VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q91105886 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000120.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q91105886‏
024 ‎‡a 0000-0002-6389-3665‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q91105886‏
100 0 ‎‡a Edouard G Stanley‏ ‎‡c researcher (ORCID 0000-0002-6389-3665)‏ ‎‡9 en‏
400 0 ‎‡a Edouard G Stanley‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 1010 - CHARACTERIZING HOXA-EXPRESSING ENDOTHELIAL AND HAEMATOPOIETIC POPULATIONS DERIVED FROM HUMAN PLURIPOTENT STEM CELLS‏
670 ‎‡a Author's 3176 – MULTIPOTENT RAG1+ PROGENITORS EMERGE DIRECTLY FROM HEMOGENIC ENDOTHELIUM IN HUMAN PSC DERIVED HEMOPOIETIC ORGANOIDS‏
670 ‎‡a Author's A Cas9 Variant for Efficient Generation of Indel-Free Knockin or Gene-Corrected Human Pluripotent Stem Cells‏
670 ‎‡a Author's A method for genetic modification of human embryonic stem cells using electroporation‏
670 ‎‡a Author's A mouse carrying the green fluorescent protein gene targeted to the Pdx1 locus facilitates the study of pancreas development and function.‏
670 ‎‡a Author's A protocol describing the use of a recombinant protein-based, animal product-free medium (APEL) for human embryonic stem cell differentiation as spin embryoid bodies‏
670 ‎‡a Author's A protocol for removal of antibiotic resistance cassettes from human embryonic stem cells genetically modified by homologous recombination or transgenesis‏
670 ‎‡a Author's A targeted NKX2.1 human embryonic stem cell reporter line enables identification of human basal forebrain derivatives.‏
670 ‎‡a Author's ALPK3-deficient cardiomyocytes generated from patient-derived induced pluripotent stem cells and mutant human embryonic stem cells display abnormal calcium handling and establish that ALPK3 deficiency underlies familial cardiomyopathy.‏
670 ‎‡a Author's An INSULIN-GFP/GLUCAGON-mCherry reporter line for the study of human pancreatic endocrine cell development‏
670 ‎‡a Author's Analysis of mitochondrial function and localisation during human embryonic stem cell differentiation in vitro.‏
670 ‎‡a Author's APELIN promotes hematopoiesis from human embryonic stem cells‏
670 ‎‡a Author's Blood cells form from phenotypically distinct precursors during human blast colony differentiation‏
670 ‎‡a Author's Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity‏
670 ‎‡a Author's Building better beta cells‏
670 ‎‡a Author's CD13 and ROR2 Permit Isolation of Highly Enriched Cardiac Mesoderm from Differentiating Human Embryonic Stem Cells‏
670 ‎‡a Author's CD90 Marks a Mesenchymal Program in Human Thymic Epithelial Cells <i>In Vitro</i> and <i>In Vivo</i>‏
670 ‎‡a Author's Coculturing with endothelial cells promotes in vitro maturation and electrical coupling of human embryonic stem cell-derived cardiomyocytes‏
670 ‎‡a Author's CRISPR/Cas9 gene editing of a SOX9 reporter human iPSC line to produce two TRPV4 patient heterozygous missense mutant iPSC lines, MCRIi001-A-3 (TRPV4 p.F273L) and MCRIi001-A-4 (TRPV4 p.P799L)‏
670 ‎‡a Author's Defined substrates for pluripotent stem cells: are we there yet?‏
670 ‎‡a Author's Derivation of endothelial cells from human embryonic stem cells in fully defined medium enables identification of lysophosphatidic acid and platelet activating factor as regulators of eNOS localization‏
670 ‎‡a Author's Derivation of insulin-producing beta-cells from human pluripotent stem cells‏
670 ‎‡a Author's Differentiating embryonic stem cells pass through 'temporal windows' that mark responsiveness to exogenous and paracrine mesendoderm inducing signals‏
670 ‎‡a Author's Differentiation of human embryonic stem cells in serum-free medium reveals distinct roles for bone morphogenetic protein 4, vascular endothelial growth factor, stem cell factor, and fibroblast growth factor 2 in hematopoiesis‏
670 ‎‡a Author's Differentiation of human embryonic stem cells to HOXA+ hemogenic vasculature that resembles the aorta-gonad-mesonephros.‏
670 ‎‡a Author's Directed differentiation and functional maturation of cortical interneurons from human embryonic stem cells‏
670 ‎‡a Author's Directed differentiation of human embryonic stem cells as spin embryoid bodies and a description of the hematopoietic blast colony forming assay‏
670 ‎‡a Author's Efficient Cre-mediated deletion in cardiac progenitor cells conferred by a 3'UTR-ires-Cre allele of the homeobox gene Nkx2-5.‏
670 ‎‡a Author's Efficient endoderm induction from human pluripotent stem cells by logically directing signals controlling lineage bifurcations.‏
670 ‎‡a Author's Efficient generation of adipocytes in a dish‏
670 ‎‡a Author's Efficient generation of NKX6-1+ pancreatic progenitors from multiple human pluripotent stem cell lines‏
670 ‎‡a Author's Efficiently Specified Ventral Midbrain Dopamine Neurons from Human Pluripotent Stem Cells Under Xeno-Free Conditions Restore Motor Deficits in Parkinsonian Rodents.‏
670 ‎‡a Author's Endocrine cells develop within pancreatic bud-like structures derived from mouse ES cells differentiated in response to BMP4 and retinoic acid‏
670 ‎‡a Author's Enforced Expression of HOXB4 in Human Embryonic Stem Cells Enhances the Production of Hematopoietic Progenitors but Has No Effect on the Maturation of Red Blood Cells.‏
670 ‎‡a Author's Enforced expression of Mixl1 during mouse ES cell differentiation suppresses hematopoietic mesoderm and promotes endoderm formation‏
