VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q70090163 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010730.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q70090163‏
024 ‎‡a 0000-0003-0002-3678‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q70090163‏
100 0 ‎‡a Manuel Carlos López‏ ‎‡c researcher‏ ‎‡9 en‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Manuel Carlos López‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's A 12-mer repetitive antigenic epitope from Trypanosoma cruzi is a potential marker of therapeutic efficacy in chronic Chagas' disease.‏
670 ‎‡a Author's A DEVH-box RNA Helicase from Leishmania braziliensis is Associated to mRNA Cytoplasmic Granules.‏
670 ‎‡a Author's A head-to-tail tandem organization of hsp70 genes in Trypanosoma cruzi‏
670 ‎‡a Author's A Parasite Biomarker Set for Evaluating Benznidazole Treatment Efficacy in Patients with Chronic Asymptomatic Trypanosoma cruzi Infection‏
670 ‎‡a Author's A potential Z-DNA-forming sequence is located between two transcription units alternatively expressed during development of Drosophila hydei‏
670 ‎‡a Author's A trial of the synthetic malaria vaccine SPf66 in Tanzania: rationale and design‏
670 ‎‡a Author's Activity of rhodium‏
670 ‎‡a Author's Activity of rhodium(III) complexes against Trypanosoma cruzi‏
670 ‎‡a Author's Altering the motility of Trypanosoma cruzi with rabbit polyclonal anti-peptide antibodies reduces infection to susceptible mammalian cells.‏
670 ‎‡a Author's An observational longitudinal study to evaluate tools and strategies available for the diagnosis of Congenital Chagas Disease in a non-endemic country‏
670 ‎‡a Author's Antiparasitic Treatment Induces an Improved CD8+ T Cell Response in Chronic Chagasic Patients.‏
670 ‎‡a Author's Antitrypanosomal action of cis-diamminedichloroplatinum‏
670 ‎‡a Author's Antitrypanosomal action of cis-diamminedichloroplatinum (II) analogs‏
670 ‎‡a Author's Benznidazole treatment reduces the induction of indoleamine 2,3-dioxygenase (IDO) enzymatic activity in Chagas disease symptomatic patients‏
670 ‎‡a Author's Biological markers for evaluating therapeutic efficacy in Chagas disease, a systematic review.‏
670 ‎‡a Author's Biology of Trypanosoma cruzi Retrotransposons: From an Enzymatic to a Structural Point of View.‏
670 ‎‡a Author's Biomarkers of therapeutic responses in chronic Chagas disease: state of the art and future perspectives‏
670 ‎‡a Author's Breaking the non-responsiveness of C57BL/6 mice to the malarial antigen EB200--the role of carrier and adjuvant molecules‏
670 ‎‡a Author's Calcium-induced conformational changes in Leishmania infantum kinetoplastid membrane protein-11.‏
670 ‎‡a Author's Cellular Location of KMP-11 Protein in Trypanosoma rangeli‏
670 ‎‡a Author's Chagasic patients are able to respond against a viral antigen from influenza virus.‏
670 ‎‡a Author's Changes in saliva of dogs with canine leishmaniosis: A proteomic approach‏
670 ‎‡a Author's Characterising the KMP-11 and HSP-70 recombinant antigens' humoral immune response profile in chagasic patients.‏
670 ‎‡a Author's Characterization of a highly repeated interspersed DNA sequence of Trypanosoma cruzi: its potential use in diagnosis and strain classification‏
670 ‎‡a Author's Characterization of a non-long terminal repeat retrotransposon cDNA‏
670 ‎‡a Author's Characterization of a non-long terminal repeat retrotransposon cDNA (L1Tc) from Trypanosoma cruzi: homology of the first ORF with the ape family of DNA repair enzymes.‏
670 ‎‡a Author's Characterization of a short interspersed reiterated DNA sequence of Trypanosoma cruzi located at the 3'-end of a poly‏
670 ‎‡a Author's Characterization of a short interspersed reiterated DNA sequence of Trypanosoma cruzi located at the 3'-end of a poly(A)+ transcript.‏
670 ‎‡a Author's Characterization of an immunodominant antigenic epitope from Trypanosoma cruzi as a biomarker of chronic Chagas' disease pathology.‏
670 ‎‡a Author's Characterization of reverse transcriptase activity of the L1Tc retroelement from Trypanosoma cruzi‏
670 ‎‡a Author's Characterization of SPf‏
670 ‎‡a Author's Characterization of SPf(66)n: a chimeric molecule used as a malaria vaccine.‏
670 ‎‡a Author's [Chromosomal localization of the KMP-11 genes in the KP1(+) and KP1(-) strains of Trypanosoma rangeli]‏
670 ‎‡a Author's cis-Dichloro(alpha,omega-diamino carboxylate ethyl ester)palladium(II) as Palladium(II) versus Platinum(II) Model Anticancer Drugs: Synthesis, Solution Equilibria of Their Aqua, Hydroxo, and/or Chloro Species, and in Vitro/in Vivo DNA-Binding Proper‏
670 ‎‡a Author's Complete nucleotide sequence of the hsp70 gene of T. cruzi‏
670 ‎‡a Author's Control mechanisms of the H2A genes expression in Trypanosoma cruzi‏
670 ‎‡a Author's Cytoplasmic-nuclear translocation of the Hsp70 protein during environmental stress in Trypanosoma cruzi‏
670 ‎‡a Author's Dataset for distribution of SIDER2 elements in the Leishmania major genome and transcriptome.‏
670 ‎‡a Author's Diagnosis of infections with Leishmania infantum using PCR-ELISA‏
