VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q92166577 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241020233204.0
008 241020nneanz||abbn n and d
035 ‎‡a (WKP)Q92166577‏
024 ‎‡a 0000-0002-5672-8709‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q92166577‏
100 0 ‎‡a Norbert Müller‏ ‎‡c researcher (ORCID 0000-0002-5672-8709)‏ ‎‡9 en‏
400 0 ‎‡a Norbert Müller‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 1 H HR-MAS NMR spectroscopy to study the metabolome of the protozoan parasite Giardia lamblia‏
670 ‎‡a Author's 14-3-3 gene characterization and description of a second 14-3-3 isoform in both Echinococcus granulosus and E. multilocularis.‏
670 ‎‡a Author's A dual PCR-based sequencing approach for the identification and discrimination of Echinococcus and Taenia taxa‏
670 ‎‡a Author's A novel Giardia lamblia nitroreductase, GlNR1, interacts with nitazoxanide and other thiazolides‏
670 ‎‡a Author's Activities of Endochin-Like Quinolones Against in vitro Cultured Besnoitia besnoiti Tachyzoites‏
670 ‎‡a Author's An intact laminated layer is important for the establishment of secondary Echinococcus multilocularis infection.‏
670 ‎‡a Author's Application of conventional and real-time fluorescent ITS1 rDNA PCR for detection of Besnoitia besnoiti infections in bovine skin biopsies‏
670 ‎‡a Author's Assessment of Echinococcus granulosus somatic protoscolex antigens for serological follow-up of young patients surgically treated for cystic echinococcosis‏
670 ‎‡a Author's Comparative analysis of Tritrichomonas foetus (Riedmüller, 1928) cat genotype, T. foetus (Riedmüller, 1928) cattle genotype and Tritrichomonas suis (Davaine, 1875) at 10 DNA loci‏
670 ‎‡a Author's Comparative assessment of ELISAs using recombinant saposin-like protein 2 and recombinant cathepsin L-1 from Fasciola hepatica for the serodiagnosis of human Fasciolosis‏
670 ‎‡a Author's Comparative Pathobiology of the Intestinal Protozoan Parasites Giardia lamblia, Entamoeba histolytica, and Cryptosporidium parvum‏
670 ‎‡a Author's Concordance of Giardia duodenalis assemblages determined by different PCR methodologies in three observational studies in Cuba‏
670 ‎‡a Author's Development of a high- versus low-pathogenicity model of the free-living amoeba Naegleria fowleri‏
670 ‎‡a Author's Diagnostic and follow-up performance of serological tests for different forms/courses of alveolar echinococcosis‏
670 ‎‡a Author's Echinococcus metacestode: in search of viability markers‏
670 ‎‡a Author's Echinococcus multilocularis phosphoglucose isomerase‏
670 ‎‡a Author's Echinococcus multilocularis phosphoglucose isomerase (EmPGI): a glycolytic enzyme involved in metacestode growth and parasite-host cell interactions.‏
670 ‎‡a Author's European Echinococcus multilocularis Identified in Patients in Canada‏
670 ‎‡a Author's Evaluation of Giardia lamblia thioredoxin reductase as drug activating enzyme and as drug target‏
670 ‎‡a Author's Exogenous nitric oxide triggers Neospora caninum tachyzoite-to-bradyzoite stage conversion in murine epidermal keratinocyte cell cultures‏
670 ‎‡a Author's Fatal alveolar echinococcosis of the lumbar spine‏
670 ‎‡a Author's Foxp3 T Regulatory Cells as a Potential Target for Immunotherapy against Primary Infection with Echinococcus multilocularis Eggs‏
670 ‎‡a Author's H HR-MAS NMR spectroscopy to study the metabolome of the protozoan parasite Giardia lamblia‏
670 ‎‡a Author's In vitro effects of thiazolides on Giardia lamblia WB clone C6 cultured axenically and in coculture with Caco2 cells‏
670 ‎‡a Author's In vitro induction of Neospora caninum bradyzoites in vero cells reveals differential antigen expression, localization, and host-cell recognition of tachyzoites and bradyzoites‏
