VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q79365093 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010855.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q79365093‏
024 ‎‡a 0000-0002-9799-9804‏ ‎‡2 orcid‏
024 ‎‡a 7103238419‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q79365093‏
100 0 ‎‡a Emmanuel Serrano‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Emmanuel Serrano‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's Absence of TB in Iberian ibex‏
670 ‎‡a Author's Absence of TB in Iberian ibex (Capra pyrenaica) in a high-risk area‏
670 ‎‡a Author's An identification key for the five most common species of Metastrongylus.‏
670 ‎‡a Author's Border Disease Virus: An Exceptional Driver of Chamois Populations Among Other Threats‏
670 ‎‡a Author's Bronchopulmonary nematode infection of Capra pyrenaica in the Sierra Nevada massif, Spain.‏
670 ‎‡a Author's Campylobacter shared between free-ranging cattle and sympatric wild ungulates in a natural environment‏
670 ‎‡a Author's Campylobacter shared between free-ranging cattle and sympatric wild ungulates in a natural environment (NE Spain).‏
670 ‎‡a Author's Cattle drive Salmonella infection in the wildlife-livestock interface.‏
670 ‎‡a Author's Coccidian and nematode infections influence prevalence of antibody to myxoma and rabbit hemorrhagic disease viruses in European rabbits.‏
670 ‎‡a Author's Comparing the accuracy of PCR-capillary electrophoresis and cuticle microhistological analysis for assessing diet composition in ungulates: A case study with Pyrenean chamois‏
670 ‎‡a Author's Coprological tests underestimate Macracanthorhynchus hirudinaceus burden in wild boar.‏
670 ‎‡a Author's Correction to: Location of studies and evidence of effects of herbivory on Arctic vegetation: a systematic map‏
670 ‎‡a Author's Different effects of alpine woody plant expansion on domestic and wild ungulates‏
670 ‎‡a Author's Effect of perphenazine enanthate in Pyrenean chamois‏
670 ‎‡a Author's Effect of perphenazine enanthate in Pyrenean chamois (Rupicapra pyrenaica).‏
670 ‎‡a Author's Effectiveness and safety of a treatment regimen based on isoniazid plus vaccination with Mycobacterium tuberculosis cells' fragments: field-study with naturally Mycobacterium caprae-infected goats.‏
670 ‎‡a Author's Escherichia coli O157:H7 in wild boars (Sus scrofa) and Iberian ibex (Capra pyrenaica) sharing pastures with free-ranging livestock in a natural environment in Spain.‏
670 ‎‡a Author's Evaluating the feeding preferences of West Nile virus mosquito vectors using bird-baited traps‏
670 ‎‡a Author's Evaluation of three enzyme-linked immunosorbent assays for sarcoptic mange diagnosis and assessment in the Iberian ibex, Capra pyrenaica‏
670 ‎‡a Author's Fecal nitrogen concentration as a nutritional quality indicator for European rabbit ecological studies‏
670 ‎‡a Author's Food-borne zoonotic pathogens and antimicrobial resistance of indicator bacteria in urban wild boars in Barcelona, Spain.‏
670 ‎‡a Author's High-density dependence but low impact on selected reproduction parameters of Brucella suis biovar 2 in wild boar hunting estates from South-Western Spain‏
670 ‎‡a Author's How sensitive and specific is the visual diagnosis of sarcoptic mange in free-ranging Iberian ibexes?‏
670 ‎‡a Author's Identification of a gammaherpesvirus belonging to the malignant catarrhal fever group of viruses in Pyrenean chamois (Rupicapra p. pyrenaica).‏
670 ‎‡a Author's Impact of co-infections with enteric pathogens on children suffering from acute diarrhea in southwest China‏
670 ‎‡a Author's In vitro rearing Oestrus caucasicus third-instar larvae and pupae (Diptera: Oestridae) from naturally-infested Iberian ibex, Capra Pyrenaica (Artiodactyla: Bovidae).‏
