VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q73391329 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235812.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q73391329‏
024 ‎‡a 0000-0001-6858-9710‏ ‎‡2 orcid‏
024 ‎‡a 8617533500‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q73391329‏
100 0 ‎‡a মার্ক জোন্স‏ ‎‡9 bn‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Mark Jones‏ ‎‡c Australian researcher on stuttering (ORCID 0000-0001-6858-9710)‏ ‎‡9 en‏
670 ‎‡a Author's A graphical method for assessing agreement with the mean between multiple observers using continuous measures.‏
670 ‎‡a Author's A new method to sample stuttering in preschool children.‏
670 ‎‡a Author's A >or=1 log rise in RQ-PCR transcript levels defines molecular relapse in core binding factor acute myeloid leukemia and predicts subsequent morphologic relapse.‏
670 ‎‡a Author's A Phase II Trial of Telehealth Delivery of the Lidcombe Program of Early Stuttering Intervention‏
670 ‎‡a Author's A preliminary study of atorvastatin plasma concentrations in critically ill patients with sepsis.‏
670 ‎‡a Author's A prospective cohort study of geriatric syndromes among older medical patients admitted to acute care hospitals‏
670 ‎‡a Author's A speech and psychological profile of treatment-seeking adolescents who stutter‏
670 ‎‡a Author's A U-Shaped Relationship between Body Mass Index and Dysmenorrhea: A Longitudinal Study.‏
670 ‎‡a Author's Absolute and relative reliability of percentage of syllables stuttered and severity rating scales.‏
670 ‎‡a Author's Accuracy and interobserver reliability of three-dimensional rotational angiography versus mathematical models for volumetric measurement of intracranial aneurysms.‏
670 ‎‡a Author's Acute fluid shifts influence the assessment of serum vitamin D status in critically ill patients.‏
670 ‎‡a Author's An Experimental Investigation of the Effect of Altered Auditory Feedback on the Conversational Speech of Adults Who Stutter‏
670 ‎‡a Author's An in vitro analysis of the effect of acidosis on coagulation in chronic disease states - a thromboelastograph study.‏
670 ‎‡a Author's An investigation of language and phonological development and the responsiveness of preschool age children to the Lidcombe Program.‏
670 ‎‡a Author's An investigation of the role of parental request for self-correction of stuttering in the Lidcombe Program‏
670 ‎‡a Author's Analytical results in longitudinal studies depended on target of inference and assumed mechanism of attrition‏
670 ‎‡a Author's Assessing attentional biases with stuttering‏
670 ‎‡a Author's Assessing the effect of estimation error on risk-adjusted CUSUM chart performance.‏
670 ‎‡a Author's Bright-field in situ hybridization for HER2 gene amplification in breast cancer using tissue microarrays: correlation between chromogenic‏
670 ‎‡a Author's Bright-field in situ hybridization for HER2 gene amplification in breast cancer using tissue microarrays: correlation between chromogenic (CISH) and automated silver-enhanced (SISH) methods with patient outcome.‏
670 ‎‡a Author's Catheter-associated bloodstream infection incidence and risk factors in adults with cancer: a prospective cohort study.‏
670 ‎‡a Author's Cessation of immunosuppression during chemotherapy for post-transplant lymphoproliferative disorders in renal transplant patients.‏
670 ‎‡a Author's Clinical characteristics of bloodstream infections due to ampicillin-sulbactam-resistant, non-extended- spectrum-beta-lactamase-producing Escherichia coli and the role of TEM-1 hyperproduction.‏
670 ‎‡a Author's Clinician percent syllables stuttered, clinician severity ratings and speaker severity ratings: are they interchangeable?‏
670 ‎‡a Author's Combined effect of education and reproductive history on weight trajectories of young Australian women: A longitudinal study.‏
670 ‎‡a Author's Commentary on Cochrane review of neuraminidase inhibitors for preventing and treating influenza in healthy adults and children.‏
670 ‎‡a Author's Community-onset Escherichia coli infection resistant to expanded-spectrum cephalosporins in low-prevalence countries.‏
670 ‎‡a Author's Comparison of audio and audiovisual measures of adult stuttering: Implications for clinical trials‏
670 ‎‡a Author's Comparisons of audio and audiovisual measures of stuttering frequency and severity in preschool-age children.‏
670 ‎‡a Author's Contemporaneous severity of symptoms and functioning reflected by variations in reporting doctor-diagnosed osteoarthritis‏
670 ‎‡a Author's Continuation of Statin Therapy in Patients with Presumed Infection‏
670 ‎‡a Author's Development of a risk-adjustment model for antimicrobial utilization data in 21 public hospitals in Queensland, Australia (2006-11).‏
670 ‎‡a Author's Do Factors That Predict Attrition Change Across Waves in a Longitudinal Study of Older Women?‏
670 ‎‡a Author's Do random estimations of vitamin D3 and parathyroid hormone reflect the 24-h profile in the critically ill?‏
670 ‎‡a Author's Doubtful Model Utility in Predicting High Vancomycin Minimum Inhibitory Concentration Methicillin-Resistant Staphylococcus aureus Bloodstream Infection Episodes‏
670 ‎‡a Author's Dual tasking and stuttering: from the laboratory to the clinic‏
670 ‎‡a Author's Educational mobility and weight gain over 13 years in a longitudinal study of young women‏
670 ‎‡a Author's Effect of a hypertonic balanced ketone solution on plasma, CSF and brain beta-hydroxybutyrate levels and acid-base status.‏
670 ‎‡a Author's Effectiveness of the Lidcombe Program for early stuttering in Australian community clinics‏
670 ‎‡a Author's Endoluminal repair of abdominal aortic aneurysm prevents enlargement of the proximal neck: a 9-year life-table and 5-year longitudinal study‏
