VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q64011860 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000210.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q64011860‏
024 ‎‡a 0000-0002-7849-8254‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q64011860‏
100 0 ‎‡a Yu-Chia Chang‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Yu-Chia Chang‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 1H NMR-Based Isolation of Anti-Inflammatory 9,11-Secosteroids from the Octocoral Sinularia leptoclados‏
670 ‎‡a Author's A new 5α,8α-Epidioxysterol from the soft coral Sinularia gaweli.‏
670 ‎‡a Author's BAY 41-2272 Attenuates CTGF Expression via sGC/cGMP-Independent Pathway in TGFβ1-Activated Hepatic Stellate Cells‏
670 ‎‡a Author's Briarane diterpenoids isolated from gorgonian corals between 2011 and 2013‏
670 ‎‡a Author's Briarenolides U-Y, New Anti-Inflammatory Briarane Diterpenoids from an Octocoral Briareum sp. (Briareidae)‏
670 ‎‡a Author's Briaviolides K-N, New Briarane-Type Diterpenoids from Cultured Octocoral Briareum violaceum.‏
670 ‎‡a Author's Chlorinated briarane diterpenoids from the sea whip gorgonian corals Junceella fragilis and Ellisella robusta‏
670 ‎‡a Author's Chlorinated briarane diterpenoids from the sea whip gorgonian corals Junceella fragilis and Ellisella robusta (Ellisellidae).‏
670 ‎‡a Author's Columnaristerol A, a novel 19-norsterol from the Formosan octocoral Nephthea columnaris‏
670 ‎‡a Author's Discovery of new eunicellin-based diterpenoids from a Formosan soft coral Cladiella sp.‏
670 ‎‡a Author's Flexibilide obtained from cultured soft coral has anti-neuroinflammatory and analgesic effects through the upregulation of spinal transforming growth factor-β1 in neuropathic rats‏
670 ‎‡a Author's Fragilides K and L, New Briaranes from the Gorgonian Coral Junceella fragilis‏
670 ‎‡a Author's (-)-Hydroxylindestrenolide, a new sesquiterpenoid from a gorgonian coral Menella sp. (Plexauridae).‏
670 ‎‡a Author's Isolation of marine bacteria with antimicrobial activities from cultured and field-collected soft corals.‏
670 ‎‡a Author's Marine-derived protein kinase inhibitors for neuroinflammatory diseases.‏
670 ‎‡a Author's Natural product chemistry of gorgonian corals of the family Plexauridae distributed in the Indo-Pacific Ocean‏
670 ‎‡a Author's New 9-Hydroxybriarane Diterpenoids from a Gorgonian Coral Briareum sp. (Briareidae).‏
670 ‎‡a Author's New Anti-Inflammatory 9,11-Secosterols with a Rare Tricyclo[5,2,1,1]decane Ring from a Formosan Gorgonian Pinnigorgia sp.‏
670 ‎‡a Author's New Anti-inflammatory Norcembranoids from the Soft Coral Sinularia numerosa.‏
670 ‎‡a Author's New Marine Sterols from a Gorgonian Pinnigorgia sp.‏