670 ‎‡a Author's Interleukin-6-deficient mice are highly susceptible to Giardia lamblia infection but exhibit normal intestinal immunoglobulin A responses against the parasite‏
670 ‎‡a Author's Intestinal Tritrichomonas foetus infection in cats in Switzerland detected by in vitro cultivation and PCR.‏
670 ‎‡a Author's Intraperitoneal Echinococcus multilocularis infection in mice modulates peritoneal CD4+ and CD8+ regulatory T cell development‏
670 ‎‡a Author's Isolation and molecular characterization of recombinant Echinococcus granulosus P29 protein‏
670 ‎‡a Author's Isolation and molecular characterization of recombinant Echinococcus granulosus P29 protein (recP29) and its assessment for the post-surgical serological follow-up of human cystic echinococcosis in young patients‏
670 ‎‡a Author's Metabolism of nitro drugs metronidazole and nitazoxanide in Giardia lamblia: characterization of a novel nitroreductase‏
670 ‎‡a Author's Metabolism of nitro drugs metronidazole and nitazoxanide in Giardia lamblia: characterization of a novel nitroreductase (GlNR2).‏
670 ‎‡a Author's Metabolomic Profiling of Wildtype and Transgenic Giardia lamblia Strains by 1H HR-MAS NMR Spectroscopy‏
670 ‎‡a Author's Molecular analysis of Giardia duodenalis isolates from symptomatic and asymptomatic children from La Habana, Cuba.‏
670 ‎‡a Author's Neospora caninum and Toxoplasma gondii: a novel adhesion/invasion assay reveals distinct differences in tachyzoite-host cell interactions‏
670 ‎‡a Author's Neospora caninum: functional inhibition of protein disulfide isomerase by the broad-spectrum anti-parasitic drug nitazoxanide and other thiazolides.‏
670 ‎‡a Author's Nitroreductase‏
670 ‎‡a Author's Nitroreductase (GlNR1) increases susceptibility of Giardia lamblia and Escherichia coli to nitro drugs.‏
670 ‎‡a Author's Nitroreductases of bacterial origin in Giardia lamblia: Potential role in detoxification of xenobiotics‏
670 ‎‡a Author's Occurrence of Leishmania sp. in cutaneous lesions of horses in Central Europe.‏
670 ‎‡a Author's Physiological aspects of nitro drug resistance in Giardia lamblia.‏
670 ‎‡a Author's Potentially human pathogenic Acanthamoeba isolated from a heated indoor swimming pool in Switzerland‏
670 ‎‡a Author's Prevalence of intestinal parasites and molecular characterization of Giardia duodenalis from dogs in La Habana, Cuba‏
670 ‎‡a Author's Quantitative PCR for the diagnosis of cutaneous leishmaniasis from formalin-fixed and paraffin-embedded skin sections‏
670 ‎‡a Author's Reduced cerebral infection of Neospora caninum-infected mice after vaccination with recombinant microneme protein NcMIC3 and ribi adjuvant‏
670 ‎‡a Author's Regulation of hepatic microRNAs in response to early stage Echinococcus multilocularis egg infection in C57BL/6 mice‏
670 ‎‡a Author's Resistance formation to nitro drugs in Giardia lamblia: No common markers identified by comparative proteomics‏
670 ‎‡a Author's Screening of Swiss hot spring resorts for potentially pathogenic free-living amoebae‏
670 ‎‡a Author's Screening Swiss water bodies for potentially pathogenic free-living amoebae‏
670 ‎‡a Author's Simplicimonas-like DNA in vaginal swabs of cows and heifers cross-reacting in the real-time PCR for T. foetus.‏
670 ‎‡a Author's Stable expression of Escherichia coli beta-glucuronidase A‏
670 ‎‡a Author's Stable expression of Escherichia coli beta-glucuronidase A (GusA) in Giardia lamblia: application to high-throughput drug susceptibility testing‏
670 ‎‡a Author's Structure-activity relationships from in vitro efficacies of the thiazolide series against the intracellular apicomplexan protozoan Neospora caninum‏