670 ‎‡a Author's Energy and protein intakes of hospitalised patients with acute respiratory failure receiving non-invasive ventilation.‏
670 ‎‡a Author's Evidence for extra-renal production of 1α,25(OH)2D 3 in critical illness: a preliminary study.‏
670 ‎‡a Author's Extended follow-up of a randomized controlled trial of the Lidcombe Program of Early Stuttering Intervention‏
670 ‎‡a Author's Femoral nerve block vs fascia iliaca block for total knee arthroplasty postoperative pain control: a prospective, randomized controlled trial.‏
670 ‎‡a Author's Funnel plots and risk-adjusted count data adverse events. A limitation of indirect standardisation.‏
670 ‎‡a Author's Further development and validation of the Unhelpful Thoughts and Beliefs About Stuttering‏
670 ‎‡a Author's Further development and validation of the Unhelpful Thoughts and Beliefs About Stuttering (UTBAS) scales: relationship to anxiety and social phobia among adults who stutter.‏
670 ‎‡a Author's Group lidcombe program treatment for early stuttering: a randomized controlled trial‏
670 ‎‡a Author's High education and increased parity are associated with breast-feeding initiation and duration among Australian women.‏
670 ‎‡a Author's Illicit drug use, early age at first use and risk of premenstrual syndrome: A longitudinal study.‏
670 ‎‡a Author's Immortal time bias in observational studies of time-to-event outcomes‏
670 ‎‡a Author's Improved hospital-level risk adjustment for surveillance of healthcare-associated bloodstream infections: a retrospective cohort study‏
670 ‎‡a Author's Increases in Australian cutaneous abscess hospitalisations: 1999-2008.‏
670 ‎‡a Author's Indocyanine green elimination: a comparison of the LiMON and serial blood sampling methods.‏
670 ‎‡a Author's Lidcombe Program Webcam Treatment for Early Stuttering: A Randomized Controlled Trial.‏
670 ‎‡a Author's Long-term Consequences of Noninjurious and Injurious Falls on Well-being in Older Women‏
670 ‎‡a Author's Mark Jones's reply to Myles and Leonardi-Bee's response to his critique of their paper reported in The BMJ.‏
670 ‎‡a Author's Methicillin-resistant Staphylococcus aureus vancomycin susceptibility testing: methodology correlations, temporal trends and clonal patterns‏
670 ‎‡a Author's Multimorbidity patterns are differentially associated with functional ability and decline in a longitudinal cohort of older women‏
670 ‎‡a Author's Neuraminidase inhibitors for influenza: a systematic review and meta-analysis of regulatory and mortality data.‏
670 ‎‡a Author's Neuraminidase inhibitors for preventing and treating influenza in healthy adults: systematic review and meta-analysis‏
670 ‎‡a Author's Neuropsychiatric adverse events and oseltamivir for prophylaxis.‏
670 ‎‡a Author's New-Onset Diabetes After Statin Exposure in Elderly Women: The Australian Longitudinal Study on Women's Health.‏
670 ‎‡a Author's Oseltamivir and early deterioration leading to death: a proportional mortality study for 2009A/H1N1 influenza.‏
670 ‎‡a Author's Oseltamivir for influenza‏
670 ‎‡a Author's Outcomes of multimodality breast screening for women at increased risk of familial breast cancer‏
670 ‎‡a Author's Parent verbal contingencies during the Lidcombe Program: Observations and statistical modeling of the treatment process‏
670 ‎‡a Author's Patient-reported outcomes after discontinuation of long-term topical corticosteroid treatment for atopic dermatitis: a targeted cross-sectional survey‏
670 ‎‡a Author's Placebo disclosure rate in randomized controlled trials involving critically ill patients‏
670 ‎‡a Author's Post-exposure passive immunisation for preventing measles‏
670 ‎‡a Author's Predicting treatment time with the Lidcombe Program: replication and meta-analysis.‏
670 ‎‡a Author's Prediction of hospital outcome in septic shock: a prospective comparison of tissue Doppler and cardiac biomarkers‏
670 ‎‡a Author's Premenstrual syndrome and dysmenorrhea: symptom trajectories over 13 years in young adults.‏
670 ‎‡a Author's Prevalence of anxiety disorders among children who stutter‏
670 ‎‡a Author's Pro-inflammatory activity in rats of thiocyanate, a metabolite of the hydrocyanic acid inhaled from tobacco smoke.‏
670 ‎‡a Author's Prognostic utility of spontaneous erythroid colony formation and JAK2 mutational analysis for thrombotic events in essential thrombocythaemia.‏
670 ‎‡a Author's Prolonged carriage of resistant E. coli by returned travellers: clonality, risk factors and bacterial characteristics‏
670 ‎‡a Author's Protective effect of hormone therapy among women with hysterectomy/oophorectomy.‏
670 ‎‡a Author's Psychiatric adverse events in oseltamivir prophylaxis trials: Novel comparative analysis using data obtained from clinical study reports‏
670 ‎‡a Author's Random measurements of adiponectin and IL-6 may not be indicative of the 24-h profile in critically ill patients.‏
670 ‎‡a Author's Randomized controlled non-inferiority trial of a telehealth treatment for chronic stuttering: the Camperdown Program.‏
670 ‎‡a Author's Randomized controlled trial of video self-modeling following speech restructuring treatment for stuttering.‏
670 ‎‡a Author's Refining esophageal cancer staging after neoadjuvant therapy: importance of treatment response.‏
670 ‎‡a Author's Risk Stratification for Early Esophageal Adenocarcinoma: Analysis of Lymphatic Spread and Prognostic Factors‏
670 ‎‡a Author's Serial changes in plasma ketone concentrations in patients with acute brain injury.‏
670 ‎‡a Author's Serial changes in plasma total cortisol, plasma free cortisol, and tissue cortisol activity in patients with septic shock: an observational study‏
670 ‎‡a Author's Skin excisions: not so simple for the regionally based general surgical trainee.‏