670 ‎‡a Author's Leptospira Detection in Cats in Spain by Serology and Molecular Techniques‏
670 ‎‡a Author's Location of studies and evidence of effects of herbivory on Arctic vegetation: a systematic map‏
670 ‎‡a Author's Long-term assessment of wild boar harvesting and cattle removal for bovine tuberculosis control in free ranging populations‏
670 ‎‡a Author's Male-biased gastrointestinal parasitism in a nearly monomorphic mountain ungulate.‏
670 ‎‡a Author's Management of a caseous lymphadenitis outbreak in a new Iberian ibex‏
670 ‎‡a Author's Management of a caseous lymphadenitis outbreak in a new Iberian ibex (Capra pyrenaica) stock reservoir‏
670 ‎‡a Author's Methicillin resistant Staphylococcus aureus‏
670 ‎‡a Author's Methicillin resistant Staphylococcus aureus (MRSA) carriage in different free-living wild animal species in Spain.‏
670 ‎‡a Author's Monitoring bluetongue virus vectors in Andalusia‏
670 ‎‡a Author's Monitoring bluetongue virus vectors in Andalusia (SW Europe): Culicoides species composition and factors affecting capture rates of the biting midge Culicoides imicola.‏
670 ‎‡a Author's Mycoplasma agalactiae in Iberian ibex‏
670 ‎‡a Author's Mycoplasma agalactiae in Iberian ibex (Capra pyrenaica) in Spain.‏
670 ‎‡a Author's Negative effect of the arthropod parasite, Sarcoptes scabiei, on testes mass in Iberian ibex, Capra pyrenaica‏
670 ‎‡a Author's On the possible role of ticks in the eco-epidemiology of Coxiella burnetii in a Mediterranean ecosystem‏
670 ‎‡a Author's Ossification of the appendicular skeleton in the Spanish Ibex Capra pyrenaica Schinz, 1838 (Artiodactyla: Bovidae), with regard to determination of age‏
670 ‎‡a Author's Oxidative Stress in Wild Boars Naturally and Experimentally Infected with Mycobacterium bovis‏
670 ‎‡a Author's Pathogens of zoonotic and biological importance in roe deer‏
670 ‎‡a Author's Pathogens of zoonotic and biological importance in roe deer (Capreolus capreolus): Seroprevalence in an agro-system population in France.‏
670 ‎‡a Author's Positive co-occurrence of flea infestation at a low biological cost in two rodent hosts in the Canary archipelago.‏
670 ‎‡a Author's Postural laterality in Iberian ibex Capra pyrenaica: effects of age, sex and nursing suggest stress and social information‏
670 ‎‡a Author's Predicting herbivore faecal nitrogen using a multispecies near-infrared reflectance spectroscopy calibration.‏
670 ‎‡a Author's Richness and diversity of helminth species in eels from a hypersaline coastal lagoon, Mar Menor, south-east Spain.‏
670 ‎‡a Author's Sarcoptes scabiei infestation does not alter the stability of ectoparasite communities‏
670 ‎‡a Author's Sarcoptic mange and metapodial development in growing male Iberian ibex (Capra pyrenaica)‏
670 ‎‡a Author's Sarcoptic mange breaks up bottom-up regulation of body condition in a large herbivore population‏
670 ‎‡a Author's Satellite-Based Monitoring of Primary Production in a Mediterranean Islet Post Black Rat Eradication‏
670 ‎‡a Author's Septicemic salmonellosis caused by Salmonella Hessarek in wintering and migrating Song Thrushes‏
670 ‎‡a Author's Septicemic salmonellosis caused by Salmonella Hessarek in wintering and migrating Song Thrushes (Turdus philomelos) in Spain.‏
670 ‎‡a Author's Sex-biased severity of sarcoptic mange at the same biological cost in a sexually dimorphic ungulate‏
670 ‎‡a Author's Sex-difference in the ossification rate of the appendicular skeleton in Capra pyrenaica Schinz, 1838, and its utility in the sex identification of long bones‏
670 ‎‡a Author's Sex-related differences in body condition and serum biochemical parameters in red deer‏
670 ‎‡a Author's Sex-related differences in body condition and serum biochemical parameters in red deer (Cervus elaphus) naturally infected with Mycobacterium bovis.‏