670 ‎‡a Author's Susceptibility versus resistance in alveolar echinococcosis (larval infection with Echinococcus multilocularis)‏
670 ‎‡a Author's The brown hare (Lepus europaeus) as a novel intermediate host for Echinococcus multilocularis in Europe.‏
670 ‎‡a Author's The identification of free-living environmental isolates of amoebae from Bulgaria.‏
670 ‎‡a Author's The role of B- and T-cell immunity in toltrazuril-treated C57BL/6 WT, microMT and nude mice experimentally infected with Neospora caninum‏
670 ‎‡a Author's The single cyclic nucleotide-specific phosphodiesterase of the intestinal parasite Giardia lamblia represents a potential drug target‏
670 ‎‡a Author's Transfection With Plasmid Causing Stable Expression of a Foreign Gene Affects General Proteome Pattern in <i>Giardia lamblia</i> Trophozoites‏
670 ‎‡a Author's Treatment of echinococcosis: albendazole and mebendazole--what else?‏
670 ‎‡a Author's Trichinella britovi in a red fox (Vulpes vulpes) from Portugal‏
670 ‎‡a Author's Tritrichomonas foetus isolates from cats and cattle show minor genetic differences in unrelated loci ITS-2 and EF-1α‏
909 ‎‡a (orcid) 0000000256728709‏ ‎‡9 1‏
919 ‎‡a regulationofhepaticmicrornasinresponsetoearlystageechinococcusmultilocularisegginfectioninc57bl6mice‏ ‎‡A Regulation of hepatic microRNAs in response to early stage Echinococcus multilocularis egg infection in C57BL/6 mice‏ ‎‡9 1‏
919 ‎‡a reducedcerebralinfectionofneosporacaninuminfectedmiceaftervaccinationwithrecombinantmicronemeproteinncmic3andribiadjuvant‏ ‎‡A Reduced cerebral infection of Neospora caninum-infected mice after vaccination with recombinant microneme protein NcMIC3 and ribi adjuvant‏ ‎‡9 1‏
919 ‎‡a quantitativepcrforthediagnosisofcutaneousleishmaniasisfromformalinfixedandparaffinembeddedskinsections‏ ‎‡A Quantitative PCR for the diagnosis of cutaneous leishmaniasis from formalin-fixed and paraffin-embedded skin sections‏ ‎‡9 1‏
919 ‎‡a prevalenceofintestinalparasitesandmolecularcharacterizationofgiardiaduodenalisfromdogsinlahabanacuba‏ ‎‡A Prevalence of intestinal parasites and molecular characterization of Giardia duodenalis from dogs in La Habana, Cuba‏ ‎‡9 1‏
919 ‎‡a potentiallyhumanpathogenicacanthamoebaisolatedfromaheatedindoorswimmingpoolinswitzerland‏ ‎‡A Potentially human pathogenic Acanthamoeba isolated from a heated indoor swimming pool in Switzerland‏ ‎‡9 1‏
919 ‎‡a physiologicalaspectsofnitrodrugresistanceingiardialamblia‏ ‎‡A Physiological aspects of nitro drug resistance in Giardia lamblia.‏ ‎‡9 1‏
919 ‎‡a occurrenceofleishmaniaspincutaneouslesionsofhorsesincentraleurope‏ ‎‡A Occurrence of Leishmania sp. in cutaneous lesions of horses in Central Europe.‏ ‎‡9 1‏
919 ‎‡a nitroreductasesofbacterialoriginingiardialambliapotentialroleindetoxificationofxenobiotics‏ ‎‡A Nitroreductases of bacterial origin in Giardia lamblia: Potential role in detoxification of xenobiotics‏ ‎‡9 1‏
919 ‎‡a nitroreductaseglnr1increasessusceptibilityofgiardialambliaandescherichiacolitonitrodrugs‏ ‎‡A Nitroreductase (GlNR1) increases susceptibility of Giardia lamblia and Escherichia coli to nitro drugs.‏ ‎‡9 1‏
919 ‎‡a nitroreductase‏ ‎‡A Nitroreductase‏ ‎‡9 1‏
919 ‎‡a neosporacaninumfunctionalinhibitionofproteindisulfideisomerasebythebroadspectrumantiparasiticdrugnitazoxanideandotherthiazolides‏ ‎‡A Neospora caninum: functional inhibition of protein disulfide isomerase by the broad-spectrum anti-parasitic drug nitazoxanide and other thiazolides.‏ ‎‡9 1‏
919 ‎‡a neosporacaninumandtoxoplasmagondiianoveladhesioninvasionassayrevealsdistinctdifferencesintachyzoitehostcellinteractions‏ ‎‡A Neospora caninum and Toxoplasma gondii: a novel adhesion/invasion assay reveals distinct differences in tachyzoite-host cell interactions‏ ‎‡9 1‏