670 ‎‡a Author's Engineered human pluripotent-stem-cell-derived intestinal tissues with a functional enteric nervous system‏
670 ‎‡a Author's ErythRED, a hESC line enabling identification of erythroid cells‏
670 ‎‡a Author's Expansion of human embryonic stem cells in vitro‏
670 ‎‡a Author's Expression from a betageo gene trap in the Slain1 gene locus is predominantly associated with the developing nervous system.‏
670 ‎‡a Author's Expression of RUNX1-ETO Rapidly Alters the Chromatin Landscape and Growth of Early Human Myeloid Precursor Cells‏
670 ‎‡a Author's Forced aggregation of defined numbers of human embryonic stem cells into embryoid bodies fosters robust, reproducible hematopoietic differentiation.‏
670 ‎‡a Author's Fourier transform infrared microspectroscopy identifies early lineage commitment in differentiating human embryonic stem cells‏
670 ‎‡a Author's Fourier transform infrared microspectroscopy reveals that tissue culture conditions affect the macromolecular phenotype of human embryonic stem cells‏
670 ‎‡a Author's Fourier transform infrared microspectroscopy reveals unique phenotypes for human embryonic and induced pluripotent stem cell lines and their progeny.‏
670 ‎‡a Author's FOXN1 (GFP/w) reporter hESCs enable identification of integrin-β4, HLA-DR, and EpCAM as markers of human PSC-derived FOXN1(+) thymic epithelial progenitors.‏
670 ‎‡a Author's Functional maturation of hPSC-derived forebrain interneurons requires an extended timeline and mimics human neural development.‏
670 ‎‡a Author's Fusion of Regionally Specified hPSC-Derived Organoids Models Human Brain Development and Interneuron Migration‏
670 ‎‡a Author's GAPTrap: A Simple Expression System for Pluripotent Stem Cells and Their Derivatives‏
670 ‎‡a Author's Generating GABAergic cerebral cortical interneurons from mouse and human embryonic stem cells.‏
670 ‎‡a Author's Generation of a heterozygous COL1A1 (c.3969_3970insT) osteogenesis imperfecta mutation human iPSC line, MCRIi001-A-1, using CRISPR/Cas9 editing‏
670 ‎‡a Author's Generation of a heterozygous COL2A1 (p.R989C) spondyloepiphyseal dysplasia congenita mutation iPSC line, MCRIi001-B, using CRISPR/Cas9 gene editing‏
670 ‎‡a Author's Generation of a SOX9-tdTomato reporter human iPSC line, MCRIi001-A-2, using CRISPR/Cas9 editing‏
670 ‎‡a Author's Generation of human embryonic stem cell reporter knock-in lines by homologous recombination‏
670 ‎‡a Author's Generation of human female reproductive tract epithelium from human embryonic stem cells.‏
670 ‎‡a Author's Generation of iPSC lines from peripheral blood mononuclear cells from 5 healthy adults‏
670 ‎‡a Author's Generation of megakaryocytic progenitors from human embryonic stem cells in a feeder- and serum-free medium.‏
670 ‎‡a Author's Generation of RAB39B knockout isogenic human embryonic stem cell lines to model RAB39B-mediated Parkinson's disease.‏
670 ‎‡a Author's Generation of seven iPSC lines from peripheral blood mononuclear cells suitable to investigate Autism Spectrum Disorder‏
670 ‎‡a Author's Hrk/DP5 contributes to the apoptosis of select neuronal populations but is dispensable for haematopoietic cell apoptosis.‏
670 ‎‡a Author's Human chondrogenic paraxial mesoderm, directed specification and prospective isolation from pluripotent stem cells‏
670 ‎‡a Author's Human definitive haemogenic endothelium and arterial vascular endothelium represent distinct lineages‏
670 ‎‡a Author's Human embryonic stem cell derived mesenchymal progenitors express cardiac markers but do not form contractile cardiomyocytes.‏
670 ‎‡a Author's Human haematopoietic stem cell development: from the embryo to the dish‏
670 ‎‡a Author's Human yolk sac-like haematopoiesis generates RUNX1- and GFI1/1B-dependent blood and SOX17-positive endothelium‏
670 ‎‡a Author's Induced pluripotent stem cell macrophages present antigen to proinsulin-specific T cell receptors from donor-matched islet-infiltrating T cells in type 1 diabetes‏
670 ‎‡a Author's Inhibition of DYRK1A disrupts neural lineage specification in human pluripotent stem cells‏
670 ‎‡a Author's Integrin αvβ5 heterodimer is a specific marker of human pancreatic beta cells‏
670 ‎‡a Author's Isolation of human lymphatic endothelial cells by multi-parameter fluorescence-activated cell sorting‏
670 ‎‡a Author's Kidney micro-organoids in suspension culture as a scalable source of human pluripotent stem cell-derived kidney cells‏
670 ‎‡a Author's Long-Term Maintenance of Human Pluripotent Stem Cells on cRGDfK-Presenting Synthetic Surfaces.‏
670 ‎‡a Author's Magnetic Resonance Imaging of Iron Oxide-Labeled Human Embryonic Stem Cell-Derived Cardiac Progenitors‏
670 ‎‡a Author's Microbioreactor arrays for full factorial screening of exogenous and paracrine factors in human embryonic stem cell differentiation.‏
670 ‎‡a Author's Mimicry of embryonic circulation enhances the hoxa hemogenic niche and human blood development‏
670 ‎‡a Author's Mixl1 and oct4 proteins are transiently co-expressed in differentiating mouse and human embryonic stem cells.‏
670 ‎‡a Author's Mixl1 is required for axial mesendoderm morphogenesis and patterning in the murine embryo‏
670 ‎‡a Author's Multipotent RAG1+ progenitors emerge directly from haemogenic endothelium in human pluripotent stem cell-derived haematopoietic organoids‏
670 ‎‡a Author's NKX2-5‏
670 ‎‡a Author's NKX2-5(eGFP/w) hESCs for isolation of human cardiac progenitors and cardiomyocytes.‏
670 ‎‡a Author's NKX2-5 regulates human cardiomyogenesis via a HEY2 dependent transcriptional network.‏