670 ‎‡a Author's Stochastic assessment of management strategies for a Mediterranean peri-urban wild boar population‏
670 ‎‡a Author's The European eel may tolerate multiple infections at a low biological cost.‏
670 ‎‡a Author's The physiological cost of male-biased parasitism in a nearly monomorphic mammal.‏
670 ‎‡a Author's The two sides of border disease in Pyrenean chamois (Rupicapra pyrenaica): silent persistence and population collapse‏
670 ‎‡a Author's The use of null models and partial least squares approach path modelling‏
670 ‎‡a Author's The use of null models and partial least squares approach path modelling (PLS-PM) for investigating risk factors influencing post-weaning mortality in indoor pig farms.‏
670 ‎‡a Author's Trichinella sp. in red foxes (Vulpes vulpes) from Catalonia, NE Spain.‏
670 ‎‡a Author's Two different epidemiological scenarios of border disease in the populations of Pyrenean chamois‏
670 ‎‡a Author's Two different epidemiological scenarios of border disease in the populations of Pyrenean chamois (Rupicapra p. pyrenaica) after the first disease outbreaks.‏
670 ‎‡a Author's Usefulness of estimated surface area of damaged skin as a proxy of mite load in the monitoring of sarcoptic mange in free-ranging populations of Iberian wild goat, Capra pyrenaica.‏
670 ‎‡a Author's Uses and limitations of faecal egg count for assessing worm burden in wild boars‏
670 ‎‡a Author's Vaccination Against Porcine Circovirus-2 Reduces Severity of Tuberculosis in Wild Boar.‏
670 ‎‡a Author's What is the price of neglecting parasite groups when assessing the cost of co-infection?‏
909 ‎‡a (orcid) 0000000297999804‏ ‎‡9 1‏
909 ‎‡a (scopus) 7103238419‏ ‎‡9 1‏
919 ‎‡a coprologicaltestsunderestimatemacracanthorhynchushirudinaceusburdeninwildboar‏ ‎‡A Coprological tests underestimate Macracanthorhynchus hirudinaceus burden in wild boar.‏ ‎‡9 1‏
919 ‎‡a coccidianandnematodeinfectionsinfluenceprevalenceofantibodytomyxomaandrabbithemorrhagicdiseasevirusesineuropeanrabbits‏ ‎‡A Coccidian and nematode infections influence prevalence of antibody to myxoma and rabbit hemorrhagic disease viruses in European rabbits.‏ ‎‡9 1‏
919 ‎‡a positivecooccurrenceoffleainfestationatalowbiologicalcostin2rodenthostsinthecanaryarchipelago‏ ‎‡A Positive co-occurrence of flea infestation at a low biological cost in two rodent hosts in the Canary archipelago.‏ ‎‡9 1‏
919 ‎‡a posturallateralityiniberianibexcaprapyrenaicaeffectsofagesexandnursingsuggeststressandsocialinformation‏ ‎‡A Postural laterality in Iberian ibex Capra pyrenaica: effects of age, sex and nursing suggest stress and social information‏ ‎‡9 1‏
919 ‎‡a predictingherbivorefaecalnitrogenusingamultispeciesnearinfraredreflectancespectroscopycalibration‏ ‎‡A Predicting herbivore faecal nitrogen using a multispecies near-infrared reflectance spectroscopy calibration.‏ ‎‡9 1‏
919 ‎‡a richnessanddiversityofhelminthspeciesineelsfromahypersalinecoastallagoonmarmenorsoutheastspain‏ ‎‡A Richness and diversity of helminth species in eels from a hypersaline coastal lagoon, Mar Menor, south-east Spain.‏ ‎‡9 1‏
919 ‎‡a sarcoptesscabieiinfestationdoesnotalterthestabilityofectoparasitecommunities‏ ‎‡A Sarcoptes scabiei infestation does not alter the stability of ectoparasite communities‏ ‎‡9 1‏
919 ‎‡a sarcopticmangeandmetapodialdevelopmentingrowingmaleiberianibexcaprapyrenaica‏ ‎‡A Sarcoptic mange and metapodial development in growing male Iberian ibex (Capra pyrenaica)‏ ‎‡9 1‏
919 ‎‡a sarcopticmangebreaksupbottomupregulationofbodyconditioninalargeherbivorepopulation‏ ‎‡A Sarcoptic mange breaks up bottom-up regulation of body condition in a large herbivore population‏ ‎‡9 1‏