919 ‎‡a molecularanalysisofgiardiaduodenalisisolatesfromsymptomaticandasymptomaticchildrenfromlahabanacuba‏ ‎‡A Molecular analysis of Giardia duodenalis isolates from symptomatic and asymptomatic children from La Habana, Cuba.‏ ‎‡9 1‏
919 ‎‡a metabolomicprofilingofwildtypeandtransgenicgiardialambliastrainsby1hhrmasnmrspectroscopy‏ ‎‡A Metabolomic Profiling of Wildtype and Transgenic Giardia lamblia Strains by 1H HR-MAS NMR Spectroscopy‏ ‎‡9 1‏
919 ‎‡a metabolismofnitrodrugsmetronidazoleandnitazoxanideingiardialambliacharacterizationofanovelnitroreductaseglnr2‏ ‎‡A Metabolism of nitro drugs metronidazole and nitazoxanide in Giardia lamblia: characterization of a novel nitroreductase (GlNR2).‏ ‎‡9 1‏
919 ‎‡a metabolismofnitrodrugsmetronidazoleandnitazoxanideingiardialambliacharacterizationofanovelnitroreductase‏ ‎‡A Metabolism of nitro drugs metronidazole and nitazoxanide in Giardia lamblia: characterization of a novel nitroreductase‏ ‎‡9 1‏
919 ‎‡a isolationandmolecularcharacterizationofrecombinantechinococcusgranulosusp29proteinrecp29anditsassessmentforthepostsurgicalserologicalfollowupofhumancysticechinococcosisinyoungpatients‏ ‎‡A Isolation and molecular characterization of recombinant Echinococcus granulosus P29 protein (recP29) and its assessment for the post-surgical serological follow-up of human cystic echinococcosis in young patients‏ ‎‡9 1‏
919 ‎‡a isolationandmolecularcharacterizationofrecombinantechinococcusgranulosusp29protein‏ ‎‡A Isolation and molecular characterization of recombinant Echinococcus granulosus P29 protein‏ ‎‡9 1‏
919 ‎‡a intraperitonealechinococcusmultilocularisinfectioninmicemodulatesperitonealcd4+andcd8+regulatorytcelldevelopment‏ ‎‡A Intraperitoneal Echinococcus multilocularis infection in mice modulates peritoneal CD4+ and CD8+ regulatory T cell development‏ ‎‡9 1‏
919 ‎‡a intestinaltritrichomonasfoetusinfectionincatsinswitzerlanddetectedbyinvitrocultivationandpcr‏ ‎‡A Intestinal Tritrichomonas foetus infection in cats in Switzerland detected by in vitro cultivation and PCR.‏ ‎‡9 1‏
919 ‎‡a interleukin6deficientmicearehighlysusceptibletogiardialambliainfectionbutexhibitnormalintestinalimmunoglobulinaresponsesagainsttheparasite‏ ‎‡A Interleukin-6-deficient mice are highly susceptible to Giardia lamblia infection but exhibit normal intestinal immunoglobulin A responses against the parasite‏ ‎‡9 1‏
919 ‎‡a invitroinductionofneosporacaninumbradyzoitesinverocellsrevealsdifferentialantigenexpressionlocalizationandhostcellrecognitionoftachyzoitesandbradyzoites‏ ‎‡A In vitro induction of Neospora caninum bradyzoites in vero cells reveals differential antigen expression, localization, and host-cell recognition of tachyzoites and bradyzoites‏ ‎‡9 1‏
919 ‎‡a invitroeffectsofthiazolidesongiardialambliawbclonec6culturedaxenicallyandincoculturewithcaco2cells‏ ‎‡A In vitro effects of thiazolides on Giardia lamblia WB clone C6 cultured axenically and in coculture with Caco2 cells‏ ‎‡9 1‏
919 ‎‡a hhrmasnmrspectroscopytostudythemetabolomeoftheprotozoanparasitegiardialamblia‏ ‎‡A H HR-MAS NMR spectroscopy to study the metabolome of the protozoan parasite Giardia lamblia‏ ‎‡9 1‏
919 ‎‡a foxp3tregulatorycellsasapotentialtargetforimmunotherapyagainstprimaryinfectionwithechinococcusmultiloculariseggs‏ ‎‡A Foxp3 T Regulatory Cells as a Potential Target for Immunotherapy against Primary Infection with Echinococcus multilocularis Eggs‏ ‎‡9 1‏
919 ‎‡a fatalalveolarechinococcosisofthelumbarspine‏ ‎‡A Fatal alveolar echinococcosis of the lumbar spine‏ ‎‡9 1‏