670 ‎‡a Author's Overcoming Monocarboxylate Transporter 8‏
670 ‎‡a Author's Overcoming Monocarboxylate Transporter 8 (MCT8)-Deficiency to Promote Human Oligodendrocyte Differentiation and Myelination‏
670 ‎‡a Author's Pancreas differentiation of mouse ES cells‏
670 ‎‡a Author's Pancreatic differentiation from pluripotent stem cells: tweaking the system.‏
670 ‎‡a Author's Pdgfrα and Flk1 are direct target genes of Mixl1 in differentiating embryonic stem cells.‏
670 ‎‡a Author's Proapoptotic BH3-only Bcl-2 family member Bik/Blk/Nbk is expressed in hemopoietic and endothelial cells but is redundant for their programmed death‏
670 ‎‡a Author's Productive Infection of Human Embryonic Stem Cell-Derived NKX2.1+ Respiratory Progenitors with Human Rhinovirus.‏
670 ‎‡a Author's Publisher Correction: The role of cardiac transcription factor NKX2-5 in regulating the human cardiac miRNAome‏
670 ‎‡a Author's Regulation of human embryonic stem cell differentiation by BMP-2 and its antagonist noggin‏
670 ‎‡a Author's Regulatory networks specifying cortical interneurons from human embryonic stem cells reveal roles for CHD2 in interneuron development‏
670 ‎‡a Author's Reshaping pluripotent stem cells‏
670 ‎‡a Author's Retinoic acid induces Pdx1-positive endoderm in differentiating mouse embryonic stem cells‏
670 ‎‡a Author's Rewiring immunity: generating a functional thymus from hESCs… are we there yet?‏
670 ‎‡a Author's RUNX1 AND GROUP F SOX GENES ARE REQUIRED AT DISTINCT STAGES FOR HUMAN HAEMATOPOIETIC DEVELOPMENT‏
670 ‎‡a Author's Simultaneous Reprogramming and Gene Correction of Patient Fibroblasts‏
670 ‎‡a Author's SIRPA is a specific cell-surface marker for isolating cardiomyocytes derived from human pluripotent stem cells.‏
670 ‎‡a Author's SIRPA, VCAM1 and CD34 identify discrete lineages during early human cardiovascular development.‏
670 ‎‡a Author's Spatio-temporal re-organization of replication foci accompanies replication domain consolidation during human pluripotent stem cell lineage specification.‏
670 ‎‡a Author's Stage-specific signaling through TGFβ family members and WNT regulates patterning and pancreatic specification of human pluripotent stem cells.‏
670 ‎‡a Author's Stems cells and the price of immortality‏
670 ‎‡a Author's Targeting a GFP reporter gene to the MIXL1 locus of human embryonic stem cells identifies human primitive streak-like cells and enables isolation of primitive hematopoietic precursors.‏
670 ‎‡a Author's Temporal restriction of pancreatic branching competence during embryogenesis is mirrored in differentiating embryonic stem cells.‏
670 ‎‡a Author's The characterisation of pluripotent and multipotent stem cells using Fourier transform infrared microspectroscopy.‏
670 ‎‡a Author's The hESC line Envy expresses high levels of GFP in all differentiated progeny.‏
670 ‎‡a Author's The Mix family of homeobox genes--key regulators of mesendoderm formation during vertebrate development.‏
670 ‎‡a Author's The primitive streak gene Mixl1 is required for efficient haematopoiesis and BMP4-induced ventral mesoderm patterning in differentiating ES cells‏
670 ‎‡a Author's The role of cardiac transcription factor NKX2-5 in regulating the human cardiac miRNAome‏
670 ‎‡a Author's The use of simultaneous reprogramming and gene correction to generate an osteogenesis imperfecta patient COL1A1 c. 3936 G>T iPSC line and an isogenic control iPSC line‏
670 ‎‡a Author's Transcriptional profiling of mouse and human ES cells identifies SLAIN1, a novel stem cell gene.‏
670 ‎‡a Author's WNT3A promotes hematopoietic or mesenchymal differentiation from hESCs depending on the time of exposure‏
670 ‎‡a Author's WNT9A Is a Conserved Regulator of Hematopoietic Stem and Progenitor Cell Development‏
670 ‎‡a Author's β-cell regeneration and differentiation: how close are we to the 'holy grail'?‏
909 ‎‡a (orcid) 0000000263893665‏ ‎‡9 1‏
919 ‎‡a βcellregenerationanddifferentiationhowclosearewetotheholygrail‏ ‎‡A β-cell regeneration and differentiation: how close are we to the 'holy grail'?‏ ‎‡9 1‏
919 ‎‡a wnt9aisaconservedregulatorofhematopoieticstemandprogenitorcelldevelopment‏ ‎‡A WNT9A Is a Conserved Regulator of Hematopoietic Stem and Progenitor Cell Development‏ ‎‡9 1‏
919 ‎‡a wnt3apromoteshematopoieticormesenchymaldifferentiationfromhescsdependingonthetimeofexposure‏ ‎‡A WNT3A promotes hematopoietic or mesenchymal differentiation from hESCs depending on the time of exposure‏ ‎‡9 1‏
919 ‎‡a transcriptionalprofilingofmouseandhumanescellsidentifiesslain1anovelstemcellgene‏ ‎‡A Transcriptional profiling of mouse and human ES cells identifies SLAIN1, a novel stem cell gene.‏ ‎‡9 1‏
919 ‎‡a useofsimultaneousreprogrammingandgenecorrectiontogenerateanosteogenesisimperfectapatientcol1a11003936gtipsclineandanisogeniccontrolipscline‏ ‎‡A The use of simultaneous reprogramming and gene correction to generate an osteogenesis imperfecta patient COL1A1 c. 3936 G>T iPSC line and an isogenic control iPSC line‏ ‎‡9 1‏
919 ‎‡a roleofcardiactranscriptionfactornkx25inregulatingthehumancardiacmirnaome‏ ‎‡A The role of cardiac transcription factor NKX2-5 in regulating the human cardiac miRNAome‏ ‎‡9 1‏
919 ‎‡a primitivestreakgenemixl1isrequiredforefficienthaematopoiesisandbmp4inducedventralmesodermpatterningindifferentiatingescells‏ ‎‡A The primitive streak gene Mixl1 is required for efficient haematopoiesis and BMP4-induced ventral mesoderm patterning in differentiating ES cells‏ ‎‡9 1‏
