070332746
996 ‎‡2 ISNI|0000000042409737
996 ‎‡2 BNE|XX4918345
996 ‎‡2 SUDOC|118410946
996 ‎‡2 PTBNP|1257950
996 ‎‡2 BNCHL|10000000000000000181268
996 ‎‡2 LC|n 91005221
996 ‎‡2 ISNI|0000000117179666
996 ‎‡2 DNB|129598445
996 ‎‡2 DNB|14384654X
996 ‎‡2 BNF|16952191
996 ‎‡2 SUDOC|170529924
996 ‎‡2 CAOONL|ncf10729081
996 ‎‡2 ISNI|0000000083558798
996 ‎‡2 BNE|XX1145771
996 ‎‡2 NKC|xx0045023
996 ‎‡2 ISNI|0000000052439454
996 ‎‡2 BNC|981058514764206706
996 ‎‡2 BNF|16196657
996 ‎‡2 ISNI|0000000059322670
996 ‎‡2 ISNI|0000000354435299
996 ‎‡2 BNE|XX5666390
996 ‎‡2 ISNI|000000011545955X
996 ‎‡2 DNB|129979651
996 ‎‡2 SUDOC|108449181
996 ‎‡2 RERO|A017932406
996 ‎‡2 DNB|1157232981
996 ‎‡2 BNC|981061121467006706
996 ‎‡2 BNE|XX952466
996 ‎‡2 ISNI|0000000119237575
996 ‎‡2 DNB|1057596329
996 ‎‡2 BNE|XX1037439
996 ‎‡2 RERO|A003164826
996 ‎‡2 LC|n 2004142052
996 ‎‡2 BNE|XX835273
996 ‎‡2 BNE|XX4889238
996 ‎‡2 J9U|987007394386205171
996 ‎‡2 BNE|XX1709841
996 ‎‡2 SUDOC|082328013
996 ‎‡2 BAV|495_328157
996 ‎‡2 RERO|A003314138
996 ‎‡2 RERO|A003314139
996 ‎‡2 LC|n 85078611
996 ‎‡2 BNF|17955200
996 ‎‡2 BNE|XX1077126
996 ‎‡2 ICCU|CFIV252714
996 ‎‡2 ISNI|000000005928351X
996 ‎‡2 LC|n 2004140459
996 ‎‡2 NUKAT|n 2018282117
996 ‎‡2 LC|n 92087339
996 ‎‡2 CAOONL|ncf11430647
996 ‎‡2 NKC|jk01032597
996 ‎‡2 ISNI|0000000454351498
996 ‎‡2 ISNI|0000000066790667
996 ‎‡2 ISNI|0000000061572409
996 ‎‡2 LC|no2002070986
996 ‎‡2 DNB|1143851161
996 ‎‡2 LC|n 94004534
996 ‎‡2 ISNI|0000000433819901
996 ‎‡2 BAV|495_90241
996 ‎‡2 RERO|A026494017
996 ‎‡2 ISNI|0000000031410476
996 ‎‡2 BIBSYS|90953377
996 ‎‡2 BNE|XX928649
996 ‎‡2 BIBSYS|90073561
996 ‎‡2 SUDOC|147619831
996 ‎‡2 BNC|981060965432306706
996 ‎‡2 BNF|14584576
996 ‎‡2 BNE|XX1519872
996 ‎‡2 LC|no2014049448
996 ‎‡2 LC|n 2001105619
996 ‎‡2 ISNI|0000000044509555
996 ‎‡2 ISNI|000000003546093X
996 ‎‡2 SZ|1115361988
996 ‎‡2 ISNI|0000000060987338
996 ‎‡2 NII|DA11047378
996 ‎‡2 RERO|A011866913
996 ‎‡2 BNE|XX1294641
996 ‎‡2 BNF|12086941
996 ‎‡2 SUDOC|188332243
996 ‎‡2 BNE|XX836380
996 ‎‡2 ICCU|SBNV015140
996 ‎‡2 SUDOC|086829955
996 ‎‡2 ISNI|0000000059216835
996 ‎‡2 LC|no2015141387
996 ‎‡2 BNC|981058526472506706
996 ‎‡2 DNB|173782825
996 ‎‡2 J9U|987007319712405171
996 ‎‡2 BNC|981058514764406706
996 ‎‡2 ISNI|0000000059260705
996 ‎‡2 LC|no2015106131
996 ‎‡2 ISNI|0000000362777790
996 ‎‡2 ISNI|0000000049581855
996 ‎‡2 PLWABN|9814254812005606
996 ‎‡2 RERO|A003314119
996 ‎‡2 ISNI|0000000080007317
996 ‎‡2 ISNI|0000000072257260
996 ‎‡2 NTA|159320038
996 ‎‡2 NTA|39073733X
996 ‎‡2 W2Z|1707990461020
996 ‎‡2 BNE|XX5313302
996 ‎‡2 NII|DA12302007
996 ‎‡2 LC|n 2019185302
996 ‎‡2 DNB|1115361988
996 ‎‡2 PLWABN|9810544814005606
996 ‎‡2 ISNI|0000000079707754
996 ‎‡2 ISNI|0000000052658753
996 ‎‡2 BNF|16048895
996 ‎‡2 LC|n 2001059762
996 ‎‡2 DNB|1078411409
996 ‎‡2 SUDOC|254327672
996 ‎‡2 NTA|400639327
996 ‎‡2 BNF|12219615
996 ‎‡2 BNE|XX1378088
996 ‎‡2 LC|n 95920251
996 ‎‡2 ISNI|0000000116705230
996 ‎‡2 LC|no 97062532
996 ‎‡2 NLA|000055138691
996 ‎‡2 ISNI|0000000070922087
996 ‎‡2 BNE|XX1075655
996 ‎‡2 BNF|13481847
996 ‎‡2 LC|no2015015928
996 ‎‡2 BIBSYS|62758
996 ‎‡2 BNC|981058609882106706
996 ‎‡2 BNF|14488448
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