919 ‎‡a exogenousnitricoxidetriggersneosporacaninumtachyzoitetobradyzoitestageconversioninmurineepidermalkeratinocytecellcultures‏ ‎‡A Exogenous nitric oxide triggers Neospora caninum tachyzoite-to-bradyzoite stage conversion in murine epidermal keratinocyte cell cultures‏ ‎‡9 1‏
919 ‎‡a evaluationofgiardialambliathioredoxinreductaseasdrugactivatingenzymeandasdrugtarget‏ ‎‡A Evaluation of Giardia lamblia thioredoxin reductase as drug activating enzyme and as drug target‏ ‎‡9 1‏
919 ‎‡a europeanechinococcusmultilocularisidentifiedinpatientsincanada‏ ‎‡A European Echinococcus multilocularis Identified in Patients in Canada‏ ‎‡9 1‏
919 ‎‡a echinococcusmultilocularisphosphoglucoseisomeraseempgiaglycolyticenzymeinvolvedinmetacestodegrowthandparasitehostcellinteractions‏ ‎‡A Echinococcus multilocularis phosphoglucose isomerase (EmPGI): a glycolytic enzyme involved in metacestode growth and parasite-host cell interactions.‏ ‎‡9 1‏
919 ‎‡a echinococcusmultilocularisphosphoglucoseisomerase‏ ‎‡A Echinococcus multilocularis phosphoglucose isomerase‏ ‎‡9 1‏
919 ‎‡a echinococcusmetacestodeinsearchofviabilitymarkers‏ ‎‡A Echinococcus metacestode: in search of viability markers‏ ‎‡9 1‏
919 ‎‡a diagnosticandfollowupperformanceofserologicaltestsfordifferentformscoursesofalveolarechinococcosis‏ ‎‡A Diagnostic and follow-up performance of serological tests for different forms/courses of alveolar echinococcosis‏ ‎‡9 1‏
919 ‎‡a developmentofahighversuslowpathogenicitymodelofthefreelivingamoebanaegleriafowleri‏ ‎‡A Development of a high- versus low-pathogenicity model of the free-living amoeba Naegleria fowleri‏ ‎‡9 1‏
919 ‎‡a concordanceofgiardiaduodenalisassemblagesdeterminedbydifferentpcrmethodologiesin3observationalstudiesincuba‏ ‎‡A Concordance of Giardia duodenalis assemblages determined by different PCR methodologies in three observational studies in Cuba‏ ‎‡9 1‏
919 ‎‡a comparativepathobiologyoftheintestinalprotozoanparasitesgiardialambliaentamoebahistolyticaandcryptosporidiumparvum‏ ‎‡A Comparative Pathobiology of the Intestinal Protozoan Parasites Giardia lamblia, Entamoeba histolytica, and Cryptosporidium parvum‏ ‎‡9 1‏
919 ‎‡a comparativeassessmentofelisasusingrecombinantsaposinlikeprotein2andrecombinantcathepsin501fromfasciolahepaticafortheserodiagnosisofhumanfasciolosis‏ ‎‡A Comparative assessment of ELISAs using recombinant saposin-like protein 2 and recombinant cathepsin L-1 from Fasciola hepatica for the serodiagnosis of human Fasciolosis‏ ‎‡9 1‏
919 ‎‡a comparativeanalysisoftritrichomonasfoetusriedmuller1928catgenotypetfoetusriedmuller1928cattlegenotypeandtritrichomonassuisdavaine1875at10dnaloci‏ ‎‡A Comparative analysis of Tritrichomonas foetus (Riedmüller, 1928) cat genotype, T. foetus (Riedmüller, 1928) cattle genotype and Tritrichomonas suis (Davaine, 1875) at 10 DNA loci‏ ‎‡9 1‏
919 ‎‡a assessmentofechinococcusgranulosussomaticprotoscolexantigensforserologicalfollowupofyoungpatientssurgicallytreatedforcysticechinococcosis‏ ‎‡A Assessment of Echinococcus granulosus somatic protoscolex antigens for serological follow-up of young patients surgically treated for cystic echinococcosis‏ ‎‡9 1‏
919 ‎‡a applicationofconventionalandrealtimefluorescentits1rdnapcrfordetectionofbesnoitiabesnoitiinfectionsinbovineskinbiopsies‏ ‎‡A Application of conventional and real-time fluorescent ITS1 rDNA PCR for detection of Besnoitia besnoiti infections in bovine skin biopsies‏ ‎‡9 1‏
919 ‎‡a structureactivityrelationshipsfrominvitroefficaciesofthethiazolideseriesagainsttheintracellularapicomplexanprotozoanneosporacaninum‏ ‎‡A Structure-activity relationships from in vitro efficacies of the thiazolide series against the intracellular apicomplexan protozoan Neospora caninum‏ ‎‡9 1‏