670 ‎‡a Author's New marine sterols from an algal-bearing gorgonian coral Pinnigorgia sp.‏
670 ‎‡a Author's Novel Caryophyllane-Related Sesquiterpenoids with Anti-Inflammatory Activity from Rumphella antipathes (Linnaeus, 1758)‏
670 ‎‡a Author's Pinnisterols A-C, New 9,11-Secosterols from a Gorgonian Pinnigorgia sp.‏
670 ‎‡a Author's Pinnisterols D-J, New 11-Acetoxy-9,11-secosterols with a 1,4-Quinone Moiety from Formosan Gorgonian Coral Pinnigorgia sp. (Gorgoniidae).‏
670 ‎‡a Author's Secondary metabolites from the soft coral Sinularia arborea‏
670 ‎‡a Author's Sponge-Derived 24-Homoscalaranes as Potent Anti-Inflammatory Agents‏
670 ‎‡a Author's Terpenoids from Octocorals of the Genus Pachyclavularia.‏
670 ‎‡a Author's The Bioactive Extract of Pinnigorgia sp. Induces Apoptosis of Hepatic Stellate Cells via ROS-ERK/JNK-Caspase-3 Signaling.‏
670 ‎‡a Author's Untargeted LC-MS/MS-Based Multi-Informative Molecular Networking for Targeting the Antiproliferative Ingredients in Tetradium ruticarpum Fruit‏
909 ‎‡a (orcid) 0000000278498254‏ ‎‡9 1‏
919 ‎‡a spongederived24homoscalaranesaspotentantiinflammatoryagents‏ ‎‡A Sponge-Derived 24-Homoscalaranes as Potent Anti-Inflammatory Agents‏ ‎‡9 1‏
919 ‎‡a pinnisterols500jnew11acetoxy911secosterolswitha14quinonemoietyfromformosangorgoniancoralpinnigorgiaspgorgoniidae‏ ‎‡A Pinnisterols D-J, New 11-Acetoxy-9,11-secosterols with a 1,4-Quinone Moiety from Formosan Gorgonian Coral Pinnigorgia sp. (Gorgoniidae).‏ ‎‡9 1‏
919 ‎‡a pinnisterolsa100new911secosterolsfromagorgonianpinnigorgiasp‏ ‎‡A Pinnisterols A-C, New 9,11-Secosterols from a Gorgonian Pinnigorgia sp.‏ ‎‡9 1‏
919 ‎‡a novelcaryophyllanerelatedsesquiterpenoidswithantiinflammatoryactivityfromrumphellaantipatheslinnaeus‏ ‎‡A Novel Caryophyllane-Related Sesquiterpenoids with Anti-Inflammatory Activity from Rumphella antipathes (Linnaeus, 1758)‏ ‎‡9 1‏
919 ‎‡a bioactiveextractofpinnigorgiaspinducesapoptosisofhepaticstellatecellsviaroserkjnkcaspase3signaling‏ ‎‡A The Bioactive Extract of Pinnigorgia sp. Induces Apoptosis of Hepatic Stellate Cells via ROS-ERK/JNK-Caspase-3 Signaling.‏ ‎‡9 1‏
919 ‎‡a newmarinesterolsfromanalgalbearinggorgoniancoralpinnigorgiasp‏ ‎‡A New marine sterols from an algal-bearing gorgonian coral Pinnigorgia sp.‏ ‎‡9 1‏
919 ‎‡a newmarinesterolsfromagorgonianpinnigorgiasp‏ ‎‡A New Marine Sterols from a Gorgonian Pinnigorgia sp.‏ ‎‡9 1‏
919 ‎‡a newantiinflammatorynorcembranoidsfromthesoftcoralsinularianumerosa‏ ‎‡A New Anti-inflammatory Norcembranoids from the Soft Coral Sinularia numerosa.‏ ‎‡9 1‏