670 ‎‡a Author's Smoking and trajectories of dysmenorrhoea among young Australian women‏
670 ‎‡a Author's Statin therapy is associated with fewer deaths in patients with bacteraemia‏
670 ‎‡a Author's Statistical and methodological concerns about the beneficial effect of neuraminidase inhibitors on mortality.‏
670 ‎‡a Author's Statistical power in stuttering research: a tutorial.‏
670 ‎‡a Author's Stuttering severity and educational attainment.‏
670 ‎‡a Author's Terror mismanagement: evidence that mortality salience exacerbates attentional bias in social anxiety‏
670 ‎‡a Author's The Chinese herbal formulation biminne in management of perennial allergic rhinitis: a randomized, double-blind, placebo-controlled, 12-week clinical trial.‏
670 ‎‡a Author's The decline in Activities of Daily Living at Discharge‏
670 ‎‡a Author's The decline in Activities of Daily Living at Discharge (DADLD) index: stratifying patients at lower and higher risk.‏
670 ‎‡a Author's The effect of aromatherapy massage with music on the stress and anxiety levels of emergency nurses: comparison between summer and winter.‏
670 ‎‡a Author's The five factor model of personality applied to adults who stutter.‏
670 ‎‡a Author's The Higher Care At Discharge Index‏
670 ‎‡a Author's The Higher Care At Discharge Index (HCDI): identifying older patients at risk of requiring a higher level of care at discharge.‏
670 ‎‡a Author's The impact of extended-hours home hemodialysis and buttonhole cannulation technique on hospitalization rates for septic events related to dialysis access.‏
670 ‎‡a Author's The prevalence and risk factors of dysmenorrhea.‏
670 ‎‡a Author's The utility of thromboelastography in monitoring low molecular weight heparin therapy in the coronary care unit.‏
670 ‎‡a Author's Tissue Doppler in critical illness: a retrospective cohort study.‏
670 ‎‡a Author's Toward improved surveillance: the impact of ventilator-associated complications on length of stay and antibiotic use in patients in intensive care units.‏
670 ‎‡a Author's Treating stuttering in young children: predicting treatment time in the Lidcombe Program‏
670 ‎‡a Author's Unscheduled telephone calls to measure percent syllables stuttered during clinical trials‏
670 ‎‡a Author's Use of Online or Paper Surveys by Australian Women: Longitudinal Study of Users, Devices, and Cohort Retention‏
670 ‎‡a Author's Using statistical process control charts to study stuttering frequency variability during a single day.‏
670 ‎‡a Author's Vancomycin heteroresistance is associated with reduced mortality in ST239 methicillin-resistant Staphylococcus aureus blood stream infections.‏
670 ‎‡a Author's Variability of cortisol assays can confound the diagnosis of adrenal insufficiency in the critically ill population.‏
670 ‎‡a Author's Visualising and modelling changes in categorical variables in longitudinal studies‏
670 ‎‡a Author's Zanamivir for influenza in adults and children: systematic review of clinical study reports and summary of regulatory comments‏
909 ‎‡a (scopus) 8617533500‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000168589710‏ ‎‡9 1‏
919 ‎‡a proinflammatoryactivityinratsofthiocyanateametaboliteofthehydrocyanicacidinhaledfromtobaccosmoke‏ ‎‡A Pro-inflammatory activity in rats of thiocyanate, a metabolite of the hydrocyanic acid inhaled from tobacco smoke.‏ ‎‡9 1‏
919 ‎‡a prognosticutilityofspontaneouserythroidcolonyformationandjak2mutationalanalysisforthromboticeventsinessentialthrombocythaemia‏ ‎‡A Prognostic utility of spontaneous erythroid colony formation and JAK2 mutational analysis for thrombotic events in essential thrombocythaemia.‏ ‎‡9 1‏
919 ‎‡a prolongedcarriageofresistantecolibyreturnedtravellersclonalityriskfactorsandbacterialcharacteristics‏ ‎‡A Prolonged carriage of resistant E. coli by returned travellers: clonality, risk factors and bacterial characteristics‏ ‎‡9 1‏
919 ‎‡a prevalenceofanxietydisordersamongchildrenwhostutter‏ ‎‡A Prevalence of anxiety disorders among children who stutter‏ ‎‡9 1‏
919 ‎‡a protectiveeffectofhormonetherapyamongwomenwithhysterectomyoophorectomy‏ ‎‡A Protective effect of hormone therapy among women with hysterectomy/oophorectomy.‏ ‎‡9 1‏
919 ‎‡a premenstrualsyndromeanddysmenorrheasymptomtrajectoriesover13yearsinyoungadults‏ ‎‡A Premenstrual syndrome and dysmenorrhea: symptom trajectories over 13 years in young adults.‏ ‎‡9 1‏
919 ‎‡a psychiatricadverseeventsinoseltamivirprophylaxistrialsnovelcomparativeanalysisusingdataobtainedfromclinicalstudyreports‏ ‎‡A Psychiatric adverse events in oseltamivir prophylaxis trials: Novel comparative analysis using data obtained from clinical study reports‏ ‎‡9 1‏
919 ‎‡a randommeasurementsofadiponectinandil6maynotbeindicativeofthe24hprofileincriticallyillpatients‏ ‎‡A Random measurements of adiponectin and IL-6 may not be indicative of the 24-h profile in critically ill patients.‏ ‎‡9 1‏
919 ‎‡a randomizedcontrollednoninferioritytrialofatelehealthtreatmentforchronicstutteringthecamperdownprogram‏ ‎‡A Randomized controlled non-inferiority trial of a telehealth treatment for chronic stuttering: the Camperdown Program.‏ ‎‡9 1‏
919 ‎‡a randomizedcontrolledtrialofvideoselfmodelingfollowingspeechrestructuringtreatmentforstuttering‏ ‎‡A Randomized controlled trial of video self-modeling following speech restructuring treatment for stuttering.‏ ‎‡9 1‏
919 ‎‡a predictionofhospitaloutcomeinsepticshockaprospectivecomparisonoftissuedopplerandcardiacbiomarkers‏ ‎‡A Prediction of hospital outcome in septic shock: a prospective comparison of tissue Doppler and cardiac biomarkers‏ ‎‡9 1‏
919 ‎‡a predictingtreatmenttimewiththelidcombeprogramreplicationandmetaanalysis‏ ‎‡A Predicting treatment time with the Lidcombe Program: replication and meta-analysis.‏ ‎‡9 1‏