670 ‎‡a Author's Differential CD86 and CD40 co-stimulatory molecules and cytokine expression pattern induced by Trypanosoma cruzi in APCs from resistant or susceptible mice‏
670 ‎‡a Author's Differential phenotypic and functional profiles of TcCA-2 -specific cytotoxic CD8+ T cells in the asymptomatic versus cardiac phase in Chagasic patients.‏
670 ‎‡a Author's DNA binding properties and antileukemic (L1210) activity of a Pt-pentamidine complex‏
670 ‎‡a Author's DNA immunization with Trypanosoma cruzi HSP70 fused to the KMP11 protein elicits a cytotoxic and humoral immune response against the antigen and leads to protection.‏
670 ‎‡a Author's Do non-long terminal repeat retrotransposons have nuclease activity?‏
670 ‎‡a Author's Dynamics of T cells repertoire during Trypanosoma cruzi infection and its post-treatment modulation‏
670 ‎‡a Author's Effect of secondary anchor amino acid substitutions on the immunogenic properties of an HLA-A*0201-restricted T cell epitope derived from the Trypanosoma cruzi KMP-11 protein‏
670 ‎‡a Author's Effect of storage on acetylcholinesterase activity‏
670 ‎‡a Author's Evaluating Chagas disease progression and cure through blood-derived biomarkers: a systematic review‏
670 ‎‡a Author's Evaluation of IFN-gamma production by CD8+ T lymphocytes in response to the K1 peptide from KMP-11 protein in patients infected with Trypanosoma cruzi‏
670 ‎‡a Author's Expression of inhibitory receptors and polyfunctional responses of T cells are linked to the risk of congenital transmission of T. cruzi‏
670 ‎‡a Author's [Expression of markers on dendritic cells from chronic chagasic patients stimulated with the KMP-11 protein and the K1 peptide from Trypanosoma cruzi]‏
670 ‎‡a Author's Frequency of specific CD8+ T cells for a promiscuous epitope derived from Trypanosoma cruzi KMP-11 protein in chagasic patients‏
670 ‎‡a Author's Genomic cartography and proposal of nomenclature for the repeated, interspersed elements of the Leishmania major SIDER2 family and identification of SIDER2-containing transcripts.‏
670 ‎‡a Author's Genomic clustering of the Trypanosoma cruzi nonlong terminal L1Tc retrotransposon with defined interspersed repeated DNA elements‏
670 ‎‡a Author's Genomic repetitive DNA elements of Trypanosoma cruzi‏
670 ‎‡a Author's HSP70 from Trypanosoma cruzi is endowed with specific cell proliferation potential leading to apoptosis‏
670 ‎‡a Author's Identification of a Trypanosoma cruzi antigenic epitope implicated in the infectivity of fibroblast LLC-MK2 cells.‏
670 ‎‡a Author's Identification of a type I nitroreductase gene in non-virulent Trypanosoma rangeli.‏
670 ‎‡a Author's Identification of an hepatitis delta virus-like ribozyme at the mRNA 5'-end of the L1Tc retrotransposon from Trypanosoma cruzi‏
670 ‎‡a Author's Identification of HLA-A∗02:01-restricted CTL epitopes in Trypanosoma cruzi heat shock protein-70 recognized by Chagas disease patients.‏
670 ‎‡a Author's Identification of non-autonomous non-LTR retrotransposons in the genome of Trypanosoma cruzi‏
670 ‎‡a Author's Immune responses to Plasmodium falciparum antigens during a malaria vaccine trial in Tanzanian children‏
670 ‎‡a Author's Immunogenicity of HSP-70, KMP-11 and PFR-2 leishmanial antigens in the experimental model of canine visceral leishmaniasis‏
670 ‎‡a Author's Immunological and structural characterization of an epitope from the Trypanosoma cruzi KMP-11 protein‏
670 ‎‡a Author's Impact of benznidazole treatment on the functional response of Trypanosoma cruzi antigen-specific CD4+CD8+ T cells in chronic Chagas disease patients.‏
670 ‎‡a Author's Inhibitory Receptor Expression on CD8+ T Cells Is Linked to Functional Responses against Trypanosoma cruzi Antigens in Chronic Chagasic Patients.‏
670 ‎‡a Author's Isolation and characterization of the gene encoding histone H2A from Trypanosoma cruzi‏
670 ‎‡a Author's L1Tc non-LTR retrotransposons from Trypanosoma cruzi contain a functional viral-like self-cleaving 2A sequence in frame with the active proteins they encode‏
670 ‎‡a Author's Label-free quantitative proteomic analysis reveals potential biomarkers for early healing in cutaneous leishmaniasis‏
670 ‎‡a Author's Locations of Z-DNA in polytene chromosomes.‏
670 ‎‡a Author's Longitudinal monitoring of anti-saliva antibodies as markers of repellent efficacy against Phlebotomus perniciosus and Phlebotomus papatasi in dogs‏
670 ‎‡a Author's Mapping of the antigenic determinants of the T. cruzi kinetoplastid membrane protein-11. Identification of a linear epitope specifically recognized by human Chagasic sera‏
670 ‎‡a Author's Microbial heat shock protein 70 stimulatory properties have different TLR requirements‏
670 ‎‡a Author's Mode of action of intercalating drug, cis-Pt(II)(DDH)Cl2, cis-Pt(II)(DDH) (metafluorobenzoic)2, and cis-Pt(II)(DDH)(mucubromic)2, on Trypanosoma cruzi‏
670 ‎‡a Author's Molecular and immunological characterization of L14 ribosomal protein from Leishmania braziliensis.‏
670 ‎‡a Author's Molecular characterization of calcineurin B from the non-virulent Trypanosoma rangeli kinetoplastid indicates high gene conservation‏