919 ‎‡a newantiinflammatory911secosterolswithararetricyclodecaneringfromaformosangorgonianpinnigorgiasp‏ ‎‡A New Anti-Inflammatory 9,11-Secosterols with a Rare Tricyclo[5,2,1,1]decane Ring from a Formosan Gorgonian Pinnigorgia sp.‏ ‎‡9 1‏
919 ‎‡a new9hydroxybriaranediterpenoidsfromagorgoniancoralbriareumspbriareidae‏ ‎‡A New 9-Hydroxybriarane Diterpenoids from a Gorgonian Coral Briareum sp. (Briareidae).‏ ‎‡9 1‏
919 ‎‡a naturalproductchemistryofgorgoniancoralsofthefamilyplexauridaedistributedintheindopacificocean‏ ‎‡A Natural product chemistry of gorgonian corals of the family Plexauridae distributed in the Indo-Pacific Ocean‏ ‎‡9 1‏
919 ‎‡a marinederivedproteinkinaseinhibitorsforneuroinflammatorydiseases‏ ‎‡A Marine-derived protein kinase inhibitors for neuroinflammatory diseases.‏ ‎‡9 1‏
919 ‎‡a isolationofmarinebacteriawithantimicrobialactivitiesfromculturedandfieldcollectedsoftcorals‏ ‎‡A Isolation of marine bacteria with antimicrobial activities from cultured and field-collected soft corals.‏ ‎‡9 1‏
919 ‎‡a plexauridae‏ ‎‡A (Plexauridae).‏ ‎‡9 1‏
919 ‎‡a fragilideskand50newbriaranesfromthegorgoniancoraljunceellafragilis‏ ‎‡A Fragilides K and L, New Briaranes from the Gorgonian Coral Junceella fragilis‏ ‎‡9 1‏
919 ‎‡a flexibilideobtainedfromculturedsoftcoralhasantineuroinflammatoryandanalgesiceffectsthroughtheupregulationofspinaltransforminggrowthfactorβ1inneuropathicrats‏ ‎‡A Flexibilide obtained from cultured soft coral has anti-neuroinflammatory and analgesic effects through the upregulation of spinal transforming growth factor-β1 in neuropathic rats‏ ‎‡9 1‏
919 ‎‡a discoveryofneweunicellinbasedditerpenoidsfromaformosansoftcoralcladiellasp‏ ‎‡A Discovery of new eunicellin-based diterpenoids from a Formosan soft coral Cladiella sp.‏ ‎‡9 1‏
919 ‎‡a columnaristerolaanovel19norsterolfromtheformosanoctocoralnephtheacolumnaris‏ ‎‡A Columnaristerol A, a novel 19-norsterol from the Formosan octocoral Nephthea columnaris‏ ‎‡9 1‏
919 ‎‡a chlorinatedbriaranediterpenoidsfromtheseawhipgorgoniancoralsjunceellafragilisandellisellarobustaellisellidae‏ ‎‡A Chlorinated briarane diterpenoids from the sea whip gorgonian corals Junceella fragilis and Ellisella robusta (Ellisellidae).‏ ‎‡9 1‏
919 ‎‡a chlorinatedbriaranediterpenoidsfromtheseawhipgorgoniancoralsjunceellafragilisandellisellarobusta‏ ‎‡A Chlorinated briarane diterpenoids from the sea whip gorgonian corals Junceella fragilis and Ellisella robusta‏ ‎‡9 1‏
919 ‎‡a briaviolidesknnewbriaranetypediterpenoidsfromculturedoctocoralbriareumviolaceum‏ ‎‡A Briaviolides K-N, New Briarane-Type Diterpenoids from Cultured Octocoral Briareum violaceum.‏ ‎‡9 1‏
919 ‎‡a briarenolidesuynewantiinflammatorybriaranediterpenoidsfromanoctocoralbriareumspbriareidae‏ ‎‡A Briarenolides U-Y, New Anti-Inflammatory Briarane Diterpenoids from an Octocoral Briareum sp. (Briareidae)‏ ‎‡9 1‏