919 ‎‡a satellitebasedmonitoringofprimaryproductioninamediterraneanisletpostblackrateradication‏ ‎‡A Satellite-Based Monitoring of Primary Production in a Mediterranean Islet Post Black Rat Eradication‏ ‎‡9 1‏
919 ‎‡a septicemicsalmonellosiscausedbysalmonellahessarekinwinteringandmigratingsongthrushes‏ ‎‡A Septicemic salmonellosis caused by Salmonella Hessarek in wintering and migrating Song Thrushes‏ ‎‡9 1‏
919 ‎‡a pathogensofzoonoticandbiologicalimportanceinroedeer‏ ‎‡A Pathogens of zoonotic and biological importance in roe deer‏ ‎‡9 1‏
919 ‎‡a septicemicsalmonellosiscausedbysalmonellahessarekinwinteringandmigratingsongthrushesturdusphilomelosinspain‏ ‎‡A Septicemic salmonellosis caused by Salmonella Hessarek in wintering and migrating Song Thrushes (Turdus philomelos) in Spain.‏ ‎‡9 1‏
919 ‎‡a sexbiasedseverityofsarcopticmangeatthesamebiologicalcostinasexuallydimorphicungulate‏ ‎‡A Sex-biased severity of sarcoptic mange at the same biological cost in a sexually dimorphic ungulate‏ ‎‡9 1‏
919 ‎‡a sexdifferenceintheossificationrateoftheappendicularskeletonincaprapyrenaicaschinz1838anditsutilityinthesexidentificationoflongbones‏ ‎‡A Sex-difference in the ossification rate of the appendicular skeleton in Capra pyrenaica Schinz, 1838, and its utility in the sex identification of long bones‏ ‎‡9 1‏
919 ‎‡a sexrelateddifferencesinbodyconditionandserumbiochemicalparametersinreddeer‏ ‎‡A Sex-related differences in body condition and serum biochemical parameters in red deer‏ ‎‡9 1‏
919 ‎‡a sexrelateddifferencesinbodyconditionandserumbiochemicalparametersinreddeercervuselaphusnaturallyinfectedwithmycobacteriumbovis‏ ‎‡A Sex-related differences in body condition and serum biochemical parameters in red deer (Cervus elaphus) naturally infected with Mycobacterium bovis.‏ ‎‡9 1‏
919 ‎‡a stochasticassessmentofmanagementstrategiesforamediterraneanperiurbanwildboarpopulation‏ ‎‡A Stochastic assessment of management strategies for a Mediterranean peri-urban wild boar population‏ ‎‡9 1‏
919 ‎‡a european2maytoleratemultipleinfectionsatalowbiologicalcost‏ ‎‡A The European eel may tolerate multiple infections at a low biological cost.‏ ‎‡9 1‏
919 ‎‡a physiologicalcostofmalebiasedparasitisminanearlymonomorphicmammal‏ ‎‡A The physiological cost of male-biased parasitism in a nearly monomorphic mammal.‏ ‎‡9 1‏
919 ‎‡a 2sidesofborderdiseaseinpyreneanchamoisrupicaprapyrenaicasilentpersistenceandpopulationcollapse‏ ‎‡A The two sides of border disease in Pyrenean chamois (Rupicapra pyrenaica): silent persistence and population collapse‏ ‎‡9 1‏
919 ‎‡a useofnullmodelsandpartialleastsquaresapproachpathmodelling‏ ‎‡A The use of null models and partial least squares approach path modelling‏ ‎‡9 1‏
919 ‎‡a useofnullmodelsandpartialleastsquaresapproachpathmodellingplspmforinvestigatingriskfactorsinfluencingpostweaningmortalityinindoorpigfarms‏ ‎‡A The use of null models and partial least squares approach path modelling (PLS-PM) for investigating risk factors influencing post-weaning mortality in indoor pig farms.‏ ‎‡9 1‏
919 ‎‡a trichinellaspinredfoxesvulpesvulpesfromcatalonianespain‏ ‎‡A Trichinella sp. in red foxes (Vulpes vulpes) from Catalonia, NE Spain.‏ ‎‡9 1‏
919 ‎‡a 2differentepidemiologicalscenariosofborderdiseaseinthepopulationsofpyreneanchamois‏ ‎‡A Two different epidemiological scenarios of border disease in the populations of Pyrenean chamois‏ ‎‡9 1‏
919 ‎‡a 2differentepidemiologicalscenariosofborderdiseaseinthepopulationsofpyreneanchamoisrupicaprappyrenaicaafterthe1diseaseoutbreaks‏ ‎‡A Two different epidemiological scenarios of border disease in the populations of Pyrenean chamois (Rupicapra p. pyrenaica) after the first disease outbreaks.‏ ‎‡9 1‏