919 ‎‡a refiningesophagealcancerstagingafterneoadjuvanttherapyimportanceoftreatmentresponse‏ ‎‡A Refining esophageal cancer staging after neoadjuvant therapy: importance of treatment response.‏ ‎‡9 1‏
919 ‎‡a riskstratificationforearlyesophagealadenocarcinomaanalysisoflymphaticspreadandprognosticfactors‏ ‎‡A Risk Stratification for Early Esophageal Adenocarcinoma: Analysis of Lymphatic Spread and Prognostic Factors‏ ‎‡9 1‏
919 ‎‡a postexposurepassiveimmunisationforpreventingmeasles‏ ‎‡A Post-exposure passive immunisation for preventing measles‏ ‎‡9 1‏
919 ‎‡a placebodisclosurerateinrandomizedcontrolledtrialsinvolvingcriticallyillpatients‏ ‎‡A Placebo disclosure rate in randomized controlled trials involving critically ill patients‏ ‎‡9 1‏
919 ‎‡a serialchangesinplasmaketoneconcentrationsinpatientswithacutebraininjury‏ ‎‡A Serial changes in plasma ketone concentrations in patients with acute brain injury.‏ ‎‡9 1‏
919 ‎‡a serialchangesinplasmatotalcortisolplasmafreecortisolandtissuecortisolactivityinpatientswithsepticshockanobservationalstudy‏ ‎‡A Serial changes in plasma total cortisol, plasma free cortisol, and tissue cortisol activity in patients with septic shock: an observational study‏ ‎‡9 1‏
919 ‎‡a patientreportedoutcomesafterdiscontinuationoflongtermtopicalcorticosteroidtreatmentforatopicdermatitisatargetedcrosssectionalsurvey‏ ‎‡A Patient-reported outcomes after discontinuation of long-term topical corticosteroid treatment for atopic dermatitis: a targeted cross-sectional survey‏ ‎‡9 1‏
919 ‎‡a skinexcisionsnotsosimplefortheregionallybasedgeneralsurgicaltrainee‏ ‎‡A Skin excisions: not so simple for the regionally based general surgical trainee.‏ ‎‡9 1‏
919 ‎‡a smokingandtrajectoriesofdysmenorrhoeaamongyoungaustralianwomen‏ ‎‡A Smoking and trajectories of dysmenorrhoea among young Australian women‏ ‎‡9 1‏
919 ‎‡a parentverbalcontingenciesduringthelidcombeprogramobservationsandstatisticalmodelingofthetreatmentprocess‏ ‎‡A Parent verbal contingencies during the Lidcombe Program: Observations and statistical modeling of the treatment process‏ ‎‡9 1‏
919 ‎‡a outcomesofmultimodalitybreastscreeningforwomenatincreasedriskoffamilialbreastcancer‏ ‎‡A Outcomes of multimodality breast screening for women at increased risk of familial breast cancer‏ ‎‡9 1‏
919 ‎‡a oseltamivirandearlydeteriorationleadingtodeathaproportionalmortalitystudyfor2009ah1n1influenza‏ ‎‡A Oseltamivir and early deterioration leading to death: a proportional mortality study for 2009A/H1N1 influenza.‏ ‎‡9 1‏
919 ‎‡a statintherapyisassociatedwithfewerdeathsinpatientswithbacteraemia‏ ‎‡A Statin therapy is associated with fewer deaths in patients with bacteraemia‏ ‎‡9 1‏
919 ‎‡a statisticalandmethodologicalconcernsaboutthebeneficialeffectofneuraminidaseinhibitorsonmortality‏ ‎‡A Statistical and methodological concerns about the beneficial effect of neuraminidase inhibitors on mortality.‏ ‎‡9 1‏
919 ‎‡a statisticalpowerinstutteringresearchatutorial‏ ‎‡A Statistical power in stuttering research: a tutorial.‏ ‎‡9 1‏
919 ‎‡a stutteringseverityandeducationalattainment‏ ‎‡A Stuttering severity and educational attainment.‏ ‎‡9 1‏
919 ‎‡a terrormismanagementevidencethatmortalitysalienceexacerbatesattentionalbiasinsocialanxiety‏ ‎‡A Terror mismanagement: evidence that mortality salience exacerbates attentional bias in social anxiety‏ ‎‡9 1‏
919 ‎‡a chineseherbalformulationbiminneinmanagementofperennialallergicrhinitisarandomizeddoubleblindplacebocontrolled12weekclinicaltrial‏ ‎‡A The Chinese herbal formulation biminne in management of perennial allergic rhinitis: a randomized, double-blind, placebo-controlled, 12-week clinical trial.‏ ‎‡9 1‏
919 ‎‡a declineinactivitiesofdailylivingatdischarge‏ ‎‡A The decline in Activities of Daily Living at Discharge‏ ‎‡9 1‏
919 ‎‡a declineinactivitiesofdailylivingatdischargedadldindexstratifyingpatientsatlowerandhigherrisk‏ ‎‡A The decline in Activities of Daily Living at Discharge (DADLD) index: stratifying patients at lower and higher risk.‏ ‎‡9 1‏
919 ‎‡a effectofaromatherapymassagewithmusiconthestressandanxietylevelsofemergencynursescomparisonbetweensummerandwinter‏ ‎‡A The effect of aromatherapy massage with music on the stress and anxiety levels of emergency nurses: comparison between summer and winter.‏ ‎‡9 1‏
919 ‎‡a newonsetdiabetesafterstatinexposureinelderlywomentheaustralianlongitudinalstudyonwomenshealth‏ ‎‡A New-Onset Diabetes After Statin Exposure in Elderly Women: The Australian Longitudinal Study on Women's Health.‏ ‎‡9 1‏
919 ‎‡a neuropsychiatricadverseeventsandoseltamivirforprophylaxis‏ ‎‡A Neuropsychiatric adverse events and oseltamivir for prophylaxis.‏ ‎‡9 1‏
919 ‎‡a 5factormodelofpersonalityappliedtoadultswhostutter‏ ‎‡A The five factor model of personality applied to adults who stutter.‏ ‎‡9 1‏
919 ‎‡a neuraminidaseinhibitorsforpreventingandtreatinginfluenzainhealthyadultssystematicreviewandmetaanalysis‏ ‎‡A Neuraminidase inhibitors for preventing and treating influenza in healthy adults: systematic review and meta-analysis‏ ‎‡9 1‏
919 ‎‡a neuraminidaseinhibitorsforinfluenzaasystematicreviewandmetaanalysisofregulatoryandmortalitydata‏ ‎‡A Neuraminidase inhibitors for influenza: a systematic review and meta-analysis of regulatory and mortality data.‏ ‎‡9 1‏
919 ‎‡a multimorbiditypatternsaredifferentiallyassociatedwithfunctionalabilityanddeclineinalongitudinalcohortofolderwomen‏ ‎‡A Multimorbidity patterns are differentially associated with functional ability and decline in a longitudinal cohort of older women‏ ‎‡9 1‏
919 ‎‡a methicillinresistantstaphylococcusaureusvancomycinsusceptibilitytestingmethodologycorrelationstemporaltrendsandclonalpatterns‏ ‎‡A Methicillin-resistant Staphylococcus aureus vancomycin susceptibility testing: methodology correlations, temporal trends and clonal patterns‏ ‎‡9 1‏