919 ‎‡a 1009familyofhomeoboxgeneskeyregulatorsofmesendodermformationduringvertebratedevelopment‏ ‎‡A The Mix family of homeobox genes--key regulators of mesendoderm formation during vertebrate development.‏ ‎‡9 1‏
919 ‎‡a hesclineenvyexpresseshighlevelsofgfpinalldifferentiatedprogeny‏ ‎‡A The hESC line Envy expresses high levels of GFP in all differentiated progeny.‏ ‎‡9 1‏
919 ‎‡a characterisationofpluripotentandmultipotentstemcellsusingfouriertransforminfraredmicrospectroscopy‏ ‎‡A The characterisation of pluripotent and multipotent stem cells using Fourier transform infrared microspectroscopy.‏ ‎‡9 1‏
919 ‎‡a temporalrestrictionofpancreaticbranchingcompetenceduringembryogenesisismirroredindifferentiatingembryonicstemcells‏ ‎‡A Temporal restriction of pancreatic branching competence during embryogenesis is mirrored in differentiating embryonic stem cells.‏ ‎‡9 1‏
919 ‎‡a targetingagfpreportergenetothemixl1locusofhumanembryonicstemcellsidentifieshumanprimitivestreaklikecellsandenablesisolationofprimitivehematopoieticprecursors‏ ‎‡A Targeting a GFP reporter gene to the MIXL1 locus of human embryonic stem cells identifies human primitive streak-like cells and enables isolation of primitive hematopoietic precursors.‏ ‎‡9 1‏
919 ‎‡a stemscellsandthepriceofimmortality‏ ‎‡A Stems cells and the price of immortality‏ ‎‡9 1‏
919 ‎‡a stagespecificsignalingthroughtgfβfamilymembersandwntregulatespatterningandpancreaticspecificationofhumanpluripotentstemcells‏ ‎‡A Stage-specific signaling through TGFβ family members and WNT regulates patterning and pancreatic specification of human pluripotent stem cells.‏ ‎‡9 1‏
919 ‎‡a spatiotemporalreorganizationofreplicationfociaccompaniesreplicationdomainconsolidationduringhumanpluripotentstemcelllineagespecification‏ ‎‡A Spatio-temporal re-organization of replication foci accompanies replication domain consolidation during human pluripotent stem cell lineage specification.‏ ‎‡9 1‏
919 ‎‡a sirpavcam1andcd34identifydiscretelineagesduringearlyhumancardiovasculardevelopment‏ ‎‡A SIRPA, VCAM1 and CD34 identify discrete lineages during early human cardiovascular development.‏ ‎‡9 1‏
919 ‎‡a sirpaisaspecificcellsurfacemarkerforisolatingcardiomyocytesderivedfromhumanpluripotentstemcells‏ ‎‡A SIRPA is a specific cell-surface marker for isolating cardiomyocytes derived from human pluripotent stem cells.‏ ‎‡9 1‏
919 ‎‡a simultaneousreprogrammingandgenecorrectionofpatientfibroblasts‏ ‎‡A Simultaneous Reprogramming and Gene Correction of Patient Fibroblasts‏ ‎‡9 1‏
919 ‎‡a runx1andgroupfsoxgenesarerequiredatdistinctstagesforhumanhaematopoieticdevelopment‏ ‎‡A RUNX1 AND GROUP F SOX GENES ARE REQUIRED AT DISTINCT STAGES FOR HUMAN HAEMATOPOIETIC DEVELOPMENT‏ ‎‡9 1‏
919 ‎‡a rewiringimmunitygeneratingafunctionalthymusfromhescsarewethereyet‏ ‎‡A Rewiring immunity: generating a functional thymus from hESCs… are we there yet?‏ ‎‡9 1‏
919 ‎‡a retinoicacidinducespdx1positiveendodermindifferentiatingmouseembryonicstemcells‏ ‎‡A Retinoic acid induces Pdx1-positive endoderm in differentiating mouse embryonic stem cells‏ ‎‡9 1‏
919 ‎‡a reshapingpluripotentstemcells‏ ‎‡A Reshaping pluripotent stem cells‏ ‎‡9 1‏
919 ‎‡a regulatorynetworksspecifyingcorticalinterneuronsfromhumanembryonicstemcellsrevealrolesforchd2ininterneurondevelopment‏ ‎‡A Regulatory networks specifying cortical interneurons from human embryonic stem cells reveal roles for CHD2 in interneuron development‏ ‎‡9 1‏
919 ‎‡a regulationofhumanembryonicstemcelldifferentiationbybmp2anditsantagonistnoggin‏ ‎‡A Regulation of human embryonic stem cell differentiation by BMP-2 and its antagonist noggin‏ ‎‡9 1‏
919 ‎‡a publishercorrectiontheroleofcardiactranscriptionfactornkx25inregulatingthehumancardiacmirnaome‏ ‎‡A Publisher Correction: The role of cardiac transcription factor NKX2-5 in regulating the human cardiac miRNAome‏ ‎‡9 1‏
919 ‎‡a productiveinfectionofhumanembryonicstemcellderivednkx21+respiratoryprogenitorswithhumanrhinovirus‏ ‎‡A Productive Infection of Human Embryonic Stem Cell-Derived NKX2.1+ Respiratory Progenitors with Human Rhinovirus.‏ ‎‡9 1‏
919 ‎‡a proapoptoticbh3onlybcl2familymemberbikblknbkisexpressedinhemopoieticandendothelialcellsbutisredundantfortheirprogrammeddeath‏ ‎‡A Proapoptotic BH3-only Bcl-2 family member Bik/Blk/Nbk is expressed in hemopoietic and endothelial cells but is redundant for their programmed death‏ ‎‡9 1‏
919 ‎‡a pdgfrαandflk1aredirecttargetgenesofmixl1indifferentiatingembryonicstemcells‏ ‎‡A Pdgfrα and Flk1 are direct target genes of Mixl1 in differentiating embryonic stem cells.‏ ‎‡9 1‏
919 ‎‡a pancreaticdifferentiationfrompluripotentstemcellstweakingthesystem‏ ‎‡A Pancreatic differentiation from pluripotent stem cells: tweaking the system.‏ ‎‡9 1‏
919 ‎‡a pancreasdifferentiationofmouseescells‏ ‎‡A Pancreas differentiation of mouse ES cells‏ ‎‡9 1‏
919 ‎‡a overcomingmonocarboxylatetransporter8mct8deficiencytopromotehumanoligodendrocytedifferentiationandmyelination‏ ‎‡A Overcoming Monocarboxylate Transporter 8 (MCT8)-Deficiency to Promote Human Oligodendrocyte Differentiation and Myelination‏ ‎‡9 1‏
919 ‎‡a overcomingmonocarboxylatetransporter8‏ ‎‡A Overcoming Monocarboxylate Transporter 8‏ ‎‡9 1‏
919 ‎‡a nkx25regulateshumancardiomyogenesisviaahey2dependenttranscriptionalnetwork‏ ‎‡A NKX2-5 regulates human cardiomyogenesis via a HEY2 dependent transcriptional network.‏ ‎‡9 1‏