670 ‎‡a Author's Molecular characterization of KMP11 from Trypanosoma cruzi: a cytoskeleton-associated protein regulated at the translational level‏
670 ‎‡a Author's Molecular characterization of the histone H2A gene from the parasite Trypanosoma rangeli.‏
670 ‎‡a Author's Molecular characterization of the kinetoplastid membrane protein-11 genes from the parasite Trypanosoma rangeli‏
670 ‎‡a Author's Molecular characterization of the short interspersed repetitive element SIRE in the six discrete typing units‏
670 ‎‡a Author's Molecular characterization of the short interspersed repetitive element SIRE in the six discrete typing units (DTUs) of Trypanosoma cruzi.‏
670 ‎‡a Author's Molecular cloning of a Drosophila potential Z-DNA forming sequence hybridizing in situ to a developmentally regulated subdivision of the polytene chromosomes‏
670 ‎‡a Author's Monocyte-derived dendritic cells from chagasic patients vs healthy donors secrete differential levels of IL-10 and IL-12 when stimulated with a protein fragment of Trypanosoma cruzi heat-shock protein-70‏
670 ‎‡a Author's Multiprimer PCR system for differential identification of mycobacteria in clinical samples.‏
670 ‎‡a Author's Natural CD4+ T-cell responses against Trypanosoma cruzi KMP-11 protein in chronic chagasic patients‏
670 ‎‡a Author's Nucleic-acid-binding properties of the C2-L1Tc nucleic acid chaperone encoded by L1Tc retrotransposon‏
670 ‎‡a Author's One-year follow-up of anti-Leishmania antibody concentrations in serum and saliva from experimentally infected dogs‏
670 ‎‡a Author's Oral transmission of Chagas disease: typing of Trypanosoma cruzi from five outbreaks occurred in Venezuela shows multiclonal and common infections in patients, vectors and reservoirs‏
670 ‎‡a Author's Performance of Leishmania PFR1 recombinant antigen in serological diagnosis of asymptomatic canine leishmaniosis by ELISA‏
670 ‎‡a Author's Phage recovery by electroporation of naked DNA into host cells avoids the use of packaging extracts.‏
670 ‎‡a Author's Phenotypic and Functional Profiles of Antigen-Specific CD4 and CD8 T Cells Associated With Infection Control in Patients With Cutaneous Leishmaniasis‏
670 ‎‡a Author's Plasticity of the histone H2A genes in a Brazilian and six Colombian strains of Trypanosoma cruzi.‏
670 ‎‡a Author's Pr77 and L1TcRz‏
670 ‎‡a Author's Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients.‏
670 ‎‡a Author's Rabbit serum against K1 peptide, an immunogenic epitope of the Trypanosoma cruzi KMP-11, decreases parasite invasion to cells‏
670 ‎‡a Author's Randomised trial of efficacy of SPf66 vaccine against Plasmodium falciparum malaria in children in southern Tanzania.‏
670 ‎‡a Author's Regulation of hsp70 expression in Trypanosoma cruzi by temperature and growth phase‏
670 ‎‡a Author's Reverse transcriptase-like activity in Trypanosoma cruzi‏
670 ‎‡a Author's Risk factors and primary prevention of congenital Chagas disease in a nonendemic country.‏
670 ‎‡a Author's Secuencia de nucleótidos del gen hsp70 de Trypanosoma cruzi‏
670 ‎‡a Author's Sensitive detection of cereal fractions that are toxic to celiac disease patients by using monoclonal antibodies to a main immunogenic wheat peptide‏
670 ‎‡a Author's Sequence and expression of the Drosophila phenylalanine hydroxylase mRNA.‏
670 ‎‡a Author's Sequence polymorphism in the Trypanosoma rangeli HSP70 coding genes allows typing of the parasite KP1‏
670 ‎‡a Author's Sequence polymorphism in the Trypanosoma rangeli HSP70 coding genes allows typing of the parasite KP1(+) and KP1(−) groups‏
670 ‎‡a Author's Serum proteome of dogs at subclinical and clinical onset of canine leishmaniosis‏
670 ‎‡a Author's Short-term follow-up of chagasic patients after benzonidazole treatment using multiple serological markers.‏
670 ‎‡a Author's SPf66, a chemically synthesized subunit malaria vaccine, is safe and immunogenic in Tanzanians exposed to intense malaria transmission‏
670 ‎‡a Author's Studies on the interaction between antitrypanosome cis-DDP analogs with dna‏
670 ‎‡a Author's The anti Z-DNA reactivity of Z-DNA forming sequences is affected by platinum antitumor drugs.‏
670 ‎‡a Author's The biology and evolution of transposable elements in parasites‏
670 ‎‡a Author's The effect of temperature on the stability of the synthetic SPf‏
670 ‎‡a Author's The effect of temperature on the stability of the synthetic SPf(66)n malaria vaccine.‏
670 ‎‡a Author's The endonuclease NL1Tc encoded by the LINE L1Tc from Trypanosoma cruzi protects parasites from daunorubicin DNA damage.‏
670 ‎‡a Author's The genetic immunization with paraflagellar rod protein-2 fused to the HSP70 confers protection against late Trypanosoma cruzi infection‏
670 ‎‡a Author's The heat shock protein hsp70 binds in vivo to subregions 2-48BC and 3-58D of the polytene chromosomes of Drosophila hydei.‏
670 ‎‡a Author's The immunization of A2/K‏