919 ‎‡a markjonessreplytomylesandleonardibeesresponsetohiscritiqueoftheirpaperreportedinthebmj‏ ‎‡A Mark Jones's reply to Myles and Leonardi-Bee's response to his critique of their paper reported in The BMJ.‏ ‎‡9 1‏
919 ‎‡a highercareatdischargeindex‏ ‎‡A The Higher Care At Discharge Index‏ ‎‡9 1‏
919 ‎‡a longtermconsequencesofnoninjuriousandinjuriousfallsonwellbeinginolderwomen‏ ‎‡A Long-term Consequences of Noninjurious and Injurious Falls on Well-being in Older Women‏ ‎‡9 1‏
919 ‎‡a lidcombeprogramwebcamtreatmentforearlystutteringarandomizedcontrolledtrial‏ ‎‡A Lidcombe Program Webcam Treatment for Early Stuttering: A Randomized Controlled Trial.‏ ‎‡9 1‏
919 ‎‡a indocyaninegreeneliminationacomparisonofthelimonandserialbloodsamplingmethods‏ ‎‡A Indocyanine green elimination: a comparison of the LiMON and serial blood sampling methods.‏ ‎‡9 1‏
919 ‎‡a increasesinaustraliancutaneousabscesshospitalisations1999‏ ‎‡A Increases in Australian cutaneous abscess hospitalisations: 1999-2008.‏ ‎‡9 1‏
919 ‎‡a highercareatdischargeindexhcdiidentifyingolderpatientsatriskofrequiringahigherlevelofcareatdischarge‏ ‎‡A The Higher Care At Discharge Index (HCDI): identifying older patients at risk of requiring a higher level of care at discharge.‏ ‎‡9 1‏
919 ‎‡a improvedhospitallevelriskadjustmentforsurveillanceofhealthcareassociatedbloodstreaminfectionsaretrospectivecohortstudy‏ ‎‡A Improved hospital-level risk adjustment for surveillance of healthcare-associated bloodstream infections: a retrospective cohort study‏ ‎‡9 1‏
919 ‎‡a immortaltimebiasinobservationalstudiesoftimetoeventoutcomes‏ ‎‡A Immortal time bias in observational studies of time-to-event outcomes‏ ‎‡9 1‏
919 ‎‡a illicitdruguseearlyageat1useandriskofpremenstrualsyndromealongitudinalstudy‏ ‎‡A Illicit drug use, early age at first use and risk of premenstrual syndrome: A longitudinal study.‏ ‎‡9 1‏
919 ‎‡a impactofextendedhourshomehemodialysisandbuttonholecannulationtechniqueonhospitalizationratesforsepticeventsrelatedtodialysisaccess‏ ‎‡A The impact of extended-hours home hemodialysis and buttonhole cannulation technique on hospitalization rates for septic events related to dialysis access.‏ ‎‡9 1‏
919 ‎‡a higheducationandincreasedparityareassociatedwithbreastfeedinginitiationanddurationamongaustralianwomen‏ ‎‡A High education and increased parity are associated with breast-feeding initiation and duration among Australian women.‏ ‎‡9 1‏
919 ‎‡a grouplidcombeprogramtreatmentforearlystutteringarandomizedcontrolledtrial‏ ‎‡A Group lidcombe program treatment for early stuttering: a randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a furtherdevelopmentandvalidationoftheunhelpfulthoughtsandbeliefsaboutstutteringutbasscalesrelationshiptoanxietyandsocialphobiaamongadultswhostutter‏ ‎‡A Further development and validation of the Unhelpful Thoughts and Beliefs About Stuttering (UTBAS) scales: relationship to anxiety and social phobia among adults who stutter.‏ ‎‡9 1‏
919 ‎‡a prevalenceandriskfactorsofdysmenorrhea‏ ‎‡A The prevalence and risk factors of dysmenorrhea.‏ ‎‡9 1‏
919 ‎‡a furtherdevelopmentandvalidationoftheunhelpfulthoughtsandbeliefsaboutstuttering‏ ‎‡A Further development and validation of the Unhelpful Thoughts and Beliefs About Stuttering‏ ‎‡9 1‏
919 ‎‡a utilityofthromboelastographyinmonitoringlowmolecularweightheparintherapyinthecoronarycareunit‏ ‎‡A The utility of thromboelastography in monitoring low molecular weight heparin therapy in the coronary care unit.‏ ‎‡9 1‏
919 ‎‡a tissuedopplerincriticalillnessaretrospectivecohortstudy‏ ‎‡A Tissue Doppler in critical illness: a retrospective cohort study.‏ ‎‡9 1‏
919 ‎‡a towardimprovedsurveillancetheimpactofventilatorassociatedcomplicationsonlengthofstayandantibioticuseinpatientsinintensivecareunits‏ ‎‡A Toward improved surveillance: the impact of ventilator-associated complications on length of stay and antibiotic use in patients in intensive care units.‏ ‎‡9 1‏
919 ‎‡a treatingstutteringinyoungchildrenpredictingtreatmenttimeinthelidcombeprogram‏ ‎‡A Treating stuttering in young children: predicting treatment time in the Lidcombe Program‏ ‎‡9 1‏
919 ‎‡a unscheduledtelephonecallstomeasurepercentsyllablesstutteredduringclinicaltrials‏ ‎‡A Unscheduled telephone calls to measure percent syllables stuttered during clinical trials‏ ‎‡9 1‏
919 ‎‡a useofonlineorpapersurveysbyaustralianwomenlongitudinalstudyofusersdevicesandcohortretention‏ ‎‡A Use of Online or Paper Surveys by Australian Women: Longitudinal Study of Users, Devices, and Cohort Retention‏ ‎‡9 1‏
919 ‎‡a usingstatisticalprocesscontrolchartstostudystutteringfrequencyvariabilityduringasingleday‏ ‎‡A Using statistical process control charts to study stuttering frequency variability during a single day.‏ ‎‡9 1‏
919 ‎‡a vancomycinheteroresistanceisassociatedwithreducedmortalityinst239methicillinresistantstaphylococcusaureusbloodstreaminfections‏ ‎‡A Vancomycin heteroresistance is associated with reduced mortality in ST239 methicillin-resistant Staphylococcus aureus blood stream infections.‏ ‎‡9 1‏
919 ‎‡a variabilityofcortisolassayscanconfoundthediagnosisofadrenalinsufficiencyinthecriticallyillpopulation‏ ‎‡A Variability of cortisol assays can confound the diagnosis of adrenal insufficiency in the critically ill population.‏ ‎‡9 1‏
919 ‎‡a visualisingandmodellingchangesincategoricalvariablesinlongitudinalstudies‏ ‎‡A Visualising and modelling changes in categorical variables in longitudinal studies‏ ‎‡9 1‏
919 ‎‡a funnelplotsandriskadjustedcountdataadverseeventsalimitationofindirectstandardisation‏ ‎‡A Funnel plots and risk-adjusted count data adverse events. A limitation of indirect standardisation.‏ ‎‡9 1‏