919 ‎‡a nkx25egfpwhescsforisolationofhumancardiacprogenitorsandcardiomyocytes‏ ‎‡A NKX2-5(eGFP/w) hESCs for isolation of human cardiac progenitors and cardiomyocytes.‏ ‎‡9 1‏
919 ‎‡a nkx25‏ ‎‡A NKX2-5‏ ‎‡9 1‏
919 ‎‡a multipotentrag1+progenitorsemergedirectlyfromhaemogenicendotheliuminhumanpluripotentstemcellderivedhaematopoieticorganoids‏ ‎‡A Multipotent RAG1+ progenitors emerge directly from haemogenic endothelium in human pluripotent stem cell-derived haematopoietic organoids‏ ‎‡9 1‏
919 ‎‡a microbioreactorarraysforfullfactorialscreeningofexogenousandparacrinefactorsinhumanembryonicstemcelldifferentiation‏ ‎‡A Microbioreactor arrays for full factorial screening of exogenous and paracrine factors in human embryonic stem cell differentiation.‏ ‎‡9 1‏
919 ‎‡a magneticresonanceimagingofironoxidelabeledhumanembryonicstemcellderivedcardiacprogenitors‏ ‎‡A Magnetic Resonance Imaging of Iron Oxide-Labeled Human Embryonic Stem Cell-Derived Cardiac Progenitors‏ ‎‡9 1‏
919 ‎‡a longtermmaintenanceofhumanpluripotentstemcellsoncrgdfkpresentingsyntheticsurfaces‏ ‎‡A Long-Term Maintenance of Human Pluripotent Stem Cells on cRGDfK-Presenting Synthetic Surfaces.‏ ‎‡9 1‏
919 ‎‡a kidneymicroorganoidsinsuspensioncultureasascalablesourceofhumanpluripotentstemcellderivedkidneycells‏ ‎‡A Kidney micro-organoids in suspension culture as a scalable source of human pluripotent stem cell-derived kidney cells‏ ‎‡9 1‏
919 ‎‡a isolationofhumanlymphaticendothelialcellsbymultiparameterfluorescenceactivatedcellsorting‏ ‎‡A Isolation of human lymphatic endothelial cells by multi-parameter fluorescence-activated cell sorting‏ ‎‡9 1‏
919 ‎‡a integrinαvβ5heterodimerisaspecificmarkerofhumanpancreaticbetacells‏ ‎‡A Integrin αvβ5 heterodimer is a specific marker of human pancreatic beta cells‏ ‎‡9 1‏
919 ‎‡a inhibitionofdyrk1adisruptsneurallineagespecificationinhumanpluripotentstemcells‏ ‎‡A Inhibition of DYRK1A disrupts neural lineage specification in human pluripotent stem cells‏ ‎‡9 1‏
919 ‎‡a inducedpluripotentstemcellmacrophagespresentantigentoproinsulinspecifictcellreceptorsfromdonormatchedisletinfiltratingtcellsintype1diabetes‏ ‎‡A Induced pluripotent stem cell macrophages present antigen to proinsulin-specific T cell receptors from donor-matched islet-infiltrating T cells in type 1 diabetes‏ ‎‡9 1‏
919 ‎‡a humanyolksaclikehaematopoiesisgeneratesrunx1andgfi11bdependentbloodandsox17positiveendothelium‏ ‎‡A Human yolk sac-like haematopoiesis generates RUNX1- and GFI1/1B-dependent blood and SOX17-positive endothelium‏ ‎‡9 1‏
919 ‎‡a humanhaematopoieticstemcelldevelopmentfromtheembryotothedish‏ ‎‡A Human haematopoietic stem cell development: from the embryo to the dish‏ ‎‡9 1‏
919 ‎‡a humanembryonicstemcellderivedmesenchymalprogenitorsexpresscardiacmarkersbutdonotformcontractilecardiomyocytes‏ ‎‡A Human embryonic stem cell derived mesenchymal progenitors express cardiac markers but do not form contractile cardiomyocytes.‏ ‎‡9 1‏
919 ‎‡a humandefinitivehaemogenicendotheliumandarterialvascularendotheliumrepresentdistinctlineages‏ ‎‡A Human definitive haemogenic endothelium and arterial vascular endothelium represent distinct lineages‏ ‎‡9 1‏
919 ‎‡a humanchondrogenicparaxialmesodermdirectedspecificationandprospectiveisolationfrompluripotentstemcells‏ ‎‡A Human chondrogenic paraxial mesoderm, directed specification and prospective isolation from pluripotent stem cells‏ ‎‡9 1‏
919 ‎‡a hrkdp5contributestotheapoptosisofselectneuronalpopulationsbutisdispensableforhaematopoieticcellapoptosis‏ ‎‡A Hrk/DP5 contributes to the apoptosis of select neuronal populations but is dispensable for haematopoietic cell apoptosis.‏ ‎‡9 1‏
919 ‎‡a generationof7ipsclinesfromperipheralbloodmononuclearcellssuitabletoinvestigateautismspectrumdisorder‏ ‎‡A Generation of seven iPSC lines from peripheral blood mononuclear cells suitable to investigate Autism Spectrum Disorder‏ ‎‡9 1‏
919 ‎‡a generationofrab39bknockoutisogenichumanembryonicstemcelllinestomodelrab39bmediatedparkinsonsdisease‏ ‎‡A Generation of RAB39B knockout isogenic human embryonic stem cell lines to model RAB39B-mediated Parkinson's disease.‏ ‎‡9 1‏
919 ‎‡a generationofmegakaryocyticprogenitorsfromhumanembryonicstemcellsinafeederandserumfreemedium‏ ‎‡A Generation of megakaryocytic progenitors from human embryonic stem cells in a feeder- and serum-free medium.‏ ‎‡9 1‏
919 ‎‡a generationofipsclinesfromperipheralbloodmononuclearcellsfrom5healthyadults‏ ‎‡A Generation of iPSC lines from peripheral blood mononuclear cells from 5 healthy adults‏ ‎‡9 1‏
919 ‎‡a generationofhumanfemalereproductivetractepitheliumfromhumanembryonicstemcells‏ ‎‡A Generation of human female reproductive tract epithelium from human embryonic stem cells.‏ ‎‡9 1‏
919 ‎‡a generationofhumanembryonicstemcellreporterknockinlinesbyhomologousrecombination‏ ‎‡A Generation of human embryonic stem cell reporter knock-in lines by homologous recombination‏ ‎‡9 1‏
919 ‎‡a generationofasox9tdtomatoreporterhumanipsclinemcrii001a2usingcrisprcas9editing‏ ‎‡A Generation of a SOX9-tdTomato reporter human iPSC line, MCRIi001-A-2, using CRISPR/Cas9 editing‏ ‎‡9 1‏
919 ‎‡a generationofaheterozygouscol2a1pr989cspondyloepiphysealdysplasiacongenitamutationipsclinemcrii001busingcrisprcas9geneediting‏ ‎‡A Generation of a heterozygous COL2A1 (p.R989C) spondyloepiphyseal dysplasia congenita mutation iPSC line, MCRIi001-B, using CRISPR/Cas9 gene editing‏ ‎‡9 1‏