670 ‎‡a Author's The immunization of A2/K(b) transgenic mice with the KMP11-HSP70 fusion protein induces CTL response against human cells expressing the T. cruzi KMP11 antigen: identification of A2-restricted epitopes‏
670 ‎‡a Author's The innate immune response status correlates with a divergent clinical course in congenital Chagas disease of twins born in a non-endemic country.‏
670 ‎‡a Author's The L1Tc C-terminal domain from Trypanosoma cruzi non-long terminal repeat retrotransposon codes for a protein that bears two C2H2 zinc finger motifs and is endowed with nucleic acid chaperone activity.‏
670 ‎‡a Author's The L1Tc, long interspersed nucleotide element from Trypanosoma cruzi, encodes a protein with 3'-phosphatase and 3'-phosphodiesterase enzymatic activities‏
670 ‎‡a Author's The L1Tc non-LTR retrotransposon of Trypanosoma cruzi contains an internal RNA-pol II-dependent promoter that strongly activates gene transcription and generates unspliced transcripts.‏
670 ‎‡a Author's The non-LTR‏
670 ‎‡a Author's The non-LTR (long terminal repeat) retrotransposon L1Tc from Trypanosoma cruzi codes for a protein with RNase H activity.‏
670 ‎‡a Author's The open reading frame 1 of the L1Tc retrotransposon of Trypanosoma cruzi codes for a protein with apurinic-apyrimidinic nuclease activity‏
670 ‎‡a Author's The SIDER2 elements, interspersed repeated sequences that populate the Leishmania genomes, constitute subfamilies showing chromosomal proximity relationship‏
670 ‎‡a Author's The stability and maturation of the H2A histone mRNAs from Trypanosoma cruzi are implicated in their post-transcriptional regulation‏
670 ‎‡a Author's The Trypanosoma rangeli histone H2A gene sequence serves as a differential marker for KP1 strains‏
670 ‎‡a Author's The Trypanosomatid Pr77-hallmark contains a downstream core promoter element essential for transcription activity of the Trypanosoma cruzi L1Tc retrotransposon.‏
670 ‎‡a Author's The wide expansion of hepatitis delta virus-like ribozymes throughout trypanosomatid genomes is linked to the spreading of L1Tc/ingi clade mobile elements.‏
670 ‎‡a Author's Toward the assessment of food toxicity for celiac patients: characterization of monoclonal antibodies to a main immunogenic gluten peptide.‏
670 ‎‡a Author's Towards a paradigm shift in the treatment of chronic Chagas disease.‏
670 ‎‡a Author's Towards the physical map of the Trypanosoma cruzi nuclear genome: construction of YAC and BAC libraries of the reference clone T. cruzi CL-Brener‏
670 ‎‡a Author's Transcriptional Profiling of Immune-Related Genes in Leishmania infantum-Infected Mice: Identification of Potential Biomarkers of Infection and Progression of Disease.‏
670 ‎‡a Author's Trypanosoma cruzi genotyping supports a common source of infection in a school-related oral outbreak of acute Chagas disease in Venezuela.‏
670 ‎‡a Author's Trypanosoma cruzi heat-shock protein-70 kDa,alone or fused to the parasite KMP11 antigen, induces functional maturation of murine dendritic cells‏
670 ‎‡a Author's Trypanosoma cruzi paraflagellar rod proteins 2 and 3 contain immunodominant CD8‏
670 ‎‡a Author's Trypanosoma cruzi paraflagellar rod proteins 2 and 3 contain immunodominant CD8(+) T-cell epitopes that are recognized by cytotoxic T cells from Chagas disease patients.‏
670 ‎‡a Author's Z-DNA in transcriptionally active chromosomes‏
909 ‎‡a (orcid) 0000000300023678‏ ‎‡9 1‏
919 ‎‡a effectoftemperatureonthestabilityofthesyntheticspf66nmalariavaccine‏ ‎‡A The effect of temperature on the stability of the synthetic SPf(66)n malaria vaccine.‏ ‎‡9 1‏
919 ‎‡a 12merrepetitiveantigenicepitopefromtrypanosomacruziisapotentialmarkeroftherapeuticefficacyinchronicchagasdisease‏ ‎‡A A 12-mer repetitive antigenic epitope from Trypanosoma cruzi is a potential marker of therapeutic efficacy in chronic Chagas' disease.‏ ‎‡9 1‏
919 ‎‡a devhboxrnahelicasefromleishmaniabraziliensisisassociatedtomrnacytoplasmicgranules‏ ‎‡A A DEVH-box RNA Helicase from Leishmania braziliensis is Associated to mRNA Cytoplasmic Granules.‏ ‎‡9 1‏
919 ‎‡a headtotailtandemorganizationofhsp70genesintrypanosomacruzi‏ ‎‡A A head-to-tail tandem organization of hsp70 genes in Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a parasitebiomarkersetforevaluatingbenznidazoletreatmentefficacyinpatientswithchronicasymptomatictrypanosomacruziinfection‏ ‎‡A A Parasite Biomarker Set for Evaluating Benznidazole Treatment Efficacy in Patients with Chronic Asymptomatic Trypanosoma cruzi Infection‏ ‎‡9 1‏
919 ‎‡a potentialzdnaformingsequenceislocatedbetween2transcriptionunitsalternativelyexpressedduringdevelopmentofdrosophilahydei‏ ‎‡A A potential Z-DNA-forming sequence is located between two transcription units alternatively expressed during development of Drosophila hydei‏ ‎‡9 1‏
919 ‎‡a trialofthesyntheticmalariavaccinespf66intanzaniarationaleanddesign‏ ‎‡A A trial of the synthetic malaria vaccine SPf66 in Tanzania: rationale and design‏ ‎‡9 1‏
919 ‎‡a activityofrhodium‏ ‎‡A Activity of rhodium‏ ‎‡9 1‏