919 ‎‡a femoralnerveblockvsfasciailiacablockfortotalkneearthroplastypostoperativepaincontrolaprospectiverandomizedcontrolledtrial‏ ‎‡A Femoral nerve block vs fascia iliaca block for total knee arthroplasty postoperative pain control: a prospective, randomized controlled trial.‏ ‎‡9 1‏
919 ‎‡a extendedfollowupofarandomizedcontrolledtrialofthelidcombeprogramofearlystutteringintervention‏ ‎‡A Extended follow-up of a randomized controlled trial of the Lidcombe Program of Early Stuttering Intervention‏ ‎‡9 1‏
919 ‎‡a evidenceforextrarenalproductionof1α2552d3incriticalillnessapreliminarystudy‏ ‎‡A Evidence for extra-renal production of 1α,25(OH)2D 3 in critical illness: a preliminary study.‏ ‎‡9 1‏
919 ‎‡a zanamivirforinfluenzainadultsandchildrensystematicreviewofclinicalstudyreportsandsummaryofregulatorycomments‏ ‎‡A Zanamivir for influenza in adults and children: systematic review of clinical study reports and summary of regulatory comments‏ ‎‡9 1‏
919 ‎‡a energyandproteinintakesofhospitalisedpatientswithacuterespiratoryfailurereceivingnoninvasiveventilation‏ ‎‡A Energy and protein intakes of hospitalised patients with acute respiratory failure receiving non-invasive ventilation.‏ ‎‡9 1‏
919 ‎‡a endoluminalrepairofabdominalaorticaneurysmpreventsenlargementoftheproximalnecka9yearlifetableand5yearlongitudinalstudy‏ ‎‡A Endoluminal repair of abdominal aortic aneurysm prevents enlargement of the proximal neck: a 9-year life-table and 5-year longitudinal study‏ ‎‡9 1‏
919 ‎‡a effectivenessofthelidcombeprogramforearlystutteringinaustraliancommunityclinics‏ ‎‡A Effectiveness of the Lidcombe Program for early stuttering in Australian community clinics‏ ‎‡9 1‏
919 ‎‡a effectofahypertonicbalancedketonesolutiononplasmacsfandbrainbetahydroxybutyratelevelsandacidbasestatus‏ ‎‡A Effect of a hypertonic balanced ketone solution on plasma, CSF and brain beta-hydroxybutyrate levels and acid-base status.‏ ‎‡9 1‏
919 ‎‡a educationalmobilityandweightgainover13yearsinalongitudinalstudyofyoungwomen‏ ‎‡A Educational mobility and weight gain over 13 years in a longitudinal study of young women‏ ‎‡9 1‏
919 ‎‡a dualtaskingandstutteringfromthelaboratorytotheclinic‏ ‎‡A Dual tasking and stuttering: from the laboratory to the clinic‏ ‎‡9 1‏
919 ‎‡a doubtfulmodelutilityinpredictinghighvancomycinminimuminhibitoryconcentrationmethicillinresistantstaphylococcusaureusbloodstreaminfectionepisodes‏ ‎‡A Doubtful Model Utility in Predicting High Vancomycin Minimum Inhibitory Concentration Methicillin-Resistant Staphylococcus aureus Bloodstream Infection Episodes‏ ‎‡9 1‏
919 ‎‡a dorandomestimationsofvitamind3andparathyroidhormonereflectthe24hprofileinthecriticallyill‏ ‎‡A Do random estimations of vitamin D3 and parathyroid hormone reflect the 24-h profile in the critically ill?‏ ‎‡9 1‏
919 ‎‡a dofactorsthatpredictattritionchangeacrosswavesinalongitudinalstudyofolderwomen‏ ‎‡A Do Factors That Predict Attrition Change Across Waves in a Longitudinal Study of Older Women?‏ ‎‡9 1‏
919 ‎‡a developmentofariskadjustmentmodelforantimicrobialutilizationdatain21publichospitalsinqueenslandaustralia200611‏ ‎‡A Development of a risk-adjustment model for antimicrobial utilization data in 21 public hospitals in Queensland, Australia (2006-11).‏ ‎‡9 1‏
919 ‎‡a continuationofstatintherapyinpatientswithpresumedinfection‏ ‎‡A Continuation of Statin Therapy in Patients with Presumed Infection‏ ‎‡9 1‏
919 ‎‡a contemporaneousseverityofsymptomsandfunctioningreflectedbyvariationsinreportingdoctordiagnosedosteoarthritis‏ ‎‡A Contemporaneous severity of symptoms and functioning reflected by variations in reporting doctor-diagnosed osteoarthritis‏ ‎‡9 1‏
919 ‎‡a comparisonsofaudioandaudiovisualmeasuresofstutteringfrequencyandseverityinpreschoolagechildren‏ ‎‡A Comparisons of audio and audiovisual measures of stuttering frequency and severity in preschool-age children.‏ ‎‡9 1‏
919 ‎‡a comparisonofaudioandaudiovisualmeasuresofadultstutteringimplicationsforclinicaltrials‏ ‎‡A Comparison of audio and audiovisual measures of adult stuttering: Implications for clinical trials‏ ‎‡9 1‏
919 ‎‡a communityonsetescherichiacoliinfectionresistanttoexpandedspectrumcephalosporinsinlowprevalencecountries‏ ‎‡A Community-onset Escherichia coli infection resistant to expanded-spectrum cephalosporins in low-prevalence countries.‏ ‎‡9 1‏
919 ‎‡a commentaryoncochranereviewofneuraminidaseinhibitorsforpreventingandtreatinginfluenzainhealthyadultsandchildren‏ ‎‡A Commentary on Cochrane review of neuraminidase inhibitors for preventing and treating influenza in healthy adults and children.‏ ‎‡9 1‏
919 ‎‡a combinedeffectofeducationandreproductivehistoryonweighttrajectoriesofyoungaustralianwomenalongitudinalstudy‏ ‎‡A Combined effect of education and reproductive history on weight trajectories of young Australian women: A longitudinal study.‏ ‎‡9 1‏
919 ‎‡a clinicianpercentsyllablesstutteredclinicianseverityratingsandspeakerseverityratingsaretheyinterchangeable‏ ‎‡A Clinician percent syllables stuttered, clinician severity ratings and speaker severity ratings: are they interchangeable?‏ ‎‡9 1‏
919 ‎‡a clinicalcharacteristicsofbloodstreaminfectionsduetoampicillinsulbactamresistantnonextendedspectrumbetalactamaseproducingescherichiacoliandtheroleoftem1hyperproduction‏ ‎‡A Clinical characteristics of bloodstream infections due to ampicillin-sulbactam-resistant, non-extended- spectrum-beta-lactamase-producing Escherichia coli and the role of TEM-1 hyperproduction.‏ ‎‡9 1‏
919 ‎‡a cessationofimmunosuppressionduringchemotherapyforposttransplantlymphoproliferativedisordersinrenaltransplantpatients‏ ‎‡A Cessation of immunosuppression during chemotherapy for post-transplant lymphoproliferative disorders in renal transplant patients.‏ ‎‡9 1‏