919 ‎‡a generationofaheterozygouscol1a110039693970instosteogenesisimperfectamutationhumanipsclinemcrii001a1usingcrisprcas9editing‏ ‎‡A Generation of a heterozygous COL1A1 (c.3969_3970insT) osteogenesis imperfecta mutation human iPSC line, MCRIi001-A-1, using CRISPR/Cas9 editing‏ ‎‡9 1‏
919 ‎‡a generatinggabaergiccerebralcorticalinterneuronsfrommouseandhumanembryonicstemcells‏ ‎‡A Generating GABAergic cerebral cortical interneurons from mouse and human embryonic stem cells.‏ ‎‡9 1‏
919 ‎‡a gaptrapasimpleexpressionsystemforpluripotentstemcellsandtheirderivatives‏ ‎‡A GAPTrap: A Simple Expression System for Pluripotent Stem Cells and Their Derivatives‏ ‎‡9 1‏
919 ‎‡a fusionofregionallyspecifiedhpscderivedorganoidsmodelshumanbraindevelopmentandinterneuronmigration‏ ‎‡A Fusion of Regionally Specified hPSC-Derived Organoids Models Human Brain Development and Interneuron Migration‏ ‎‡9 1‏
919 ‎‡a functionalmaturationofhpscderivedforebraininterneuronsrequiresanextendedtimelineandmimicshumanneuraldevelopment‏ ‎‡A Functional maturation of hPSC-derived forebrain interneurons requires an extended timeline and mimics human neural development.‏ ‎‡9 1‏
919 ‎‡a foxn1gfpwreporterhescsenableidentificationofintegrinβ4hladrandepcamasmarkersofhumanpscderivedfoxn1+thymicepithelialprogenitors‏ ‎‡A FOXN1 (GFP/w) reporter hESCs enable identification of integrin-β4, HLA-DR, and EpCAM as markers of human PSC-derived FOXN1(+) thymic epithelial progenitors.‏ ‎‡9 1‏
919 ‎‡a fouriertransforminfraredmicrospectroscopyrevealsthattissuecultureconditionsaffectthemacromolecularphenotypeofhumanembryonicstemcells‏ ‎‡A Fourier transform infrared microspectroscopy reveals that tissue culture conditions affect the macromolecular phenotype of human embryonic stem cells‏ ‎‡9 1‏
919 ‎‡a fouriertransforminfraredmicrospectroscopyidentifiesearlylineagecommitmentindifferentiatinghumanembryonicstemcells‏ ‎‡A Fourier transform infrared microspectroscopy identifies early lineage commitment in differentiating human embryonic stem cells‏ ‎‡9 1‏
919 ‎‡a forcedaggregationofdefinednumbersofhumanembryonicstemcellsintoembryoidbodiesfostersrobustreproduciblehematopoieticdifferentiation‏ ‎‡A Forced aggregation of defined numbers of human embryonic stem cells into embryoid bodies fosters robust, reproducible hematopoietic differentiation.‏ ‎‡9 1‏
919 ‎‡a expressionofrunx1etorapidlyaltersthechromatinlandscapeandgrowthofearlyhumanmyeloidprecursorcells‏ ‎‡A Expression of RUNX1-ETO Rapidly Alters the Chromatin Landscape and Growth of Early Human Myeloid Precursor Cells‏ ‎‡9 1‏
919 ‎‡a expressionfromabetageogenetrapintheslain1genelocusispredominantlyassociatedwiththedevelopingnervoussystem‏ ‎‡A Expression from a betageo gene trap in the Slain1 gene locus is predominantly associated with the developing nervous system.‏ ‎‡9 1‏
919 ‎‡a expansionofhumanembryonicstemcellsinvitro‏ ‎‡A Expansion of human embryonic stem cells in vitro‏ ‎‡9 1‏
919 ‎‡a erythredahesclineenablingidentificationoferythroidcells‏ ‎‡A ErythRED, a hESC line enabling identification of erythroid cells‏ ‎‡9 1‏
919 ‎‡a engineeredhumanpluripotentstemcellderivedintestinaltissueswithafunctionalentericnervoussystem‏ ‎‡A Engineered human pluripotent-stem-cell-derived intestinal tissues with a functional enteric nervous system‏ ‎‡9 1‏
919 ‎‡a enforcedexpressionofmixl1duringmouseescelldifferentiationsuppresseshematopoieticmesodermandpromotesendodermformation‏ ‎‡A Enforced expression of Mixl1 during mouse ES cell differentiation suppresses hematopoietic mesoderm and promotes endoderm formation‏ ‎‡9 1‏
919 ‎‡a enforcedexpressionofhoxb4inhumanembryonicstemcellsenhancestheproductionofhematopoieticprogenitorsbuthasnoeffectonthematurationofredbloodcells‏ ‎‡A Enforced Expression of HOXB4 in Human Embryonic Stem Cells Enhances the Production of Hematopoietic Progenitors but Has No Effect on the Maturation of Red Blood Cells.‏ ‎‡9 1‏
919 ‎‡a endocrinecellsdevelopwithinpancreaticbudlikestructuresderivedfrommouseescellsdifferentiatedinresponsetobmp4andretinoicacid‏ ‎‡A Endocrine cells develop within pancreatic bud-like structures derived from mouse ES cells differentiated in response to BMP4 and retinoic acid‏ ‎‡9 1‏
919 ‎‡a efficientlyspecifiedventralmidbraindopamineneuronsfromhumanpluripotentstemcellsunderxenofreeconditionsrestoremotordeficitsinparkinsonianrodents‏ ‎‡A Efficiently Specified Ventral Midbrain Dopamine Neurons from Human Pluripotent Stem Cells Under Xeno-Free Conditions Restore Motor Deficits in Parkinsonian Rodents.‏ ‎‡9 1‏
919 ‎‡a efficientgenerationofnkx61+pancreaticprogenitorsfrommultiplehumanpluripotentstemcelllines‏ ‎‡A Efficient generation of NKX6-1+ pancreatic progenitors from multiple human pluripotent stem cell lines‏ ‎‡9 1‏
919 ‎‡a efficientgenerationofadipocytesinadish‏ ‎‡A Efficient generation of adipocytes in a dish‏ ‎‡9 1‏
919 ‎‡a fouriertransforminfraredmicrospectroscopyrevealsuniquephenotypesforhumanembryonicandinducedpluripotentstemcelllinesandtheirprogeny‏ ‎‡A Fourier transform infrared microspectroscopy reveals unique phenotypes for human embryonic and induced pluripotent stem cell lines and their progeny.‏ ‎‡9 1‏
919 ‎‡a efficientendoderminductionfromhumanpluripotentstemcellsbylogicallydirectingsignalscontrollinglineagebifurcations‏ ‎‡A Efficient endoderm induction from human pluripotent stem cells by logically directing signals controlling lineage bifurcations.‏ ‎‡9 1‏
919 ‎‡a mimicryofembryoniccirculationenhancesthehoxahemogenicnicheandhumanblooddevelopment‏ ‎‡A Mimicry of embryonic circulation enhances the hoxa hemogenic niche and human blood development‏ ‎‡9 1‏