919 ‎‡a intactlaminatedlayerisimportantfortheestablishmentofsecondaryechinococcusmultilocularisinfection‏ ‎‡A An intact laminated layer is important for the establishment of secondary Echinococcus multilocularis infection.‏ ‎‡9 1‏
919 ‎‡a activitiesofendochinlikequinolonesagainstinvitroculturedbesnoitiabesnoititachyzoites‏ ‎‡A Activities of Endochin-Like Quinolones Against in vitro Cultured Besnoitia besnoiti Tachyzoites‏ ‎‡9 1‏
919 ‎‡a novelgiardialamblianitroreductaseglnr1interactswithnitazoxanideandotherthiazolides‏ ‎‡A A novel Giardia lamblia nitroreductase, GlNR1, interacts with nitazoxanide and other thiazolides‏ ‎‡9 1‏
919 ‎‡a dualpcrbasedsequencingapproachfortheidentificationanddiscriminationofechinococcusandtaeniataxa‏ ‎‡A A dual PCR-based sequencing approach for the identification and discrimination of Echinococcus and Taenia taxa‏ ‎‡9 1‏
919 ‎‡a 1433genecharacterizationanddescriptionofa21433isoforminbothechinococcusgranulosusandemultilocularis‏ ‎‡A 14-3-3 gene characterization and description of a second 14-3-3 isoform in both Echinococcus granulosus and E. multilocularis.‏ ‎‡9 1‏
919 ‎‡a 1hhrmasnmrspectroscopytostudythemetabolomeoftheprotozoanparasitegiardialamblia‏ ‎‡A 1 H HR-MAS NMR spectroscopy to study the metabolome of the protozoan parasite Giardia lamblia‏ ‎‡9 1‏
919 ‎‡a tritrichomonasfoetusisolatesfromcatsandcattleshowminorgeneticdifferencesinunrelatedlociits2andef1α‏ ‎‡A Tritrichomonas foetus isolates from cats and cattle show minor genetic differences in unrelated loci ITS-2 and EF-1α‏ ‎‡9 1‏
919 ‎‡a trichinellabritoviinaredfoxvulpesvulpesfromportugal‏ ‎‡A Trichinella britovi in a red fox (Vulpes vulpes) from Portugal‏ ‎‡9 1‏
919 ‎‡a treatmentofechinococcosisalbendazoleandmebendazolewhatelse‏ ‎‡A Treatment of echinococcosis: albendazole and mebendazole--what else?‏ ‎‡9 1‏
919 ‎‡a transfectionwithplasmidcausingstableexpressionofaforeigngeneaffectsgeneralproteomepatternin1giardialamblia1trophozoites‏ ‎‡A Transfection With Plasmid Causing Stable Expression of a Foreign Gene Affects General Proteome Pattern in <i>Giardia lamblia</i> Trophozoites‏ ‎‡9 1‏
919 ‎‡a singlecyclicnucleotidespecificphosphodiesteraseoftheintestinalparasitegiardialambliarepresentsapotentialdrugtarget‏ ‎‡A The single cyclic nucleotide-specific phosphodiesterase of the intestinal parasite Giardia lamblia represents a potential drug target‏ ‎‡9 1‏
919 ‎‡a roleofbandtcellimmunityintoltrazuriltreatedc57bl6wtmicromtandnudemiceexperimentallyinfectedwithneosporacaninum‏ ‎‡A The role of B- and T-cell immunity in toltrazuril-treated C57BL/6 WT, microMT and nude mice experimentally infected with Neospora caninum‏ ‎‡9 1‏
919 ‎‡a identificationoffreelivingenvironmentalisolatesofamoebaefrombulgaria‏ ‎‡A The identification of free-living environmental isolates of amoebae from Bulgaria.‏ ‎‡9 1‏
919 ‎‡a brownharelepuseuropaeusasanovelintermediatehostforechinococcusmultilocularisineurope‏ ‎‡A The brown hare (Lepus europaeus) as a novel intermediate host for Echinococcus multilocularis in Europe.‏ ‎‡9 1‏
919 ‎‡a susceptibilityversusresistanceinalveolarechinococcosislarvalinfectionwithechinococcusmultilocularis‏ ‎‡A Susceptibility versus resistance in alveolar echinococcosis (larval infection with Echinococcus multilocularis)‏ ‎‡9 1‏
919 ‎‡a stableexpressionofescherichiacolibetaglucuronidaseagusaingiardialambliaapplicationtohighthroughputdrugsusceptibilitytesting‏ ‎‡A Stable expression of Escherichia coli beta-glucuronidase A (GusA) in Giardia lamblia: application to high-throughput drug susceptibility testing‏ ‎‡9 1‏