919 ‎‡a catheterassociatedbloodstreaminfectionincidenceandriskfactorsinadultswithcanceraprospectivecohortstudy‏ ‎‡A Catheter-associated bloodstream infection incidence and risk factors in adults with cancer: a prospective cohort study.‏ ‎‡9 1‏
919 ‎‡a brightfieldinsituhybridizationforher2geneamplificationinbreastcancerusingtissuemicroarrayscorrelationbetweenchromogeniccishandautomatedsilverenhancedsishmethodswithpatientoutcome‏ ‎‡A Bright-field in situ hybridization for HER2 gene amplification in breast cancer using tissue microarrays: correlation between chromogenic (CISH) and automated silver-enhanced (SISH) methods with patient outcome.‏ ‎‡9 1‏
919 ‎‡a brightfieldinsituhybridizationforher2geneamplificationinbreastcancerusingtissuemicroarrayscorrelationbetweenchromogenic‏ ‎‡A Bright-field in situ hybridization for HER2 gene amplification in breast cancer using tissue microarrays: correlation between chromogenic‏ ‎‡9 1‏
919 ‎‡a assessingtheeffectofestimationerroronriskadjustedcusumchartperformance‏ ‎‡A Assessing the effect of estimation error on risk-adjusted CUSUM chart performance.‏ ‎‡9 1‏
919 ‎‡a assessingattentionalbiaseswithstuttering‏ ‎‡A Assessing attentional biases with stuttering‏ ‎‡9 1‏
919 ‎‡a analyticalresultsinlongitudinalstudiesdependedontargetofinferenceandassumedmechanismofattrition‏ ‎‡A Analytical results in longitudinal studies depended on target of inference and assumed mechanism of attrition‏ ‎‡9 1‏
919 ‎‡a investigationoftheroleofparentalrequestforselfcorrectionofstutteringinthelidcombeprogram‏ ‎‡A An investigation of the role of parental request for self-correction of stuttering in the Lidcombe Program‏ ‎‡9 1‏
919 ‎‡a investigationoflanguageandphonologicaldevelopmentandtheresponsivenessofpreschoolagechildrentothelidcombeprogram‏ ‎‡A An investigation of language and phonological development and the responsiveness of preschool age children to the Lidcombe Program.‏ ‎‡9 1‏
919 ‎‡a invitroanalysisoftheeffectofacidosisoncoagulationinchronicdiseasestatesathromboelastographstudy‏ ‎‡A An in vitro analysis of the effect of acidosis on coagulation in chronic disease states - a thromboelastograph study.‏ ‎‡9 1‏
919 ‎‡a experimentalinvestigationoftheeffectofalteredauditoryfeedbackontheconversationalspeechofadultswhostutter‏ ‎‡A An Experimental Investigation of the Effect of Altered Auditory Feedback on the Conversational Speech of Adults Who Stutter‏ ‎‡9 1‏
919 ‎‡a acutefluidshiftsinfluencetheassessmentofserumvitamin500statusincriticallyillpatients‏ ‎‡A Acute fluid shifts influence the assessment of serum vitamin D status in critically ill patients.‏ ‎‡9 1‏
919 ‎‡a accuracyandinterobserverreliabilityof3dimensionalrotationalangiographyversusmathematicalmodelsforvolumetricmeasurementofintracranialaneurysms‏ ‎‡A Accuracy and interobserver reliability of three-dimensional rotational angiography versus mathematical models for volumetric measurement of intracranial aneurysms.‏ ‎‡9 1‏
919 ‎‡a absoluteandrelativereliabilityofpercentageofsyllablesstutteredandseverityratingscales‏ ‎‡A Absolute and relative reliability of percentage of syllables stuttered and severity rating scales.‏ ‎‡9 1‏
919 ‎‡a ushapedrelationshipbetweenbodymassindexanddysmenorrheaalongitudinalstudy‏ ‎‡A A U-Shaped Relationship between Body Mass Index and Dysmenorrhea: A Longitudinal Study.‏ ‎‡9 1‏
919 ‎‡a speechandpsychologicalprofileoftreatmentseekingadolescentswhostutter‏ ‎‡A A speech and psychological profile of treatment-seeking adolescents who stutter‏ ‎‡9 1‏
919 ‎‡a prospectivecohortstudyofgeriatricsyndromesamongoldermedicalpatientsadmittedtoacutecarehospitals‏ ‎‡A A prospective cohort study of geriatric syndromes among older medical patients admitted to acute care hospitals‏ ‎‡9 1‏
919 ‎‡a preliminarystudyofatorvastatinplasmaconcentrationsincriticallyillpatientswithsepsis‏ ‎‡A A preliminary study of atorvastatin plasma concentrations in critically ill patients with sepsis.‏ ‎‡9 1‏
919 ‎‡a phase2trialoftelehealthdeliveryofthelidcombeprogramofearlystutteringintervention‏ ‎‡A A Phase II Trial of Telehealth Delivery of the Lidcombe Program of Early Stuttering Intervention‏ ‎‡9 1‏
919 ‎‡a or1logriseinrqpcrtranscriptlevelsdefinesmolecularrelapseincorebindingfactoracutemyeloidleukemiaandpredictssubsequentmorphologicrelapse‏ ‎‡A A >or=1 log rise in RQ-PCR transcript levels defines molecular relapse in core binding factor acute myeloid leukemia and predicts subsequent morphologic relapse.‏ ‎‡9 1‏
919 ‎‡a newmethodtosamplestutteringinpreschoolchildren‏ ‎‡A A new method to sample stuttering in preschool children.‏ ‎‡9 1‏
919 ‎‡a graphicalmethodforassessingagreementwiththemeanbetweenmultipleobserversusingcontinuousmeasures‏ ‎‡A A graphical method for assessing agreement with the mean between multiple observers using continuous measures.‏ ‎‡9 1‏
919 ‎‡a oseltamivirforinfluenza‏ ‎‡A Oseltamivir for influenza‏ ‎‡9 1‏
943 ‎‡a 200x‏ ‎‡A 2008‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 NDL|001189898‏
996 ‎‡2 RERO|A003429900‏
996 ‎‡2 LNB|LNC10-000336712‏
996 ‎‡2 BIBSYS|9005710‏
996 ‎‡2 CAOONL|ncf10469015‏
996 ‎‡2 SUDOC|251135942‏
996 ‎‡2 BIBSYS|1488830535933‏
996 ‎‡2 SUDOC|029269016‏
996 ‎‡2 LC|no2005008108‏
996 ‎‡2 SUDOC|082327068‏
996 ‎‡2 JPG|500232159‏
996 ‎‡2 J9U|987007457475805171‏
996 ‎‡2 BAV|495_349690‏
996 ‎‡2 BAV|495_349691‏
996 ‎‡2 ISNI|0000000077142665‏
996 ‎‡2 LC|nb2012023548‏
996 ‎‡2 DNB|114183317‏
996 ‎‡2 LC|n 91002141‏
996 ‎‡2 BIBSYS|1707990462809‏
996 ‎‡2 NUKAT|n 2022200440‏
996 ‎‡2 LC|no2018067175‏
996 ‎‡2 NLA|000035567110‏
996 ‎‡2 LC|n 2015050789‏
996 ‎‡2 LC|no2010136459‏
996 ‎‡2 ISNI|0000000055596471‏
996 ‎‡2 LC|n 88621549‏
996 ‎‡2 DNB|171244230‏
996 ‎‡2 NLA|000035252773‏
996 ‎‡2 J9U|987007404549305171‏
996 ‎‡2 NUKAT|n 2003139794‏
996 ‎‡2 BNF|13474782‏