919 ‎‡a mixl1andoct4proteinsaretransientlycoexpressedindifferentiatingmouseandhumanembryonicstemcells‏ ‎‡A Mixl1 and oct4 proteins are transiently co-expressed in differentiating mouse and human embryonic stem cells.‏ ‎‡9 1‏
919 ‎‡a mixl1isrequiredforaxialmesendodermmorphogenesisandpatterninginthemurineembryo‏ ‎‡A Mixl1 is required for axial mesendoderm morphogenesis and patterning in the murine embryo‏ ‎‡9 1‏
919 ‎‡a efficientcremediateddeletionincardiacprogenitorcellsconferredbya3utrirescrealleleofthehomeoboxgenenkx25‏ ‎‡A Efficient Cre-mediated deletion in cardiac progenitor cells conferred by a 3'UTR-ires-Cre allele of the homeobox gene Nkx2-5.‏ ‎‡9 1‏
919 ‎‡a directeddifferentiationofhumanembryonicstemcellsasspinembryoidbodiesandadescriptionofthehematopoieticblastcolonyformingassay‏ ‎‡A Directed differentiation of human embryonic stem cells as spin embryoid bodies and a description of the hematopoietic blast colony forming assay‏ ‎‡9 1‏
919 ‎‡a directeddifferentiationandfunctionalmaturationofcorticalinterneuronsfromhumanembryonicstemcells‏ ‎‡A Directed differentiation and functional maturation of cortical interneurons from human embryonic stem cells‏ ‎‡9 1‏
919 ‎‡a differentiationofhumanembryonicstemcellstohoxa+hemogenicvasculaturethatresemblestheaortagonadmesonephros‏ ‎‡A Differentiation of human embryonic stem cells to HOXA+ hemogenic vasculature that resembles the aorta-gonad-mesonephros.‏ ‎‡9 1‏
919 ‎‡a differentiationofhumanembryonicstemcellsinserumfreemediumrevealsdistinctrolesforbonemorphogeneticprotein4vascularendothelialgrowthfactorstemcellfactorandfibroblastgrowthfactor2inhematopoiesis‏ ‎‡A Differentiation of human embryonic stem cells in serum-free medium reveals distinct roles for bone morphogenetic protein 4, vascular endothelial growth factor, stem cell factor, and fibroblast growth factor 2 in hematopoiesis‏ ‎‡9 1‏
919 ‎‡a differentiatingembryonicstemcellspassthroughtemporalwindowsthatmarkresponsivenesstoexogenousandparacrinemesendoderminducingsignals‏ ‎‡A Differentiating embryonic stem cells pass through 'temporal windows' that mark responsiveness to exogenous and paracrine mesendoderm inducing signals‏ ‎‡9 1‏
919 ‎‡a derivationofinsulinproducingbetacellsfromhumanpluripotentstemcells‏ ‎‡A Derivation of insulin-producing beta-cells from human pluripotent stem cells‏ ‎‡9 1‏
919 ‎‡a derivationofendothelialcellsfromhumanembryonicstemcellsinfullydefinedmediumenablesidentificationoflysophosphatidicacidandplateletactivatingfactorasregulatorsofenoslocalization‏ ‎‡A Derivation of endothelial cells from human embryonic stem cells in fully defined medium enables identification of lysophosphatidic acid and platelet activating factor as regulators of eNOS localization‏ ‎‡9 1‏
919 ‎‡a definedsubstratesforpluripotentstemcellsarewethereyet‏ ‎‡A Defined substrates for pluripotent stem cells: are we there yet?‏ ‎‡9 1‏
919 ‎‡a crisprcas9geneeditingofasox9reporterhumanipsclinetoproduce2trpv4patientheterozygousmissensemutantipsclinesmcrii001a3trpv4pf273landmcrii001a4trpv4pp799l‏ ‎‡A CRISPR/Cas9 gene editing of a SOX9 reporter human iPSC line to produce two TRPV4 patient heterozygous missense mutant iPSC lines, MCRIi001-A-3 (TRPV4 p.F273L) and MCRIi001-A-4 (TRPV4 p.P799L)‏ ‎‡9 1‏
919 ‎‡a coculturingwithendothelialcellspromotesinvitromaturationandelectricalcouplingofhumanembryonicstemcellderivedcardiomyocytes‏ ‎‡A Coculturing with endothelial cells promotes in vitro maturation and electrical coupling of human embryonic stem cell-derived cardiomyocytes‏ ‎‡9 1‏
919 ‎‡a cd90marksamesenchymalprograminhumanthymicepithelialcells1invitro1and1invivo1‏ ‎‡A CD90 Marks a Mesenchymal Program in Human Thymic Epithelial Cells <i>In Vitro</i> and <i>In Vivo</i>‏ ‎‡9 1‏
919 ‎‡a cd13andror2permitisolationofhighlyenrichedcardiacmesodermfromdifferentiatinghumanembryonicstemcells‏ ‎‡A CD13 and ROR2 Permit Isolation of Highly Enriched Cardiac Mesoderm from Differentiating Human Embryonic Stem Cells‏ ‎‡9 1‏
919 ‎‡a buildingbetterbetacells‏ ‎‡A Building better beta cells‏ ‎‡9 1‏
919 ‎‡a brachyuryandrelatedtbxproteinsinteractwiththemixl1homeodomainproteinandnegativelyregulatemixl1transcriptionalactivity‏ ‎‡A Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity‏ ‎‡9 1‏
919 ‎‡a bloodcellsformfromphenotypicallydistinctprecursorsduringhumanblastcolonydifferentiation‏ ‎‡A Blood cells form from phenotypically distinct precursors during human blast colony differentiation‏ ‎‡9 1‏
919 ‎‡a apelinpromoteshematopoiesisfromhumanembryonicstemcells‏ ‎‡A APELIN promotes hematopoiesis from human embryonic stem cells‏ ‎‡9 1‏
919 ‎‡a analysisofmitochondrialfunctionandlocalisationduringhumanembryonicstemcelldifferentiationinvitro‏ ‎‡A Analysis of mitochondrial function and localisation during human embryonic stem cell differentiation in vitro.‏ ‎‡9 1‏
919 ‎‡a insulingfpglucagonmcherryreporterlineforthestudyofhumanpancreaticendocrinecelldevelopment‏ ‎‡A An INSULIN-GFP/GLUCAGON-mCherry reporter line for the study of human pancreatic endocrine cell development‏ ‎‡9 1‏
919 ‎‡a alpk3deficientcardiomyocytesgeneratedfrompatientderivedinducedpluripotentstemcellsandmutanthumanembryonicstemcellsdisplayabnormalcalciumhandlingandestablishthatalpk3deficiencyunderliesfamilialcardiomyopathy‏ ‎‡A ALPK3-deficient cardiomyocytes generated from patient-derived induced pluripotent stem cells and mutant human embryonic stem cells display abnormal calcium handling and establish that ALPK3 deficiency underlies familial cardiomyopathy.‏ ‎‡9 1‏