919 ‎‡a briaranediterpenoidsisolatedfromgorgoniancoralsbetween2011and‏ ‎‡A Briarane diterpenoids isolated from gorgonian corals between 2011 and 2013‏ ‎‡9 1‏
919 ‎‡a bay412272attenuatesctgfexpressionviasgccgmpindependentpathwayintgfβ1activatedhepaticstellatecells‏ ‎‡A BAY 41-2272 Attenuates CTGF Expression via sGC/cGMP-Independent Pathway in TGFβ1-Activated Hepatic Stellate Cells‏ ‎‡9 1‏
919 ‎‡a new5α8αepidioxysterolfromthesoftcoralsinulariagaweli‏ ‎‡A A new 5α,8α-Epidioxysterol from the soft coral Sinularia gaweli.‏ ‎‡9 1‏
919 ‎‡a 1hnmrbasedisolationofantiinflammatory911secosteroidsfromtheoctocoralsinularialeptoclados‏ ‎‡A 1H NMR-Based Isolation of Anti-Inflammatory 9,11-Secosteroids from the Octocoral Sinularia leptoclados‏ ‎‡9 1‏
919 ‎‡a untargetedlcmsmsbasedmultiinformativemolecularnetworkingfortargetingtheantiproliferativeingredientsintetradiumruticarpumfruit‏ ‎‡A Untargeted LC-MS/MS-Based Multi-Informative Molecular Networking for Targeting the Antiproliferative Ingredients in Tetradium ruticarpum Fruit‏ ‎‡9 1‏
919 ‎‡a secondarymetabolitesfromthesoftcoralsinulariaarborea‏ ‎‡A Secondary metabolites from the soft coral Sinularia arborea‏ ‎‡9 1‏
919 ‎‡a terpenoidsfromoctocoralsofthegenuspachyclavularia‏ ‎‡A Terpenoids from Octocorals of the Genus Pachyclavularia.‏ ‎‡9 1‏
943 ‎‡a 175x‏ ‎‡A 1758‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2013‏ ‎‡9 1‏
996 ‎‡2 NKC|xx0255656‏
996 ‎‡2 LC|n 83209049‏
996 ‎‡2 CYT|AC000223022‏
996 ‎‡2 LC|n 81093496‏
996 ‎‡2 ISNI|0000000064218480‏
996 ‎‡2 CYT|AC000618334‏
996 ‎‡2 ISNI|0000000051786016‏
996 ‎‡2 DNB|1060754711‏
996 ‎‡2 CAOONL|ncf10399693‏
996 ‎‡2 NKC|pna2009495228‏
996 ‎‡2 LC|no2010086828‏
996 ‎‡2 ISNI|0000000084336660‏
996 ‎‡2 CYT|AC000226862‏
996 ‎‡2 CYT|AC000003214‏
996 ‎‡2 CYT|AC000226861‏
996 ‎‡2 ISNI|0000000505695961‏
996 ‎‡2 LC|nr 93030493‏
996 ‎‡2 CYT|AC000579196‏
996 ‎‡2 SUDOC|083283293‏
996 ‎‡2 CYT|AC000226236‏
996 ‎‡2 CYT|AC000613476‏
996 ‎‡2 CYT|AC000226233‏
996 ‎‡2 ISNI|0000000052744491‏
996 ‎‡2 DNB|132056399‏
996 ‎‡2 CYT|AC000577095‏
996 ‎‡2 DNB|1110784066‏
996 ‎‡2 NUKAT|n 2012213201‏
996 ‎‡2 ISNI|0000000460163127‏
996 ‎‡2 CYT|AC000226918‏
996 ‎‡2 NUKAT|n 2012068257‏
996 ‎‡2 ISNI|0000000079659553‏
996 ‎‡2 RERO|A003094791‏
996 ‎‡2 SUDOC|03273414X‏
996 ‎‡2 BIBSYS|1642068373415‏
996 ‎‡2 ISNI|0000000118556515‏
996 ‎‡2 LC|n 85360104‏
996 ‎‡2 SUDOC|241031796‏
996 ‎‡2 LC|no2005111906‏
996 ‎‡2 LC|n 88118780‏
996 ‎‡2 LC|nr 95046603‏
996 ‎‡2 LC|no2008185554‏
996 ‎‡2 W2Z|11074679‏
996 ‎‡2 DNB|1123103186‏
996 ‎‡2 ISNI|0000000064287814‏
996 ‎‡2 CAOONL|ncf11533873‏
996 ‎‡2 CYT|AC000618797‏
996 ‎‡2 CYT|AC000618418‏
996 ‎‡2 CYT|AC000445211‏