919 ‎‡a stableexpressionofescherichiacolibetaglucuronidasea‏ ‎‡A Stable expression of Escherichia coli beta-glucuronidase A‏ ‎‡9 1‏
919 ‎‡a simplicimonaslikednainvaginalswabsofcowsandheiferscrossreactingintherealtimepcrfortfoetus‏ ‎‡A Simplicimonas-like DNA in vaginal swabs of cows and heifers cross-reacting in the real-time PCR for T. foetus.‏ ‎‡9 1‏
919 ‎‡a screeningswisswaterbodiesforpotentiallypathogenicfreelivingamoebae‏ ‎‡A Screening Swiss water bodies for potentially pathogenic free-living amoebae‏ ‎‡9 1‏
919 ‎‡a screeningofswisshotspringresortsforpotentiallypathogenicfreelivingamoebae‏ ‎‡A Screening of Swiss hot spring resorts for potentially pathogenic free-living amoebae‏ ‎‡9 1‏
919 ‎‡a resistanceformationtonitrodrugsingiardialamblianocommonmarkersidentifiedbycomparativeproteomics‏ ‎‡A Resistance formation to nitro drugs in Giardia lamblia: No common markers identified by comparative proteomics‏ ‎‡9 1‏
996 ‎‡2 PLWABN|9810650123805606‏
996 ‎‡2 ISNI|0000000071915655‏
996 ‎‡2 DNB|1051228859‏
996 ‎‡2 J9U|987009440578705171‏
996 ‎‡2 LC|n 80056003‏
996 ‎‡2 SUDOC|077903641‏
996 ‎‡2 DNB|126462038‏
996 ‎‡2 SUDOC|075953722‏
996 ‎‡2 DNB|123066808‏
996 ‎‡2 LC|n 2022011656‏
996 ‎‡2 NTA|147386888‏
996 ‎‡2 DNB|1082052515‏
996 ‎‡2 DNB|123693721‏
996 ‎‡2 DNB|123434246‏
996 ‎‡2 NUKAT|n 2019025818‏
996 ‎‡2 ISNI|0000000078731912‏
996 ‎‡2 ISNI|0000000018148813‏
996 ‎‡2 DNB|108531481‏
996 ‎‡2 ISNI|0000000023967004‏
996 ‎‡2 DNB|13154926X‏
996 ‎‡2 LC|n 79031833‏
996 ‎‡2 NII|DA04195513‏
996 ‎‡2 DNB|1249409403‏
996 ‎‡2 ISNI|0000000069503635‏
996 ‎‡2 B2Q|0000141166‏
996 ‎‡2 DNB|120174219‏
996 ‎‡2 SUDOC|23414453X‏
996 ‎‡2 ISNI|0000000391225389‏
996 ‎‡2 DNB|1346485712‏
996 ‎‡2 DNB|1344669344‏
996 ‎‡2 DNB|1208361937‏
996 ‎‡2 DNB|1157603017‏
996 ‎‡2 RERO|A023874008‏
996 ‎‡2 NTA|071936793‏
996 ‎‡2 LC|n 83033099‏
996 ‎‡2 CAOONL|ncf12079553‏
996 ‎‡2 DNB|1157295215‏
996 ‎‡2 DNB|122501527‏
996 ‎‡2 LC|no2013070351‏
996 ‎‡2 DNB|131358839‏
996 ‎‡2 BNF|12182917‏
996 ‎‡2 PLWABN|9810680575105606‏
996 ‎‡2 ISNI|0000000388969096‏
996 ‎‡2 J9U|987007295110705171‏
996 ‎‡2 DNB|1201825598‏
996 ‎‡2 DNB|1013539494‏
996 ‎‡2 NKC|jcu2012738279‏
996 ‎‡2 DNB|1243876557‏
996 ‎‡2 LIH|LNB:_s__d__c_;=CE‏
996 ‎‡2 ISNI|0000000435021688‏
996 ‎‡2 DNB|127804277‏
996 ‎‡2 NII|DA06241564‏
996 ‎‡2 RERO|A012548170‏
996 ‎‡2 SUDOC|263411303‏
996 ‎‡2 SUDOC|134524217‏
996 ‎‡2 DNB|1068556455‏
996 ‎‡2 DNB|129631183‏
996 ‎‡2 RERO|A003623584‏
996 ‎‡2 RERO|A003623585‏
996 ‎‡2 BIBSYS|90679217‏
996 ‎‡2 DNB|129631213‏
996 ‎‡2 ISNI|000000002114897X‏
996 ‎‡2 NKC|vse2008449660‏
996 ‎‡2 BIBSYS|2053220‏
996 ‎‡2 DNB|1201825377‏
996 ‎‡2 DNB|1081020660‏
996 ‎‡2 BIBSYS|90090992‏
996 ‎‡2 SUDOC|144432986‏
996 ‎‡2 SZ|129631426‏
996 ‎‡2 BNF|12303818‏
996 ‎‡2 DNB|1053291418‏
996 ‎‡2 BNF|15065826‏
996 ‎‡2 ISNI|000000011938281X‏
996 ‎‡2 DNB|1244331252‏
996 ‎‡2 LC|nb2007002409‏
996 ‎‡2 NTA|069601232‏
996 ‎‡2 NTA|207358664‏
996 ‎‡2 SZ|1263644546‏
996 ‎‡2 DNB|173692303‏
996 ‎‡2 NKC|skuk0004227‏
996 ‎‡2 DNB|131358790‏
996 ‎‡2 ISNI|0000000416582711‏
996 ‎‡2 ISNI|0000000031390794‏
996 ‎‡2 DNB|1047721058‏
996 ‎‡2 ISNI|0000000072897014‏
996 ‎‡2 LC|n 89668613‏
996 ‎‡2 DNB|129631353‏
996 ‎‡2 DNB|139754652‏
996 ‎‡2 DNB|1137339586‏
996 ‎‡2 DNB|1196879001‏
996 ‎‡2 DNB|1190013002‏
996 ‎‡2 NTA|180007246‏
996 ‎‡2 SUDOC|264048539‏
996 ‎‡2 NTA|147363497‏
996 ‎‡2 BIBSYS|90552334‏
996 ‎‡2 LC|no2021143888‏
996 ‎‡2 DNB|127804285‏
996 ‎‡2 LC|n 2011026418‏
996 ‎‡2 ISNI|0000000016911782‏
996 ‎‡2 NUKAT|n 01024741‏
996 ‎‡2 N6I|vtls000042766‏
996 ‎‡2 DNB|125768117‏
996 ‎‡2 LC|n 92012155‏
996 ‎‡2 LC|no2023037104‏
996 ‎‡2 DNB|1162144963‏
996 ‎‡2 DNB|1137400773‏
996 ‎‡2 PLWABN|9810688551305606‏
996 ‎‡2 NTA|316332380‏
996 ‎‡2 ISNI|0000000388017079‏
996 ‎‡2 ISNI|000000007304673X‏