919 ‎‡a usefulnessofestimatedsurfaceareaofdamagedskinasaproxyofmiteloadinthemonitoringofsarcopticmangeinfreerangingpopulationsofiberianwildgoatcaprapyrenaica‏ ‎‡A Usefulness of estimated surface area of damaged skin as a proxy of mite load in the monitoring of sarcoptic mange in free-ranging populations of Iberian wild goat, Capra pyrenaica.‏ ‎‡9 1‏
919 ‎‡a usesandlimitationsoffaecaleggcountforassessingwormburdeninwildboars‏ ‎‡A Uses and limitations of faecal egg count for assessing worm burden in wild boars‏ ‎‡9 1‏
919 ‎‡a vaccinationagainstporcinecircovirus2reducesseverityoftuberculosisinwildboar‏ ‎‡A Vaccination Against Porcine Circovirus-2 Reduces Severity of Tuberculosis in Wild Boar.‏ ‎‡9 1‏
919 ‎‡a whatisthepriceofneglectingparasitegroupswhenassessingthecostofcoinfection‏ ‎‡A What is the price of neglecting parasite groups when assessing the cost of co-infection?‏ ‎‡9 1‏
919 ‎‡a comparingtheaccuracyofpcrcapillaryelectrophoresisandcuticlemicrohistologicalanalysisforassessingdietcompositioninungulatesacasestudywithpyreneanchamois‏ ‎‡A Comparing the accuracy of PCR-capillary electrophoresis and cuticle microhistological analysis for assessing diet composition in ungulates: A case study with Pyrenean chamois‏ ‎‡9 1‏
919 ‎‡a absenceoftbiniberianibex‏ ‎‡A Absence of TB in Iberian ibex‏ ‎‡9 1‏
919 ‎‡a absenceoftbiniberianibexcaprapyrenaicainahighriskarea‏ ‎‡A Absence of TB in Iberian ibex (Capra pyrenaica) in a high-risk area‏ ‎‡9 1‏
919 ‎‡a identificationkeyforthe5mostcommonspeciesofmetastrongylus‏ ‎‡A An identification key for the five most common species of Metastrongylus.‏ ‎‡9 1‏
919 ‎‡a borderdiseasevirusanexceptionaldriverofchamoispopulationsamongotherthreats‏ ‎‡A Border Disease Virus: An Exceptional Driver of Chamois Populations Among Other Threats‏ ‎‡9 1‏
919 ‎‡a bronchopulmonarynematodeinfectionofcaprapyrenaicainthesierranevadamassifspain‏ ‎‡A Bronchopulmonary nematode infection of Capra pyrenaica in the Sierra Nevada massif, Spain.‏ ‎‡9 1‏
919 ‎‡a campylobactersharedbetweenfreerangingcattleandsympatricwildungulatesinanaturalenvironment‏ ‎‡A Campylobacter shared between free-ranging cattle and sympatric wild ungulates in a natural environment‏ ‎‡9 1‏
919 ‎‡a campylobactersharedbetweenfreerangingcattleandsympatricwildungulatesinanaturalenvironmentnespain‏ ‎‡A Campylobacter shared between free-ranging cattle and sympatric wild ungulates in a natural environment (NE Spain).‏ ‎‡9 1‏
919 ‎‡a pathogensofzoonoticandbiologicalimportanceinroedeercapreoluscapreolusseroprevalenceinanagrosystempopulationinfrance‏ ‎‡A Pathogens of zoonotic and biological importance in roe deer (Capreolus capreolus): Seroprevalence in an agro-system population in France.‏ ‎‡9 1‏
919 ‎‡a oxidativestressinwildboarsnaturallyandexperimentallyinfectedwithmycobacteriumbovis‏ ‎‡A Oxidative Stress in Wild Boars Naturally and Experimentally Infected with Mycobacterium bovis‏ ‎‡9 1‏
919 ‎‡a ossificationoftheappendicularskeletoninthespanishibexcaprapyrenaicaschinz1838artiodactylabovidaewithregardtodeterminationofage‏ ‎‡A Ossification of the appendicular skeleton in the Spanish Ibex Capra pyrenaica Schinz, 1838 (Artiodactyla: Bovidae), with regard to determination of age‏ ‎‡9 1‏
919 ‎‡a onthepossibleroleofticksintheecoepidemiologyofcoxiellaburnetiiinamediterraneanecosystem‏ ‎‡A On the possible role of ticks in the eco-epidemiology of Coxiella burnetii in a Mediterranean ecosystem‏ ‎‡9 1‏
919 ‎‡a negativeeffectofthearthropodparasitesarcoptesscabieiontestesmassiniberianibexcaprapyrenaica‏ ‎‡A Negative effect of the arthropod parasite, Sarcoptes scabiei, on testes mass in Iberian ibex, Capra pyrenaica‏ ‎‡9 1‏
919 ‎‡a mycoplasmaagalactiaeiniberianibexcaprapyrenaicainspain‏ ‎‡A Mycoplasma agalactiae in Iberian ibex (Capra pyrenaica) in Spain.‏ ‎‡9 1‏
919 ‎‡a mycoplasmaagalactiaeiniberianibex‏ ‎‡A Mycoplasma agalactiae in Iberian ibex‏ ‎‡9 1‏