996 ‎‡2 ISNI|0000000063877150‏
996 ‎‡2 ISNI|0000000381447164‏
996 ‎‡2 CYT|AC000259056‏
996 ‎‡2 SUDOC|227397924‏
996 ‎‡2 LC|n 80019480‏
996 ‎‡2 ISNI|0000000032343535‏
996 ‎‡2 SUDOC|24103275X‏
996 ‎‡2 ISNI|0000000083028973‏
996 ‎‡2 CYT|AC000337019‏
996 ‎‡2 LC|n 99046912‏
996 ‎‡2 LC|no2003128635‏
996 ‎‡2 LC|n 88254820‏
996 ‎‡2 LC|no2009001965‏
996 ‎‡2 DNB|1027307876‏
996 ‎‡2 LC|n 2021033282‏
996 ‎‡2 LC|n 78051793‏
996 ‎‡2 LC|n 83029862‏
996 ‎‡2 CYT|AC000252352‏
996 ‎‡2 ISNI|0000000063395039‏
996 ‎‡2 LC|n 89118481‏
996 ‎‡2 ISNI|000000006366813X‏
996 ‎‡2 ISNI|0000000048242640‏
996 ‎‡2 JPG|500328449‏
996 ‎‡2 LC|n 82245442‏
996 ‎‡2 LC|n 87906730‏
996 ‎‡2 LC|nr 94041634‏
996 ‎‡2 LC|n 85258909‏
996 ‎‡2 RERO|A008593524‏
996 ‎‡2 J9U|987007375745805171‏
996 ‎‡2 J9U|987010400029505171‏
996 ‎‡2 LC|no2011000232‏
996 ‎‡2 LC|no2023108906‏
996 ‎‡2 NTA|069586187‏
996 ‎‡2 LC|n 82024259‏
996 ‎‡2 SUDOC|199472726‏
996 ‎‡2 J9U|987007429018805171‏
996 ‎‡2 LC|n 82122731‏
996 ‎‡2 SUDOC|197351689‏
996 ‎‡2 LC|n 2016036124‏
996 ‎‡2 ISNI|0000000063652525‏
996 ‎‡2 SUDOC|168414511‏
996 ‎‡2 LC|n 85214035‏
996 ‎‡2 ISNI|000000006926315X‏
996 ‎‡2 ISNI|0000000064006592‏
996 ‎‡2 DNB|1266429115‏
996 ‎‡2 CYT|AC000587410‏
996 ‎‡2 J9U|987007461196805171‏
996 ‎‡2 LC|nr 98031602‏
996 ‎‡2 LC|n 88107327‏
996 ‎‡2 LC|nr 00007011‏
996 ‎‡2 CYT|AC000227514‏
996 ‎‡2 LC|n 78069759‏
996 ‎‡2 ISNI|0000000064162210‏
996 ‎‡2 CYT|AC000226465‏
996 ‎‡2 DNB|1183001738‏
996 ‎‡2 LC|n 84231524‏
996 ‎‡2 DNB|1048250989‏
996 ‎‡2 LC|n 84032325‏
996 ‎‡2 LC|nr 99016337‏
996 ‎‡2 CYT|AC000226919‏
996 ‎‡2 CYT|AC000602896‏
996 ‎‡2 CYT|AC000226916‏
996 ‎‡2 CYT|AC000226915‏
996 ‎‡2 CYT|AC000149195‏
996 ‎‡2 J9U|987007430405205171‏
996 ‎‡2 LC|nr 93030561‏
996 ‎‡2 J9U|987007402697305171‏
996 ‎‡2 NII|DA06368634‏
996 ‎‡2 LC|nr 89008358‏
996 ‎‡2 LC|n 2020023793‏
996 ‎‡2 PLWABN|9810531942605606‏
996 ‎‡2 SUDOC|082010609‏
996 ‎‡2 BIBSYS|90126912‏
996 ‎‡2 LC|n 94036276‏
996 ‎‡2 CYT|AC000621346‏
996 ‎‡2 ISNI|0000000113045230‏
996 ‎‡2 SUDOC|110179307‏
996 ‎‡2 DNB|142885223‏
996 ‎‡2 DNB|1062211898‏
996 ‎‡2 J9U|987007320644705171‏
996 ‎‡2 BNE|XX1640529‏
996 ‎‡2 ISNI|0000000409496356‏
996 ‎‡2 PLWABN|9814233201805606‏
996 ‎‡2 DNB|108196247X‏
996 ‎‡2 ISNI|0000000027236997‏
996 ‎‡2 ISNI|0000000025700813‏
996 ‎‡2 LC|no2011052259‏
996 ‎‡2 LC|n 88031476‏
996 ‎‡2 ISNI|0000000064372509‏
996 ‎‡2 LC|no2006126357‏
996 ‎‡2 ISNI|0000000063467071‏
996 ‎‡2 CYT|AC000226775‏
996 ‎‡2 LC|n 78076505‏
996 ‎‡2 J9U|987007322252905171‏
996 ‎‡2 CAOONL|ncf11580935‏
996 ‎‡2 DNB|1245902075‏
996 ‎‡2 PLWABN|9812648599205606‏
996 ‎‡2 ISNI|000000044462232X‏
996 ‎‡2 DNB|1168493684‏
996 ‎‡2 CYT|AC000004068‏
996 ‎‡2 RERO|A023276645‏
996 ‎‡2 J9U|987007297986605171‏