996 ‎‡2 DNB|131358782‏
996 ‎‡2 DNB|137087381‏
996 ‎‡2 LC|n 81120191‏
996 ‎‡2 J9U|987007265780605171‏
996 ‎‡2 J9U|987007397808005171‏
996 ‎‡2 ISNI|0000000005689354‏
996 ‎‡2 NTA|291056709‏
996 ‎‡2 BLBNB|000226104‏
996 ‎‡2 RERO|A003624167‏
996 ‎‡2 NTA|069397015‏
996 ‎‡2 RERO|A016370988‏
996 ‎‡2 PLWABN|9810611456205606‏
996 ‎‡2 LC|n 88158896‏
996 ‎‡2 NTA|074606433‏
996 ‎‡2 CAOONL|ncf10997038‏
996 ‎‡2 DNB|133320561‏
996 ‎‡2 DNB|117590568‏
996 ‎‡2 NTA|073969028‏
996 ‎‡2 SUDOC|254219128‏
996 ‎‡2 DNB|1328457788‏
996 ‎‡2 NTA|07278380X‏
996 ‎‡2 DNB|134626225X‏
996 ‎‡2 DNB|136286615‏
996 ‎‡2 SUDOC|258854278‏
996 ‎‡2 DNB|1135490201‏
996 ‎‡2 DNB|17352480X‏
996 ‎‡2 DNB|1299671527‏
996 ‎‡2 DNB|1123292337‏
996 ‎‡2 ISNI|0000000084147659‏
996 ‎‡2 DNB|1244332666‏
996 ‎‡2 BNCHL|10000000000000000011069‏
996 ‎‡2 DNB|129631248‏
996 ‎‡2 DNB|1011671395‏
996 ‎‡2 DNB|173615147‏
996 ‎‡2 ISNI|0000000074377549‏
996 ‎‡2 DNB|1201826926‏
996 ‎‡2 J9U|987007424311305171‏
996 ‎‡2 LC|n 85110833‏
996 ‎‡2 PLWABN|9810652630305606‏
996 ‎‡2 BNF|11491531‏
996 ‎‡2 LC|n 85810615‏
996 ‎‡2 SUDOC|145892131‏
996 ‎‡2 PLWABN|9810632797105606‏
996 ‎‡2 BNCHL|10000000000000000069901‏
996 ‎‡2 LC|n 50004586‏
996 ‎‡2 DNB|137706553‏
996 ‎‡2 NII|DA09465863‏
996 ‎‡2 DNB|1102396001‏
996 ‎‡2 DNB|133320421‏
996 ‎‡2 NLA|000035986181‏
996 ‎‡2 NKC|hka2016923849‏
996 ‎‡2 SUDOC|08413934X‏
996 ‎‡2 SUDOC|170471802‏
996 ‎‡2 LC|n 2004102934‏
996 ‎‡2 NTA|147363160‏
996 ‎‡2 JPG|500025672‏
996 ‎‡2 ISNI|0000000073099364‏
996 ‎‡2 ISNI|0000000063047632‏
996 ‎‡2 ISNI|000000040842369X‏
996 ‎‡2 RERO|A020036264‏
996 ‎‡2 NTA|416763227‏
996 ‎‡2 ISNI|0000000479863158‏
996 ‎‡2 DNB|1283672758‏
996 ‎‡2 RERO|A003617891‏
996 ‎‡2 DNB|121023758X‏
996 ‎‡2 BNE|XX861045‏
996 ‎‡2 LC|n 2005080834‏
996 ‎‡2 DNB|106768106X‏
996 ‎‡2 DE633|pe343754‏
996 ‎‡2 DNB|136572901‏
996 ‎‡2 ISNI|0000000388466050‏
996 ‎‡2 SUDOC|166244120‏
996 ‎‡2 DNB|1139847686‏
996 ‎‡2 NUKAT|n 2007002878‏
996 ‎‡2 ISNI|0000000398156224‏
996 ‎‡2 DNB|1216304858‏
996 ‎‡2 DNB|170614581‏
996 ‎‡2 J9U|987007344673905171‏
996 ‎‡2 NUKAT|n 96637472‏
996 ‎‡2 SUDOC|241932238‏
996 ‎‡2 N6I|vtls001339812‏
996 ‎‡2 ISNI|0000000034789565‏
996 ‎‡2 DNB|1243876549‏
996 ‎‡2 ISNI|0000000358525902‏
996 ‎‡2 RERO|A012501502‏
996 ‎‡2 LC|n 2019030824‏
996 ‎‡2 ISNI|0000000139196221‏
996 ‎‡2 DNB|1053643985‏
996 ‎‡2 DNB|1154801764‏
996 ‎‡2 BIBSYS|90919659‏
996 ‎‡2 DNB|1108104843‏
996 ‎‡2 DNB|1015510353‏
996 ‎‡2 DNB|1328749614‏
996 ‎‡2 LC|n 87948850‏
996 ‎‡2 DNB|12675148X‏
996 ‎‡2 SUDOC|26477678X‏
996 ‎‡2 BNE|XX1042761‏
996 ‎‡2 NII|DA02530366‏
996 ‎‡2 ISNI|0000000081445378‏
996 ‎‡2 DNB|125768125‏
996 ‎‡2 NKC|xx0055473‏
996 ‎‡2 DNB|1055052372‏
996 ‎‡2 DNB|1031501231‏
996 ‎‡2 ISNI|0000000071541235‏
996 ‎‡2 DNB|1139846337‏
996 ‎‡2 NUKAT|n 2011204357‏
996 ‎‡2 DNB|1079356584‏
996 ‎‡2 NUKAT|n 2019015834‏
996 ‎‡2 SUDOC|196535522‏
996 ‎‡2 JPG|500097408‏
996 ‎‡2 LC|n 2007076395‏
996 ‎‡2 SUDOC|193181274‏
996 ‎‡2 DNB|1157236243‏
996 ‎‡2 NUKAT|n 2012109770‏
996 ‎‡2 ISNI|0000000378090758‏
996 ‎‡2 ISNI|0000000058871723‏
996 ‎‡2 DNB|1084154463‏
996 ‎‡2 SUDOC|075552965‏
996 ‎‡2 B2Q|0000071375‏
996 ‎‡2 PLWABN|9811507171005606‏
996 ‎‡2 KRNLK|KAC202319283‏
996 ‎‡2 DNB|1130419568‏
996 ‎‡2 LC|n 80069749‏
996 ‎‡2 LC|n 79068211‏
996 ‎‡2 ISNI|0000000066531497‏
996 ‎‡2 PLWABN|9810625315305606‏
996 ‎‡2 NTA|147386624‏
996 ‎‡2 NTA|395845505‏
996 ‎‡2 DNB|1081742348‏
996 ‎‡2 NTA|147564913‏
996 ‎‡2 CAOONL|ncf11165671‏
996 ‎‡2 NTA|095253254‏
996 ‎‡2 NII|DA10135753‏
996 ‎‡2 NUKAT|n 2008080836‏
996 ‎‡2 ISNI|0000000020270092‏
996 ‎‡2 NUKAT|n 2009143422‏
996 ‎‡2 ISNI|000000039637667X‏
996 ‎‡2 SUDOC|144832917‏
996 ‎‡2 DNB|121110249‏
996 ‎‡2 LC|n 92049848‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