919 ‎‡a monitoringbluetonguevirusvectorsinandalusiasweuropeculicoidesspeciescompositionandfactorsaffectingcaptureratesofthebitingmidgeculicoidesimicola‏ ‎‡A Monitoring bluetongue virus vectors in Andalusia (SW Europe): Culicoides species composition and factors affecting capture rates of the biting midge Culicoides imicola.‏ ‎‡9 1‏
919 ‎‡a monitoringbluetonguevirusvectorsinandalusia‏ ‎‡A Monitoring bluetongue virus vectors in Andalusia‏ ‎‡9 1‏
919 ‎‡a methicillinresistantstaphylococcusaureusmrsacarriageindifferentfreelivingwildanimalspeciesinspain‏ ‎‡A Methicillin resistant Staphylococcus aureus (MRSA) carriage in different free-living wild animal species in Spain.‏ ‎‡9 1‏
919 ‎‡a methicillinresistantstaphylococcusaureus‏ ‎‡A Methicillin resistant Staphylococcus aureus‏ ‎‡9 1‏
919 ‎‡a managementofacaseouslymphadenitisoutbreakinanewiberianibexcaprapyrenaicastockreservoir‏ ‎‡A Management of a caseous lymphadenitis outbreak in a new Iberian ibex (Capra pyrenaica) stock reservoir‏ ‎‡9 1‏
919 ‎‡a managementofacaseouslymphadenitisoutbreakinanewiberianibex‏ ‎‡A Management of a caseous lymphadenitis outbreak in a new Iberian ibex‏ ‎‡9 1‏
919 ‎‡a malebiasedgastrointestinalparasitisminanearlymonomorphicmountainungulate‏ ‎‡A Male-biased gastrointestinal parasitism in a nearly monomorphic mountain ungulate.‏ ‎‡9 1‏
919 ‎‡a longtermassessmentofwildboarharvestingandcattleremovalforbovinetuberculosiscontrolinfreerangingpopulations‏ ‎‡A Long-term assessment of wild boar harvesting and cattle removal for bovine tuberculosis control in free ranging populations‏ ‎‡9 1‏
919 ‎‡a locationofstudiesandevidenceofeffectsofherbivoryonarcticvegetationasystematicmap‏ ‎‡A Location of studies and evidence of effects of herbivory on Arctic vegetation: a systematic map‏ ‎‡9 1‏
919 ‎‡a leptospiradetectionincatsinspainbyserologyandmoleculartechniques‏ ‎‡A Leptospira Detection in Cats in Spain by Serology and Molecular Techniques‏ ‎‡9 1‏
919 ‎‡a invitrorearingoestruscaucasicus3instarlarvaeandpupaedipteraoestridaefromnaturallyinfestediberianibexcaprapyrenaicaartiodactylabovidae‏ ‎‡A In vitro rearing Oestrus caucasicus third-instar larvae and pupae (Diptera: Oestridae) from naturally-infested Iberian ibex, Capra Pyrenaica (Artiodactyla: Bovidae).‏ ‎‡9 1‏
919 ‎‡a cattledrivesalmonellainfectioninthewildlifelivestockinterface‏ ‎‡A Cattle drive Salmonella infection in the wildlife-livestock interface.‏ ‎‡9 1‏
919 ‎‡a impactofcoinfectionswithentericpathogensonchildrensufferingfromacutediarrheainsouthwestchina‏ ‎‡A Impact of co-infections with enteric pathogens on children suffering from acute diarrhea in southwest China‏ ‎‡9 1‏
919 ‎‡a identificationofagammaherpesvirusbelongingtothemalignantcatarrhalfevergroupofvirusesinpyreneanchamoisrupicaprappyrenaica‏ ‎‡A Identification of a gammaherpesvirus belonging to the malignant catarrhal fever group of viruses in Pyrenean chamois (Rupicapra p. pyrenaica).‏ ‎‡9 1‏
919 ‎‡a howsensitiveandspecificisthevisualdiagnosisofsarcopticmangeinfreerangingiberianibexes‏ ‎‡A How sensitive and specific is the visual diagnosis of sarcoptic mange in free-ranging Iberian ibexes?‏ ‎‡9 1‏
919 ‎‡a highdensitydependencebutlowimpactonselectedreproductionparametersofbrucellasuisbiovar2inwildboarhuntingestatesfromsouthwesternspain‏ ‎‡A High-density dependence but low impact on selected reproduction parameters of Brucella suis biovar 2 in wild boar hunting estates from South-Western Spain‏ ‎‡9 1‏
919 ‎‡a foodbornezoonoticpathogensandantimicrobialresistanceofindicatorbacteriainurbanwildboarsinbarcelonaspain‏ ‎‡A Food-borne zoonotic pathogens and antimicrobial resistance of indicator bacteria in urban wild boars in Barcelona, Spain.‏ ‎‡9 1‏
919 ‎‡a fecalnitrogenconcentrationasanutritionalqualityindicatorforeuropeanrabbitecologicalstudies‏ ‎‡A Fecal nitrogen concentration as a nutritional quality indicator for European rabbit ecological studies‏ ‎‡9 1‏