996 ‎‡2 CYT|AC000597911‏
996 ‎‡2 SUDOC|272847976‏
996 ‎‡2 ISNI|0000000080153330‏
996 ‎‡2 LC|n 81114035‏
996 ‎‡2 CYT|AC000227551‏
996 ‎‡2 ISNI|0000000018724913‏
996 ‎‡2 ISNI|0000000078896055‏
996 ‎‡2 PLWABN|9810577559005606‏
996 ‎‡2 NUKAT|n 2011205463‏
996 ‎‡2 DNB|1169932177‏
996 ‎‡2 DNB|1211523993‏
996 ‎‡2 DNB|1204660395‏
996 ‎‡2 SUDOC|143434519‏
996 ‎‡2 ISNI|0000000478818240‏
996 ‎‡2 DNB|123256755‏
996 ‎‡2 ISNI|0000000064299786‏
996 ‎‡2 DNB|126054207‏
996 ‎‡2 CYT|AC000585829‏
996 ‎‡2 DNB|132890313‏
996 ‎‡2 LC|nr 92005263‏
996 ‎‡2 LC|nr 99023252‏
996 ‎‡2 ISNI|000000007142037X‏
996 ‎‡2 CYT|AC000405395‏
996 ‎‡2 NII|DA02388709‏
996 ‎‡2 DNB|1043514732‏
996 ‎‡2 LC|no2016141180‏
996 ‎‡2 PLWABN|9810564662505606‏
996 ‎‡2 LC|n 81095057‏
996 ‎‡2 LC|n 83178858‏
996 ‎‡2 LC|nr 94022634‏
996 ‎‡2 LC|no2010180479‏
996 ‎‡2 ISNI|0000000408431112‏
996 ‎‡2 LC|nr 97017417‏
996 ‎‡2 SUDOC|120715538‏
996 ‎‡2 LC|n 88293281‏
996 ‎‡2 ISNI|0000000120282357‏
996 ‎‡2 LC|nr 94001003‏
996 ‎‡2 ISNI|0000000028853727‏
996 ‎‡2 ISNI|0000000063130620‏
996 ‎‡2 LC|n 85258597‏
996 ‎‡2 RERO|A009038804‏
996 ‎‡2 ISNI|0000000063902029‏
996 ‎‡2 ISNI|0000000047680999‏
996 ‎‡2 LC|n 94046777‏
996 ‎‡2 BNF|14966875‏
996 ‎‡2 ISNI|0000000036750760‏
996 ‎‡2 ISNI|0000000486034622‏
996 ‎‡2 CYT|AC000597192‏
996 ‎‡2 LC|nr 96001745‏
996 ‎‡2 SUDOC|241036429‏
996 ‎‡2 ISNI|0000000495676125‏
996 ‎‡2 LC|n 90609098‏
996 ‎‡2 ISNI|0000000063452283‏
996 ‎‡2 ISNI|0000000063958516‏
996 ‎‡2 CYT|AC000226922‏
996 ‎‡2 CYT|AC000226921‏
996 ‎‡2 ISNI|0000000379982440‏
996 ‎‡2 NII|DA09362543‏
996 ‎‡2 BNF|17781840‏
996 ‎‡2 LC|nr 95036098‏
996 ‎‡2 LC|n 82036492‏
996 ‎‡2 SUDOC|181142597‏
996 ‎‡2 DNB|1053076916‏
996 ‎‡2 ISNI|0000000064204601‏
996 ‎‡2 LC|n 80130215‏
996 ‎‡2 J9U|987007342632705171‏
996 ‎‡2 ISNI|0000000063355475‏
996 ‎‡2 LC|n 85170373‏
996 ‎‡2 ISNI|0000000032595214‏
996 ‎‡2 SUDOC|20321949X‏
996 ‎‡2 LC|no2020118030‏
996 ‎‡2 ISNI|0000000381377776‏
996 ‎‡2 NSK|000733712‏
996 ‎‡2 CYT|AC000619234‏
996 ‎‡2 ISNI|0000000049395593‏
996 ‎‡2 PLWABN|9812648599105606‏
996 ‎‡2 DNB|123031745‏
996 ‎‡2 LC|nr 96037498‏
996 ‎‡2 LC|n 85336449‏
996 ‎‡2 ISNI|0000000064109524‏
996 ‎‡2 ISNI|0000000445912791‏
996 ‎‡2 LC|no2017120400‏
996 ‎‡2 ISNI|0000000382610090‏
996 ‎‡2 J9U|987007352277305171‏
996 ‎‡2 ISNI|000000006594904X‏
996 ‎‡2 LC|n 88230976‏
996 ‎‡2 LC|n 82046831‏
996 ‎‡2 LC|n 87924274‏
996 ‎‡2 ISNI|0000000051533908‏
996 ‎‡2 LC|no 97024927‏
996 ‎‡2 SUDOC|100517315‏
996 ‎‡2 CYT|AC000226589‏
996 ‎‡2 LC|n 81101978‏
996 ‎‡2 BNF|12208800‏
996 ‎‡2 LC|n 82118646‏
996 ‎‡2 CYT|AC000227509‏
996 ‎‡2 J9U|987007315333705171‏
996 ‎‡2 CYT|AC000615302‏
996 ‎‡2 ISNI|000000002772347X‏
996 ‎‡2 SELIBR|285972‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