919 ‎‡a activityofrhodium3complexesagainsttrypanosomacruzi‏ ‎‡A Activity of rhodium(III) complexes against Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a alteringthemotilityoftrypanosomacruziwithrabbitpolyclonalantipeptideantibodiesreducesinfectiontosusceptiblemammaliancells‏ ‎‡A Altering the motility of Trypanosoma cruzi with rabbit polyclonal anti-peptide antibodies reduces infection to susceptible mammalian cells.‏ ‎‡9 1‏
919 ‎‡a observationallongitudinalstudytoevaluatetoolsandstrategiesavailableforthediagnosisofcongenitalchagasdiseaseinanonendemiccountry‏ ‎‡A An observational longitudinal study to evaluate tools and strategies available for the diagnosis of Congenital Chagas Disease in a non-endemic country‏ ‎‡9 1‏
919 ‎‡a antiparasitictreatmentinducesanimprovedcd8+tcellresponseinchronicchagasicpatients‏ ‎‡A Antiparasitic Treatment Induces an Improved CD8+ T Cell Response in Chronic Chagasic Patients.‏ ‎‡9 1‏
919 ‎‡a antitrypanosomalactionofcisdiamminedichloroplatinum‏ ‎‡A Antitrypanosomal action of cis-diamminedichloroplatinum‏ ‎‡9 1‏
919 ‎‡a antitrypanosomalactionofcisdiamminedichloroplatinum2analogs‏ ‎‡A Antitrypanosomal action of cis-diamminedichloroplatinum (II) analogs‏ ‎‡9 1‏
919 ‎‡a benznidazoletreatmentreducestheinductionofindoleamine23dioxygenaseidoenzymaticactivityinchagasdiseasesymptomaticpatients‏ ‎‡A Benznidazole treatment reduces the induction of indoleamine 2,3-dioxygenase (IDO) enzymatic activity in Chagas disease symptomatic patients‏ ‎‡9 1‏
919 ‎‡a biologicalmarkersforevaluatingtherapeuticefficacyinchagasdiseaseasystematicreview‏ ‎‡A Biological markers for evaluating therapeutic efficacy in Chagas disease, a systematic review.‏ ‎‡9 1‏
919 ‎‡a biologyoftrypanosomacruziretrotransposonsfromanenzymatictoastructuralpointofview‏ ‎‡A Biology of Trypanosoma cruzi Retrotransposons: From an Enzymatic to a Structural Point of View.‏ ‎‡9 1‏
919 ‎‡a biomarkersoftherapeuticresponsesinchronicchagasdiseasestateoftheartandfutureperspectives‏ ‎‡A Biomarkers of therapeutic responses in chronic Chagas disease: state of the art and future perspectives‏ ‎‡9 1‏
919 ‎‡a breakingthenonresponsivenessofc57bl6micetothemalarialantigeneb200theroleofcarrierandadjuvantmolecules‏ ‎‡A Breaking the non-responsiveness of C57BL/6 mice to the malarial antigen EB200--the role of carrier and adjuvant molecules‏ ‎‡9 1‏
919 ‎‡a calciuminducedconformationalchangesinleishmaniainfantumkinetoplastidmembraneprotein11‏ ‎‡A Calcium-induced conformational changes in Leishmania infantum kinetoplastid membrane protein-11.‏ ‎‡9 1‏
919 ‎‡a cellularlocationofkmp11proteinintrypanosomarangeli‏ ‎‡A Cellular Location of KMP-11 Protein in Trypanosoma rangeli‏ ‎‡9 1‏
919 ‎‡a chagasicpatientsareabletorespondagainstaviralantigenfrominfluenzavirus‏ ‎‡A Chagasic patients are able to respond against a viral antigen from influenza virus.‏ ‎‡9 1‏
919 ‎‡a changesinsalivaofdogswithcanineleishmaniosisaproteomicapproach‏ ‎‡A Changes in saliva of dogs with canine leishmaniosis: A proteomic approach‏ ‎‡9 1‏
919 ‎‡a characterisingthekmp11andhsp70recombinantantigenshumoralimmuneresponseprofileinchagasicpatients‏ ‎‡A Characterising the KMP-11 and HSP-70 recombinant antigens' humoral immune response profile in chagasic patients.‏ ‎‡9 1‏
919 ‎‡a characterizationofahighlyrepeatedintersperseddnasequenceoftrypanosomacruziitspotentialuseindiagnosisandstrainclassification‏ ‎‡A Characterization of a highly repeated interspersed DNA sequence of Trypanosoma cruzi: its potential use in diagnosis and strain classification‏ ‎‡9 1‏
919 ‎‡a characterizationofanonlongterminalrepeatretrotransposoncdna‏ ‎‡A Characterization of a non-long terminal repeat retrotransposon cDNA‏ ‎‡9 1‏
919 ‎‡a characterizationofanonlongterminalrepeatretrotransposoncdnal1tcfromtrypanosomacruzihomologyofthe1orfwiththeapefamilyofdnarepairenzymes‏ ‎‡A Characterization of a non-long terminal repeat retrotransposon cDNA (L1Tc) from Trypanosoma cruzi: homology of the first ORF with the ape family of DNA repair enzymes.‏ ‎‡9 1‏
919 ‎‡a characterizationofashortinterspersedreiterateddnasequenceoftrypanosomacruzilocatedatthe3endofapoly‏ ‎‡A Characterization of a short interspersed reiterated DNA sequence of Trypanosoma cruzi located at the 3'-end of a poly‏ ‎‡9 1‏
919 ‎‡a characterizationofashortinterspersedreiterateddnasequenceoftrypanosomacruzilocatedatthe3endofapolya+transcript‏ ‎‡A Characterization of a short interspersed reiterated DNA sequence of Trypanosoma cruzi located at the 3'-end of a poly(A)+ transcript.‏ ‎‡9 1‏
919 ‎‡a characterizationofanimmunodominantantigenicepitopefromtrypanosomacruziasabiomarkerofchronicchagasdiseasepathology‏ ‎‡A Characterization of an immunodominant antigenic epitope from Trypanosoma cruzi as a biomarker of chronic Chagas' disease pathology.‏ ‎‡9 1‏
919 ‎‡a characterizationofreversetranscriptaseactivityofthel1tcretroelementfromtrypanosomacruzi‏ ‎‡A Characterization of reverse transcriptase activity of the L1Tc retroelement from Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a characterizationofspf‏ ‎‡A Characterization of SPf‏ ‎‡9 1‏
919 ‎‡a characterizationofspf66nachimericmoleculeusedasamalariavaccine‏ ‎‡A Characterization of SPf(66)n: a chimeric molecule used as a malaria vaccine.‏ ‎‡9 1‏