996 ‎‡2 ISNI|0000000054505857‏
996 ‎‡2 NTA|128495162‏
996 ‎‡2 DNB|1075549620‏
996 ‎‡2 CAOONL|ncf12120847‏
996 ‎‡2 ISNI|000000008405740X‏
996 ‎‡2 SZ|1067414789‏
996 ‎‡2 BNF|16577770‏
996 ‎‡2 ISNI|0000000083631764‏
996 ‎‡2 BNF|18174793‏
996 ‎‡2 BNF|15700315‏
996 ‎‡2 BIBSYS|90059304‏
996 ‎‡2 DNB|174002270‏
996 ‎‡2 ISNI|0000000074369362‏
996 ‎‡2 ISNI|0000000043392033‏
996 ‎‡2 RERO|A020140661‏
996 ‎‡2 RERO|A006436500‏
996 ‎‡2 SUDOC|236676415‏
996 ‎‡2 ISNI|0000000114674469‏
996 ‎‡2 J9U|987007456475905171‏
996 ‎‡2 LNB|LNC10-000092208‏
996 ‎‡2 BIBSYS|90777083‏
996 ‎‡2 NUKAT|n 98000614‏
996 ‎‡2 NII|DA11724068‏
996 ‎‡2 SUDOC|185979432‏
996 ‎‡2 DNB|10849344X‏
996 ‎‡2 CAOONL|ncf10644797‏
996 ‎‡2 J9U|987007402454405171‏
996 ‎‡2 KRNLK|KAC200807186‏
996 ‎‡2 SUDOC|158185536‏
996 ‎‡2 DNB|1324107413‏
996 ‎‡2 ISNI|0000000115918277‏
996 ‎‡2 LC|no2018015613‏
996 ‎‡2 NII|DA00373868‏
996 ‎‡2 NUKAT|n 2009141576‏
996 ‎‡2 LC|n 88009220‏
996 ‎‡2 PTBNP|156705‏
996 ‎‡2 J9U|987007460945805171‏
996 ‎‡2 NUKAT|n 2005002451‏
996 ‎‡2 LC|no2021082547‏
996 ‎‡2 LC|n 2009043302‏
996 ‎‡2 LC|n 90605925‏
996 ‎‡2 ISNI|0000000037655175‏
996 ‎‡2 BNF|17148765‏
996 ‎‡2 BIBSYS|41830‏
996 ‎‡2 NTA|073237078‏
996 ‎‡2 BIBSYS|12028681‏
996 ‎‡2 ISNI|0000000383176724‏
996 ‎‡2 ISNI|0000000035910080‏
996 ‎‡2 BAV|495_287887‏
996 ‎‡2 RERO|A009312185‏
996 ‎‡2 LC|nb 99116083‏
996 ‎‡2 LC|nb2021000830‏
996 ‎‡2 LC|no2013051697‏
996 ‎‡2 SUDOC|077315804‏
996 ‎‡2 ISNI|0000000101373034‏
996 ‎‡2 DNB|136030645‏
996 ‎‡2 LC|n 88639481‏
996 ‎‡2 ISNI|0000000080595200‏
996 ‎‡2 JPG|500018578‏
996 ‎‡2 LC|nb 99052660‏
996 ‎‡2 BIBSYS|90830440‏
996 ‎‡2 NII|DA07744389‏
996 ‎‡2 BIBSYS|90763725‏
996 ‎‡2 SUDOC|145578461‏
996 ‎‡2 J9U|987007315964705171‏
996 ‎‡2 NII|DA17774604‏
996 ‎‡2 NDL|00738888‏
996 ‎‡2 LC|n 96034279‏
996 ‎‡2 LC|n 79058341‏
996 ‎‡2 SUDOC|201071452‏
996 ‎‡2 LC|n 2011080877‏
996 ‎‡2 B2Q|0000014377‏
996 ‎‡2 CAOONL|ncf10642195‏
996 ‎‡2 NII|DA10688548‏
996 ‎‡2 CAOONL|ncf12114972‏
996 ‎‡2 LC|no2019116314‏
996 ‎‡2 ISNI|0000000037293514‏
996 ‎‡2 ISNI|0000000402660213‏
996 ‎‡2 LC|no2019098921‏
996 ‎‡2 BIBSYS|14006639‏
996 ‎‡2 ISNI|0000000424901823‏
996 ‎‡2 CAOONL|ncf11337428‏
996 ‎‡2 ISNI|0000000051460382‏
996 ‎‡2 ISNI|0000000063684287‏
996 ‎‡2 CAOONL|ncf10075177‏
996 ‎‡2 ISNI|0000000076841085‏
996 ‎‡2 LC|n 85080076‏
996 ‎‡2 LC|n 50007165‏
996 ‎‡2 ISNI|0000000463376240‏
996 ‎‡2 LC|n 2013004326‏
996 ‎‡2 NTA|32208895X‏
996 ‎‡2 NUKAT|n 2017196870‏
996 ‎‡2 NDL|01203015‏
996 ‎‡2 NTA|138257639‏
996 ‎‡2 NTA|394186389‏
996 ‎‡2 BIBSYS|8022533‏
996 ‎‡2 NII|DA17079796‏
996 ‎‡2 ISNI|0000000043076911‏
996 ‎‡2 DNB|1344166563‏
996 ‎‡2 LC|n 2008020038‏
996 ‎‡2 SUDOC|19188295X‏
996 ‎‡2 RERO|A011108745‏
996 ‎‡2 BIBSYS|11078666‏
996 ‎‡2 BIBSYS|4025693‏
996 ‎‡2 RERO|A003429917‏
996 ‎‡2 DBC|87097961864644‏
996 ‎‡2 LC|nb2010026883‏
996 ‎‡2 BIBSYS|1592544498297‏
996 ‎‡2 NSK|000093105‏
996 ‎‡2 BLBNB|001574256‏
996 ‎‡2 ISNI|0000000399310887‏
996 ‎‡2 ISNI|0000000394408105‏
996 ‎‡2 J9U|987007376397105171‏
996 ‎‡2 ISNI|0000000043232857‏
996 ‎‡2 DNB|1028027893‏
996 ‎‡2 LC|n 89605411‏
996 ‎‡2 ISNI|0000000121487178‏
996 ‎‡2 LC|no 97053865‏
996 ‎‡2 CAOONL|ncf10643911‏
996 ‎‡2 BNF|17142372‏
996 ‎‡2 J9U|987007269530505171‏
996 ‎‡2 LC|n 95041174‏
996 ‎‡2 SUDOC|202690342‏
996 ‎‡2 NKC|stk2007383196‏
996 ‎‡2 RERO|A003429899‏
996 ‎‡2 DNB|136030734‏
996 ‎‡2 SUDOC|16975023X‏
996 ‎‡2 BNE|XX1218703‏
996 ‎‡2 NII|DA18724394‏
996 ‎‡2 NTA|29748897X‏
996 ‎‡2 LC|no2003047800‏
996 ‎‡2 LC|no2008178405‏
996 ‎‡2 ISNI|0000000054789773‏
996 ‎‡2 LC|no 98079363‏
996 ‎‡2 ISNI|0000000401925144‏
996 ‎‡2 BIBSYS|90898503‏
996 ‎‡2 BNF|15004020‏
996 ‎‡2 DNB|1268649287‏
996 ‎‡2 NTA|269084975‏
996 ‎‡2 LC|n 92043333‏
996 ‎‡2 BNF|16775415‏
996 ‎‡2 SIMACOB|269465699‏
996 ‎‡2 BNF|12093191‏
996 ‎‡2 BIBSYS|1022102‏
996 ‎‡2 ISNI|0000000051309818‏
996 ‎‡2 DNB|1041836074‏
996 ‎‡2 ISNI|0000000133567095‏
996 ‎‡2 NUKAT|n 2017076429‏
996 ‎‡2 J9U|987007430259805171‏
996 ‎‡2 LC|no2024096105‏
996 ‎‡2 J9U|987007339155505171‏
996 ‎‡2 RERO|A027655582‏
996 ‎‡2 LC|no 89012112‏
996 ‎‡2 NUKAT|n 2019005349‏
996 ‎‡2 NSK|000667105‏
996 ‎‡2 LC|nb2014003939‏
996 ‎‡2 DNB|14263168X‏
996 ‎‡2 DNB|1122069405‏
996 ‎‡2 LC|nb2006021595‏
996 ‎‡2 BIBSYS|14016693‏
996 ‎‡2 LC|nb2013017681‏
996 ‎‡2 BIBSYS|3030556‏
996 ‎‡2 LC|n 2012074913‏
996 ‎‡2 CAOONL|ncf11194278‏
996 ‎‡2 SUDOC|167412876‏
996 ‎‡2 BIBSYS|1542227323818‏
996 ‎‡2 J9U|987007414680405171‏
996 ‎‡2 DNB|1079912088‏
996 ‎‡2 JPG|500271122‏
996 ‎‡2 BIBSYS|90524019‏
996 ‎‡2 DNB|1034964887‏
996 ‎‡2 NTA|41110859X‏
996 ‎‡2 LC|nb2005015990‏
996 ‎‡2 LC|no2024037172‏
996 ‎‡2 NKC|jn20000605116‏
996 ‎‡2 ISNI|0000000463376232‏
996 ‎‡2 ISNI|0000000038197540‏
996 ‎‡2 DNB|1138949566‏
996 ‎‡2 NTA|160438004‏
996 ‎‡2 LC|no2005009091‏
996 ‎‡2 DNB|1193435943‏
996 ‎‡2 LC|nb2002017659‏
996 ‎‡2 BIBSYS|2122154‏
996 ‎‡2 ISNI|0000000116623278‏
996 ‎‡2 ERRR|12520469‏
996 ‎‡2 NUKAT|n 2015094179‏
996 ‎‡2 LNB|LNC10-000033983‏
996 ‎‡2 ISNI|0000000039853773‏
996 ‎‡2 J9U|987007384411405171‏
996 ‎‡2 ISNI|0000000043735083‏
996 ‎‡2 LC|no2024114668‏
996 ‎‡2 NUKAT|n 2007117996‏
996 ‎‡2 ISNI|0000000036897412‏
996 ‎‡2 NTA|21580919X‏
996 ‎‡2 SUDOC|169842568‏
996 ‎‡2 ISNI|0000000116310773‏
996 ‎‡2 DNB|1077073992‏
996 ‎‡2 NII|DA06032702‏
996 ‎‡2 LC|n 90710482‏
996 ‎‡2 NUKAT|n 2012168454‏
996 ‎‡2 LC|nr 91031631‏
996 ‎‡2 NII|DA13164598‏
996 ‎‡2 LC|n 2008053638‏
996 ‎‡2 RERO|A027632046‏
996 ‎‡2 J9U|987007586337205171‏
996 ‎‡2 LC|n 96803486‏
996 ‎‡2 LC|no2017111007‏
996 ‎‡2 ISNI|0000000054262760‏
996 ‎‡2 CAOONL|ncf10376058‏
996 ‎‡2 LC|n 89225316‏
996 ‎‡2 BAV|495_124406‏
996 ‎‡2 J9U|987007270085005171‏
996 ‎‡2 LC|n 88657896‏
996 ‎‡2 ISNI|0000000486607558‏
996 ‎‡2 LC|nb2015014459‏
996 ‎‡2 NKC|jo20221143175‏
996 ‎‡2 NKC|xx0249012‏
996 ‎‡2 LC|n 90628354‏
996 ‎‡2 LC|no2013142611‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