919 ‎‡a evaluationof3enzymelinkedimmunosorbentassaysforsarcopticmangediagnosisandassessmentintheiberianibexcaprapyrenaica‏ ‎‡A Evaluation of three enzyme-linked immunosorbent assays for sarcoptic mange diagnosis and assessment in the Iberian ibex, Capra pyrenaica‏ ‎‡9 1‏
919 ‎‡a evaluatingthefeedingpreferencesofwestnilevirusmosquitovectorsusingbirdbaitedtraps‏ ‎‡A Evaluating the feeding preferences of West Nile virus mosquito vectors using bird-baited traps‏ ‎‡9 1‏
919 ‎‡a escherichiacolio157h7inwildboarssusscrofaandiberianibexcaprapyrenaicasharingpastureswithfreeranginglivestockinanaturalenvironmentinspain‏ ‎‡A Escherichia coli O157:H7 in wild boars (Sus scrofa) and Iberian ibex (Capra pyrenaica) sharing pastures with free-ranging livestock in a natural environment in Spain.‏ ‎‡9 1‏
919 ‎‡a effectivenessandsafetyofatreatmentregimenbasedonisoniazidplusvaccinationwithmycobacteriumtuberculosiscellsfragmentsfieldstudywithnaturallymycobacteriumcapraeinfectedgoats‏ ‎‡A Effectiveness and safety of a treatment regimen based on isoniazid plus vaccination with Mycobacterium tuberculosis cells' fragments: field-study with naturally Mycobacterium caprae-infected goats.‏ ‎‡9 1‏
919 ‎‡a effectofperphenazineenanthateinpyreneanchamoisrupicaprapyrenaica‏ ‎‡A Effect of perphenazine enanthate in Pyrenean chamois (Rupicapra pyrenaica).‏ ‎‡9 1‏
919 ‎‡a effectofperphenazineenanthateinpyreneanchamois‏ ‎‡A Effect of perphenazine enanthate in Pyrenean chamois‏ ‎‡9 1‏
919 ‎‡a differenteffectsofalpinewoodyplantexpansionondomesticandwildungulates‏ ‎‡A Different effects of alpine woody plant expansion on domestic and wild ungulates‏ ‎‡9 1‏
919 ‎‡a correctiontolocationofstudiesandevidenceofeffectsofherbivoryonarcticvegetationasystematicmap‏ ‎‡A Correction to: Location of studies and evidence of effects of herbivory on Arctic vegetation: a systematic map‏ ‎‡9 1‏
996 ‎‡2 SUDOC|111023475‏
996 ‎‡2 DNB|1157393489‏
996 ‎‡2 BNE|XX892061‏
996 ‎‡2 NTA|068511159‏
996 ‎‡2 BNE|XX5378523‏
996 ‎‡2 BNC|981058521345006706‏
996 ‎‡2 BNCHL|10000000000000000831974‏
996 ‎‡2 BNE|XX1504413‏
996 ‎‡2 LC|n 2008032374‏
996 ‎‡2 BNC|981058516434806706‏
996 ‎‡2 LC|n 94001420‏
996 ‎‡2 RERO|A003822992‏
996 ‎‡2 ISNI|0000000068396321‏
996 ‎‡2 ISNI|0000000123203343‏
996 ‎‡2 SUDOC|157975983‏
996 ‎‡2 RERO|A023981877‏
996 ‎‡2 BNE|XX1799171‏
996 ‎‡2 DNB|1056338288‏
996 ‎‡2 J9U|987007452906205171‏
996 ‎‡2 DNB|12815859X‏
996 ‎‡2 JPG|500244802‏
996 ‎‡2 BNE|XX1379020‏
996 ‎‡2 BNE|XX1298945‏
996 ‎‡2 BNE|XX1017815‏
996 ‎‡2 BNE|XX1553866‏
996 ‎‡2 SUDOC|192189220‏
996 ‎‡2 LC|n 87124138‏
996 ‎‡2 DNB|1300583800‏
996 ‎‡2 BNE|XX1192408‏
996 ‎‡2 JPG|500014552‏
996 ‎‡2 NUKAT|n 2016051215‏
996 ‎‡2 LC|n 97057322‏
996 ‎‡2 LC|n 91019505‏
996 ‎‡2 BNE|XX1119631‏
996 ‎‡2 ISNI|0000000059461515‏
996 ‎‡2 BNF|16986580‏
996 ‎‡2 ISNI|0000000394689269‏
996 ‎‡2 ISNI|000000006749777X‏
996 ‎‡2 BNC|981058514855506706‏
996 ‎‡2 ISNI|000000003489252X‏
996 ‎‡2 BNE|XX1071980‏
996 ‎‡2 PTBNP|1008626‏
996 ‎‡2 ISNI|000000011805091X‏
996 ‎‡2 ISNI|0000000059206194‏
996 ‎‡2 BNE|XX1685803‏
996 ‎‡2 BNC|981058522372006706‏
996 ‎‡2 NLR|RU NLR AUTH 770264763‏
996 ‎‡2 RERO|A023135782‏
996 ‎‡2 ISNI|0000000060334986‏
996 ‎‡2 BNE|XX4793740‏
996 ‎‡2 BNE|XX956001‏
996 ‎‡2 BNE|XX1573534‏
996 ‎‡2 NTA|075188228‏
996 ‎‡2 PTBNP|1582854‏
996 ‎‡2 BNE|XX1118557‏
996 ‎‡2 SUDOC|133774759‏
996 ‎‡2 ISNI|0000000059198788‏
996 ‎‡2 RERO|A027689905‏
996 ‎‡2 BNE|XX1656607‏
996 ‎‡2 LC|ns2019003071‏
996 ‎‡2 PTBNP|1749629‏
996 ‎‡2 ISNI|0000000034919278‏
996 ‎‡2 BNF|14479562‏
996 ‎‡2 DNB|1060860554‏
996 ‎‡2 ISNI|0000000369549483‏
996 ‎‡2 BNE|XX6462712‏
996 ‎‡2 DNB|1047964066‏
996 ‎‡2 BIBSYS|10018440‏
996 ‎‡2 JPG|500009935‏
996 ‎‡2 NTA|069168644‏
996 ‎‡2 DNB|119097559‏