919 ‎‡a chromosomallocalizationofthekmp11genesinthekp1+andkp1strainsoftrypanosomarangeli‏ ‎‡A [Chromosomal localization of the KMP-11 genes in the KP1(+) and KP1(-) strains of Trypanosoma rangeli]‏ ‎‡9 1‏
919 ‎‡a cisdichloroalphaomegadiaminocarboxylateethylesterpalladium2aspalladium2versusplatinum2modelanticancerdrugssynthesissolutionequilibriaoftheiraquahydroxoandorchlorospeciesandinvitroinvivodnabindingproper‏ ‎‡A cis-Dichloro(alpha,omega-diamino carboxylate ethyl ester)palladium(II) as Palladium(II) versus Platinum(II) Model Anticancer Drugs: Synthesis, Solution Equilibria of Their Aqua, Hydroxo, and/or Chloro Species, and in Vitro/in Vivo DNA-Binding Proper‏ ‎‡9 1‏
919 ‎‡a completenucleotidesequenceofthehsp70geneoftcruzi‏ ‎‡A Complete nucleotide sequence of the hsp70 gene of T. cruzi‏ ‎‡9 1‏
919 ‎‡a controlmechanismsoftheh2agenesexpressionintrypanosomacruzi‏ ‎‡A Control mechanisms of the H2A genes expression in Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a cytoplasmicnucleartranslocationofthehsp70proteinduringenvironmentalstressintrypanosomacruzi‏ ‎‡A Cytoplasmic-nuclear translocation of the Hsp70 protein during environmental stress in Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a datasetfordistributionofsider2elementsintheleishmaniamajorgenomeandtranscriptome‏ ‎‡A Dataset for distribution of SIDER2 elements in the Leishmania major genome and transcriptome.‏ ‎‡9 1‏
919 ‎‡a diagnosisofinfectionswithleishmaniainfantumusingpcrelisa‏ ‎‡A Diagnosis of infections with Leishmania infantum using PCR-ELISA‏ ‎‡9 1‏
919 ‎‡a differentialcd86andcd40costimulatorymoleculesandcytokineexpressionpatterninducedbytrypanosomacruziinapcsfromresistantorsusceptiblemice‏ ‎‡A Differential CD86 and CD40 co-stimulatory molecules and cytokine expression pattern induced by Trypanosoma cruzi in APCs from resistant or susceptible mice‏ ‎‡9 1‏
919 ‎‡a differentialphenotypicandfunctionalprofilesoftcca2specificcytotoxiccd8+tcellsintheasymptomaticversuscardiacphaseinchagasicpatients‏ ‎‡A Differential phenotypic and functional profiles of TcCA-2 -specific cytotoxic CD8+ T cells in the asymptomatic versus cardiac phase in Chagasic patients.‏ ‎‡9 1‏
919 ‎‡a dnabindingpropertiesandantileukemicl1210activityofaptpentamidinecomplex‏ ‎‡A DNA binding properties and antileukemic (L1210) activity of a Pt-pentamidine complex‏ ‎‡9 1‏
919 ‎‡a dnaimmunizationwithtrypanosomacruzihsp70fusedtothekmp11proteinelicitsacytotoxicandhumoralimmuneresponseagainsttheantigenandleadstoprotection‏ ‎‡A DNA immunization with Trypanosoma cruzi HSP70 fused to the KMP11 protein elicits a cytotoxic and humoral immune response against the antigen and leads to protection.‏ ‎‡9 1‏
919 ‎‡a dononlongterminalrepeatretrotransposonshavenucleaseactivity‏ ‎‡A Do non-long terminal repeat retrotransposons have nuclease activity?‏ ‎‡9 1‏
919 ‎‡a dynamicsoftcellsrepertoireduringtrypanosomacruziinfectionanditsposttreatmentmodulation‏ ‎‡A Dynamics of T cells repertoire during Trypanosoma cruzi infection and its post-treatment modulation‏ ‎‡9 1‏
919 ‎‡a effectofsecondaryanchoraminoacidsubstitutionsontheimmunogenicpropertiesofanhlaa0201restrictedtcellepitopederivedfromthetrypanosomacruzikmp11protein‏ ‎‡A Effect of secondary anchor amino acid substitutions on the immunogenic properties of an HLA-A*0201-restricted T cell epitope derived from the Trypanosoma cruzi KMP-11 protein‏ ‎‡9 1‏
919 ‎‡a effectofstorageonacetylcholinesteraseactivity‏ ‎‡A Effect of storage on acetylcholinesterase activity‏ ‎‡9 1‏
919 ‎‡a evaluatingchagasdiseaseprogressionandcurethroughbloodderivedbiomarkersasystematicreview‏ ‎‡A Evaluating Chagas disease progression and cure through blood-derived biomarkers: a systematic review‏ ‎‡9 1‏
919 ‎‡a evaluationofifngammaproductionbycd8+tlymphocytesinresponsetothek1peptidefromkmp11proteininpatientsinfectedwithtrypanosomacruzi‏ ‎‡A Evaluation of IFN-gamma production by CD8+ T lymphocytes in response to the K1 peptide from KMP-11 protein in patients infected with Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a expressionofinhibitoryreceptorsandpolyfunctionalresponsesoftcellsarelinkedtotheriskofcongenitaltransmissionoftcruzi‏ ‎‡A Expression of inhibitory receptors and polyfunctional responses of T cells are linked to the risk of congenital transmission of T. cruzi‏ ‎‡9 1‏
919 ‎‡a expressionofmarkersondendriticcellsfromchronicchagasicpatientsstimulatedwiththekmp11proteinandthek1peptidefromtrypanosomacruzi‏ ‎‡A [Expression of markers on dendritic cells from chronic chagasic patients stimulated with the KMP-11 protein and the K1 peptide from Trypanosoma cruzi]‏ ‎‡9 1‏
919 ‎‡a frequencyofspecificcd8+tcellsforapromiscuousepitopederivedfromtrypanosomacruzikmp11proteininchagasicpatients‏ ‎‡A Frequency of specific CD8+ T cells for a promiscuous epitope derived from Trypanosoma cruzi KMP-11 protein in chagasic patients‏ ‎‡9 1‏
919 ‎‡a genomiccartographyandproposalofnomenclaturefortherepeatedinterspersedelementsoftheleishmaniamajorsider2familyandidentificationofsider2containingtranscripts‏ ‎‡A Genomic cartography and proposal of nomenclature for the repeated, interspersed elements of the Leishmania major SIDER2 family and identification of SIDER2-containing transcripts.‏ ‎‡9 1‏