919 ‎‡a targetednkx21humanembryonicstemcellreporterlineenablesidentificationofhumanbasalforebrainderivatives‏ ‎‡A A targeted NKX2.1 human embryonic stem cell reporter line enables identification of human basal forebrain derivatives.‏ ‎‡9 1‏
919 ‎‡a protocolforremovalofantibioticresistancecassettesfromhumanembryonicstemcellsgeneticallymodifiedbyhomologousrecombinationortransgenesis‏ ‎‡A A protocol for removal of antibiotic resistance cassettes from human embryonic stem cells genetically modified by homologous recombination or transgenesis‏ ‎‡9 1‏
919 ‎‡a protocoldescribingtheuseofarecombinantproteinbasedanimalproductfreemediumapelforhumanembryonicstemcelldifferentiationasspinembryoidbodies‏ ‎‡A A protocol describing the use of a recombinant protein-based, animal product-free medium (APEL) for human embryonic stem cell differentiation as spin embryoid bodies‏ ‎‡9 1‏
919 ‎‡a mousecarryingthegreenfluorescentproteingenetargetedtothepdx1locusfacilitatesthestudyofpancreasdevelopmentandfunction‏ ‎‡A A mouse carrying the green fluorescent protein gene targeted to the Pdx1 locus facilitates the study of pancreas development and function.‏ ‎‡9 1‏
919 ‎‡a methodforgeneticmodificationofhumanembryonicstemcellsusingelectroporation‏ ‎‡A A method for genetic modification of human embryonic stem cells using electroporation‏ ‎‡9 1‏
919 ‎‡a cas9variantforefficientgenerationofindelfreeknockinorgenecorrectedhumanpluripotentstemcells‏ ‎‡A A Cas9 Variant for Efficient Generation of Indel-Free Knockin or Gene-Corrected Human Pluripotent Stem Cells‏ ‎‡9 1‏
919 ‎‡a 3176multipotentrag1+progenitorsemergedirectlyfromhemogenicendotheliuminhumanpscderivedhemopoieticorganoids‏ ‎‡A 3176 – MULTIPOTENT RAG1+ PROGENITORS EMERGE DIRECTLY FROM HEMOGENIC ENDOTHELIUM IN HUMAN PSC DERIVED HEMOPOIETIC ORGANOIDS‏ ‎‡9 1‏
919 ‎‡a 1010characterizinghoxaexpressingendothelialandhaematopoieticpopulationsderivedfromhumanpluripotentstemcells‏ ‎‡A 1010 - CHARACTERIZING HOXA-EXPRESSING ENDOTHELIAL AND HAEMATOPOIETIC POPULATIONS DERIVED FROM HUMAN PLURIPOTENT STEM CELLS‏ ‎‡9 1‏
996 ‎‡2 DNB|1062527623‏
996 ‎‡2 SUDOC|193719347‏
996 ‎‡2 RERO|A012396846‏
996 ‎‡2 SUDOC|073318957‏
996 ‎‡2 ISNI|0000000043439823‏
996 ‎‡2 DNB|132767988‏
996 ‎‡2 LC|no2014051346‏
996 ‎‡2 DNB|117652539‏
996 ‎‡2 SUDOC|256982627‏
996 ‎‡2 RERO|A003858034‏
996 ‎‡2 SUDOC|140345620‏
996 ‎‡2 RERO|A003858033‏
996 ‎‡2 BNF|14978268‏
996 ‎‡2 ISNI|0000000450946347‏
996 ‎‡2 LC|no2017079863‏
996 ‎‡2 NLA|000035302550‏
996 ‎‡2 DNB|118671502‏
996 ‎‡2 ISNI|0000000417428169‏
996 ‎‡2 NSK|000056496‏
996 ‎‡2 DNB|1158107447‏
996 ‎‡2 DNB|1089733364‏
996 ‎‡2 BNF|12504386‏
996 ‎‡2 NII|DA10832688‏
996 ‎‡2 BNCHL|10000000000000000166543‏
996 ‎‡2 RERO|A027184787‏
996 ‎‡2 LC|nb2017025881‏
996 ‎‡2 B2Q|0000320027‏
996 ‎‡2 BAV|495_3545‏
996 ‎‡2 DNB|118671510‏
996 ‎‡2 LC|nb2008019362‏
996 ‎‡2 ISNI|0000000433821673‏
996 ‎‡2 NTA|242408745‏
996 ‎‡2 BNF|17126862‏
996 ‎‡2 BNF|15609452‏
996 ‎‡2 LC|no2015078695‏
996 ‎‡2 BIBSYS|2131038‏
996 ‎‡2 ISNI|0000000499616576‏
996 ‎‡2 ISNI|0000000450480022‏
996 ‎‡2 ISNI|0000000112557752‏
996 ‎‡2 ISNI|0000000083944322‏
996 ‎‡2 CAOONL|ncf10036357‏
996 ‎‡2 BNF|13743703‏
996 ‎‡2 LC|n 2021026671‏
996 ‎‡2 NII|DA17604626‏
996 ‎‡2 SUDOC|255001754‏
996 ‎‡2 N6I|vtls000045717‏
996 ‎‡2 N6I|vtls002485414‏
996 ‎‡2 LC|n 83139083‏
996 ‎‡2 SELIBR|183678‏
996 ‎‡2 LC|no2012061149‏
996 ‎‡2 BNE|XX4739767‏
996 ‎‡2 ISNI|0000000044918551‏
996 ‎‡2 ISNI|0000000008834705‏
996 ‎‡2 DNB|1157887996‏
996 ‎‡2 NTA|123758556‏
996 ‎‡2 ISNI|0000000460282716‏
996 ‎‡2 J9U|987007272843205171‏
996 ‎‡2 BIBSYS|15004335‏
996 ‎‡2 N6I|vtls002065109‏
996 ‎‡2 J9U|987007429596405171‏
996 ‎‡2 LC|n 83148824‏
996 ‎‡2 ISNI|0000000115875342‏
996 ‎‡2 ISNI|0000000053454461‏
996 ‎‡2 N6I|vtls000052967‏
996 ‎‡2 J9U|987007446993005171‏
996 ‎‡2 DNB|1051904773‏
996 ‎‡2 SELIBR|184335‏
996 ‎‡2 RERO|A027118873‏
996 ‎‡2 SUDOC|130715107‏
996 ‎‡2 LC|n 2002161037‏
996 ‎‡2 N6I|vtls000087359‏
996 ‎‡2 LC|no2007009956‏
996 ‎‡2 N6I|vtls000037059‏
996 ‎‡2 ISNI|0000000498415895‏
996 ‎‡2 DNB|1026514223‏
996 ‎‡2 RERO|A022954670‏
996 ‎‡2 ISNI|000000044417917X‏
996 ‎‡2 ISNI|0000000038093207‏
996 ‎‡2 N6I|vtls001154098‏
996 ‎‡2 BNE|XX932012‏
996 ‎‡2 NUKAT|n 96025970‏
996 ‎‡2 NTA|274016249‏
996 ‎‡2 BNF|18018662‏
996 ‎‡2 LC|no2018115246‏
996 ‎‡2 BNF|14610482‏
996 ‎‡2 LC|n 88142911‏
996 ‎‡2 DNB|1072576163‏
996 ‎‡2 LC|nr2001007188‏
996 ‎‡2 RERO|A022943918‏
996 ‎‡2 SELIBR|323464‏
996 ‎‡2 ISNI|0000000116008902‏
996 ‎‡2 ISNI|0000000043493096‏
996 ‎‡2 BNC|981058514349306706‏
996 ‎‡2 LC|nr 93037202‏
996 ‎‡2 CAOONL|ncf10190655‏
996 ‎‡2 LC|nb2007027926‏
996 ‎‡2 LC|no2017160014‏
996 ‎‡2 NLR|RU NLR AUTH 7792958‏
996 ‎‡2 N6I|vtls000339819‏
996 ‎‡2 NYNYRILM|169391‏
996 ‎‡2 LC|no2006040656‏
996 ‎‡2 LC|no2009135746‏
996 ‎‡2 SUDOC|073319236‏
996 ‎‡2 SUDOC|066994616‏
996 ‎‡2 J9U|987007524358105171‏
996 ‎‡2 ISNI|0000000496857665‏
996 ‎‡2 DBC|87097919223523‏
996 ‎‡2 LC|n 82244666‏
996 ‎‡2 ISNI|0000000371158123‏
996 ‎‡2 DNB|117632570‏
996 ‎‡2 LC|n 98035108‏
996 ‎‡2 NKC|kup20020000021021‏
996 ‎‡2 LC|nr 99024965‏
996 ‎‡2 ISNI|0000000026211018‏
996 ‎‡2 ISNI|0000000080837046‏
996 ‎‡2 BAV|495_1976‏
996 ‎‡2 BAV|495_1977‏
996 ‎‡2 LC|no 90014556‏
996 ‎‡2 NTA|099817594‏
996 ‎‡2 ISNI|0000000081038772‏
996 ‎‡2 BNF|18095765‏
996 ‎‡2 DNB|1186843047‏
996 ‎‡2 DNB|119325284‏
996 ‎‡2 LC|n 87896612‏
996 ‎‡2 DE633|pe50047474‏
996 ‎‡2 NTA|070019703‏
996 ‎‡2 ISNI|000000006114122X‏
996 ‎‡2 ISNI|0000000068147456‏
996 ‎‡2 NTA|130748366‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