996 ‎‡2 CAOONL|ncf10724046‏
996 ‎‡2 ISNI|0000000015670489‏
996 ‎‡2 DNB|1154617688‏
996 ‎‡2 BNE|XX4606436‏
996 ‎‡2 BNC|981058522371906706‏
996 ‎‡2 LC|no2018045145‏
996 ‎‡2 LC|ns2015003428‏
996 ‎‡2 BIBSYS|15017714‏
996 ‎‡2 ISNI|0000000060274565‏
996 ‎‡2 SUDOC|06937953X‏
996 ‎‡2 DNB|1107444632‏
996 ‎‡2 LC|n 79059391‏
996 ‎‡2 ISNI|0000000034165365‏
996 ‎‡2 CAOONL|ncf11720381‏
996 ‎‡2 BNE|XX1083780‏
996 ‎‡2 ISNI|0000000060443306‏
996 ‎‡2 BNE|XX1724585‏
996 ‎‡2 LC|no 98099695‏
996 ‎‡2 LC|no2001037724‏
996 ‎‡2 BNE|XX4581052‏
996 ‎‡2 BNF|13323520‏
996 ‎‡2 LC|n 2002109730‏
996 ‎‡2 RERO|A024210673‏
996 ‎‡2 BNC|981058520757206706‏
996 ‎‡2 NUKAT|n 2016242929‏
996 ‎‡2 PTBNP|268647‏
996 ‎‡2 LC|n 2012059655‏
996 ‎‡2 ISNI|0000000060422978‏
996 ‎‡2 BNE|XX876210‏
996 ‎‡2 BNE|XX1557104‏
996 ‎‡2 BNC|981058522658306706‏
996 ‎‡2 SUDOC|110890027‏
996 ‎‡2 BNE|XX1437853‏
996 ‎‡2 BNE|XX864131‏
996 ‎‡2 SUDOC|244349320‏
996 ‎‡2 ISNI|000000038222873X‏
996 ‎‡2 LC|n 83129074‏
996 ‎‡2 PTBNP|145301‏
996 ‎‡2 RERO|A013857869‏
996 ‎‡2 SUDOC|069506124‏
996 ‎‡2 NII|DA17727579‏
996 ‎‡2 BNE|XX4972960‏
996 ‎‡2 J9U|987012501439705171‏
996 ‎‡2 ISNI|0000000059684014‏
996 ‎‡2 BNE|XX6175643‏
996 ‎‡2 LC|no2002007399‏
996 ‎‡2 BNE|XX933541‏
996 ‎‡2 BNE|XX1492686‏
996 ‎‡2 BNE|XX1481828‏
996 ‎‡2 LC|no2022025811‏
996 ‎‡2 ISNI|0000000061265601‏
996 ‎‡2 PLWABN|9812696202505606‏
996 ‎‡2 DNB|1057391751‏
996 ‎‡2 ISNI|000000006907851X‏
996 ‎‡2 BNCHL|10000000000000000099493‏
996 ‎‡2 SUDOC|163955530‏
996 ‎‡2 NUKAT|nx2022925897‏
996 ‎‡2 BNF|16557454‏
996 ‎‡2 LC|n 85831252‏
996 ‎‡2 BNE|XX1193918‏
996 ‎‡2 BNE|XX5462959‏
996 ‎‡2 RERO|A023222291‏
996 ‎‡2 BNE|XX1636770‏
996 ‎‡2 SUDOC|192600699‏
996 ‎‡2 BNC|981058508742106706‏
996 ‎‡2 NUKAT|n 2020030265‏
996 ‎‡2 BNE|XX1140300‏
996 ‎‡2 ISNI|0000000026784158‏
996 ‎‡2 J9U|987007329663505171‏
996 ‎‡2 BNE|XX1018491‏
996 ‎‡2 DNB|1056222948‏
996 ‎‡2 LC|nr 90003104‏
996 ‎‡2 BNF|14578791‏
996 ‎‡2 PLWABN|9814000378805606‏
996 ‎‡2 BNE|XX1022105‏
996 ‎‡2 BAV|495_192253‏
996 ‎‡2 SUDOC|281361223‏
996 ‎‡2 LC|n 99011373‏
996 ‎‡2 SUDOC|193266970‏
996 ‎‡2 PTBNP|59169‏
996 ‎‡2 SUDOC|265838851‏
996 ‎‡2 BNCHL|10000000000000000216269‏
996 ‎‡2 BNE|XX1437873‏
996 ‎‡2 BNE|XX1086836‏
996 ‎‡2 BNC|981058613131806706‏
996 ‎‡2 BNE|XX1791793‏
996 ‎‡2 BNE|XX5481248‏
996 ‎‡2 RERO|A025666592‏
996 ‎‡2 RERO|A003567052‏
996 ‎‡2 BNF|14519012‏
996 ‎‡2 BNE|XX5476176‏
996 ‎‡2 LC|n 2007021221‏
996 ‎‡2 BNC|981058522372406706‏
996 ‎‡2 BNE|XX1384927‏
996 ‎‡2 SUDOC|083935789‏
996 ‎‡2 BNE|XX1217400‏
996 ‎‡2 LC|no2011150741‏
996 ‎‡2 BAV|495_162578‏
996 ‎‡2 BNF|14522463‏
996 ‎‡2 BNCHL|10000000000000000122462‏
996 ‎‡2 BNC|981058521231006706‏
996 ‎‡2 J9U|987007317307905171‏
996 ‎‡2 DNB|1261860713‏
996 ‎‡2 DNB|1095248030‏
996 ‎‡2 ISNI|0000000041326155‏
996 ‎‡2 NUKAT|n 2015084905‏
996 ‎‡2 SUDOC|143447475‏
996 ‎‡2 LC|n 83204746‏
996 ‎‡2 LC|n 2023039729‏
996 ‎‡2 LC|n 99041172‏
996 ‎‡2 ARBABN|000070076‏
996 ‎‡2 SUDOC|195706439‏
996 ‎‡2 BNC|981058526115906706‏
996 ‎‡2 DNB|1057246042‏
996 ‎‡2 BNE|XX1018425‏
996 ‎‡2 BNE|XX1039034‏
996 ‎‡2 BNE|XX1572451‏
996 ‎‡2 DNB|1057375675‏
996 ‎‡2 BNE|XX4919980‏
996 ‎‡2 SUDOC|029371325‏
996 ‎‡2 ISNI|0000000046056959‏
996 ‎‡2 BNCHL|10000000000000000108100‏
996 ‎‡2 DNB|172514770‏
996 ‎‡2 SUDOC|035597372‏
996 ‎‡2 DNB|1056274468‏
996 ‎‡2 LC|no2023020135‏
996 ‎‡2 BNC|981058615897106706‏
996 ‎‡2 BNE|XX1155166‏
996 ‎‡2 J9U|987007422538305171‏
996 ‎‡2 NKC|jo2016897347‏
996 ‎‡2 LC|n 85279063‏
996 ‎‡2 ISNI|0000000059313707‏
996 ‎‡2 BNC|981058521041406706‏
996 ‎‡2 DNB|1053253184‏
996 ‎‡2 BNE|XX934515‏
996 ‎‡2 BNE|XX1119567‏
996 ‎‡2 DNB|1165585308‏
996 ‎‡2 DNB|121079171‏
996 ‎‡2 ISNI|0000000059280685‏
996 ‎‡2 PLWABN|9810591193405606‏
996 ‎‡2 BNE|XX1774205‏
996 ‎‡2 PTBNP|99055‏
996 ‎‡2 PTBNP|1791496‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