919 ‎‡a genomicclusteringofthetrypanosomacruzinonlongterminall1tcretrotransposonwithdefinedinterspersedrepeateddnaelements‏ ‎‡A Genomic clustering of the Trypanosoma cruzi nonlong terminal L1Tc retrotransposon with defined interspersed repeated DNA elements‏ ‎‡9 1‏
919 ‎‡a genomicrepetitivednaelementsoftrypanosomacruzi‏ ‎‡A Genomic repetitive DNA elements of Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a hsp70fromtrypanosomacruziisendowedwithspecificcellproliferationpotentialleadingtoapoptosis‏ ‎‡A HSP70 from Trypanosoma cruzi is endowed with specific cell proliferation potential leading to apoptosis‏ ‎‡9 1‏
919 ‎‡a identificationofatrypanosomacruziantigenicepitopeimplicatedintheinfectivityoffibroblastllcmk2cells‏ ‎‡A Identification of a Trypanosoma cruzi antigenic epitope implicated in the infectivity of fibroblast LLC-MK2 cells.‏ ‎‡9 1‏
919 ‎‡a identificationofatype1nitroreductasegeneinnonvirulenttrypanosomarangeli‏ ‎‡A Identification of a type I nitroreductase gene in non-virulent Trypanosoma rangeli.‏ ‎‡9 1‏
919 ‎‡a identificationofanhepatitisdeltaviruslikeribozymeatthemrna5endofthel1tcretrotransposonfromtrypanosomacruzi‏ ‎‡A Identification of an hepatitis delta virus-like ribozyme at the mRNA 5'-end of the L1Tc retrotransposon from Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a identificationofhlaa0201restrictedctlepitopesintrypanosomacruziheatshockprotein70recognizedbychagasdiseasepatients‏ ‎‡A Identification of HLA-A∗02:01-restricted CTL epitopes in Trypanosoma cruzi heat shock protein-70 recognized by Chagas disease patients.‏ ‎‡9 1‏
919 ‎‡a identificationofnonautonomousnonltrretrotransposonsinthegenomeoftrypanosomacruzi‏ ‎‡A Identification of non-autonomous non-LTR retrotransposons in the genome of Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a immuneresponsestoplasmodiumfalciparumantigensduringamalariavaccinetrialintanzanianchildren‏ ‎‡A Immune responses to Plasmodium falciparum antigens during a malaria vaccine trial in Tanzanian children‏ ‎‡9 1‏
919 ‎‡a immunogenicityofhsp70kmp11andpfr2leishmanialantigensintheexperimentalmodelofcaninevisceralleishmaniasis‏ ‎‡A Immunogenicity of HSP-70, KMP-11 and PFR-2 leishmanial antigens in the experimental model of canine visceral leishmaniasis‏ ‎‡9 1‏
919 ‎‡a immunologicalandstructuralcharacterizationofanepitopefromthetrypanosomacruzikmp11protein‏ ‎‡A Immunological and structural characterization of an epitope from the Trypanosoma cruzi KMP-11 protein‏ ‎‡9 1‏
919 ‎‡a impactofbenznidazoletreatmentonthefunctionalresponseoftrypanosomacruziantigenspecificcd4+cd8+tcellsinchronicchagasdiseasepatients‏ ‎‡A Impact of benznidazole treatment on the functional response of Trypanosoma cruzi antigen-specific CD4+CD8+ T cells in chronic Chagas disease patients.‏ ‎‡9 1‏
919 ‎‡a inhibitoryreceptorexpressiononcd8+tcellsislinkedtofunctionalresponsesagainsttrypanosomacruziantigensinchronicchagasicpatients‏ ‎‡A Inhibitory Receptor Expression on CD8+ T Cells Is Linked to Functional Responses against Trypanosoma cruzi Antigens in Chronic Chagasic Patients.‏ ‎‡9 1‏
919 ‎‡a isolationandcharacterizationofthegeneencodinghistoneh2afromtrypanosomacruzi‏ ‎‡A Isolation and characterization of the gene encoding histone H2A from Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a l1tcnonltrretrotransposonsfromtrypanosomacruzicontainafunctionalvirallikeselfcleaving2asequenceinframewiththeactiveproteinstheyencode‏ ‎‡A L1Tc non-LTR retrotransposons from Trypanosoma cruzi contain a functional viral-like self-cleaving 2A sequence in frame with the active proteins they encode‏ ‎‡9 1‏
919 ‎‡a labelfreequantitativeproteomicanalysisrevealspotentialbiomarkersforearlyhealingincutaneousleishmaniasis‏ ‎‡A Label-free quantitative proteomic analysis reveals potential biomarkers for early healing in cutaneous leishmaniasis‏ ‎‡9 1‏
919 ‎‡a locationsofzdnainpolytenechromosomes‏ ‎‡A Locations of Z-DNA in polytene chromosomes.‏ ‎‡9 1‏
919 ‎‡a longitudinalmonitoringofantisalivaantibodiesasmarkersofrepellentefficacyagainstphlebotomusperniciosusandphlebotomuspapatasiindogs‏ ‎‡A Longitudinal monitoring of anti-saliva antibodies as markers of repellent efficacy against Phlebotomus perniciosus and Phlebotomus papatasi in dogs‏ ‎‡9 1‏
919 ‎‡a mappingoftheantigenicdeterminantsofthetcruzikinetoplastidmembraneprotein11identificationofalinearepitopespecificallyrecognizedbyhumanchagasicsera‏ ‎‡A Mapping of the antigenic determinants of the T. cruzi kinetoplastid membrane protein-11. Identification of a linear epitope specifically recognized by human Chagasic sera‏ ‎‡9 1‏
919 ‎‡a microbialheatshockprotein70stimulatorypropertieshavedifferenttlrrequirements‏ ‎‡A Microbial heat shock protein 70 stimulatory properties have different TLR requirements‏ ‎‡9 1‏
919 ‎‡a modeofactionofintercalatingdrugcispt2ddhcl2cispt2ddhmetafluorobenzoic2andcispt2ddhmucubromic2ontrypanosomacruzi‏ ‎‡A Mode of action of intercalating drug, cis-Pt(II)(DDH)Cl2, cis-Pt(II)(DDH) (metafluorobenzoic)2, and cis-Pt(II)(DDH)(mucubromic)2, on Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a molecularandimmunologicalcharacterizationofl14ribosomalproteinfromleishmaniabraziliensis‏ ‎‡A Molecular and immunological characterization of L14 ribosomal protein from Leishmania braziliensis.‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationofcalcineurinbfromthenonvirulenttrypanosomarangelikinetoplastidindicateshighgeneconservation‏ ‎‡A Molecular characterization of calcineurin B from the non-virulent Trypanosoma rangeli kinetoplastid indicates high gene conservation‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationofkmp11fromtrypanosomacruziacytoskeletonassociatedproteinregulatedatthetranslationallevel‏ ‎‡A Molecular characterization of KMP11 from Trypanosoma cruzi: a cytoskeleton-associated protein regulated at the translational level‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationofthehistoneh2agenefromtheparasitetrypanosomarangeli‏ ‎‡A Molecular characterization of the histone H2A gene from the parasite Trypanosoma rangeli.‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationofthekinetoplastidmembraneprotein11genesfromtheparasitetrypanosomarangeli‏ ‎‡A Molecular characterization of the kinetoplastid membrane protein-11 genes from the parasite Trypanosoma rangeli‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationoftheshortinterspersedrepetitiveelementsireinthe6discretetypingunits‏ ‎‡A Molecular characterization of the short interspersed repetitive element SIRE in the six discrete typing units‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationoftheshortinterspersedrepetitiveelementsireinthe6discretetypingunitsdtusoftrypanosomacruzi‏ ‎‡A Molecular characterization of the short interspersed repetitive element SIRE in the six discrete typing units (DTUs) of Trypanosoma cruzi.‏ ‎‡9 1‏
919 ‎‡a molecularcloningofadrosophilapotentialzdnaformingsequencehybridizinginsitutoadevelopmentallyregulatedsubdivisionofthepolytenechromosomes‏ ‎‡A Molecular cloning of a Drosophila potential Z-DNA forming sequence hybridizing in situ to a developmentally regulated subdivision of the polytene chromosomes‏ ‎‡9 1‏
919 ‎‡a monocytederiveddendriticcellsfromchagasicpatientsvshealthydonorssecretedifferentiallevelsofil10andil12whenstimulatedwithaproteinfragmentoftrypanosomacruziheatshockprotein70‏ ‎‡A Monocyte-derived dendritic cells from chagasic patients vs healthy donors secrete differential levels of IL-10 and IL-12 when stimulated with a protein fragment of Trypanosoma cruzi heat-shock protein-70‏ ‎‡9 1‏
919 ‎‡a multiprimerpcrsystemfordifferentialidentificationofmycobacteriainclinicalsamples‏ ‎‡A Multiprimer PCR system for differential identification of mycobacteria in clinical samples.‏ ‎‡9 1‏
919 ‎‡a naturalcd4+tcellresponsesagainsttrypanosomacruzikmp11proteininchronicchagasicpatients‏ ‎‡A Natural CD4+ T-cell responses against Trypanosoma cruzi KMP-11 protein in chronic chagasic patients‏ ‎‡9 1‏
919 ‎‡a nucleicacidbindingpropertiesofthec2l1tcnucleicacidchaperoneencodedbyl1tcretrotransposon‏ ‎‡A Nucleic-acid-binding properties of the C2-L1Tc nucleic acid chaperone encoded by L1Tc retrotransposon‏ ‎‡9 1‏
919 ‎‡a 1yearfollowupofantileishmaniaantibodyconcentrationsinserumandsalivafromexperimentallyinfecteddogs‏ ‎‡A One-year follow-up of anti-Leishmania antibody concentrations in serum and saliva from experimentally infected dogs‏ ‎‡9 1‏
919 ‎‡a oraltransmissionofchagasdiseasetypingoftrypanosomacruzifrom5outbreaksoccurredinvenezuelashowsmulticlonalandcommoninfectionsinpatientsvectorsandreservoirs‏ ‎‡A Oral transmission of Chagas disease: typing of Trypanosoma cruzi from five outbreaks occurred in Venezuela shows multiclonal and common infections in patients, vectors and reservoirs‏ ‎‡9 1‏
919 ‎‡a performanceofleishmaniapfr1recombinantantigeninserologicaldiagnosisofasymptomaticcanineleishmaniosisbyelisa‏ ‎‡A Performance of Leishmania PFR1 recombinant antigen in serological diagnosis of asymptomatic canine leishmaniosis by ELISA‏ ‎‡9 1‏
919 ‎‡a phagerecoverybyelectroporationofnakeddnaintohostcellsavoidstheuseofpackagingextracts‏ ‎‡A Phage recovery by electroporation of naked DNA into host cells avoids the use of packaging extracts.‏ ‎‡9 1‏
919 ‎‡a phenotypicandfunctionalprofilesofantigenspecificcd4andcd8tcellsassociatedwithinfectioncontrolinpatientswithcutaneousleishmaniasis‏ ‎‡A Phenotypic and Functional Profiles of Antigen-Specific CD4 and CD8 T Cells Associated With Infection Control in Patients With Cutaneous Leishmaniasis‏ ‎‡9 1‏
919 ‎‡a plasticityofthehistoneh2agenesinabrazilianand6colombianstrainsoftrypanosomacruzi‏ ‎‡A Plasticity of the histone H2A genes in a Brazilian and six Colombian strains of Trypanosoma cruzi.‏ ‎‡9 1‏
919 ‎‡a pr77andl1tcrz‏ ‎‡A Pr77 and L1TcRz‏ ‎‡9 1‏
919 ‎‡a promiscuousrecognitionofatrypanosomacruzicd8+tcellepitopeamonghlaa2hlaa24andhlaa1supertypesinchagasicpatients‏ ‎‡A Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients.‏ ‎‡9 1‏
919 ‎‡a rabbitserumagainstk1peptideanimmunogenicepitopeofthetrypanosomacruzikmp11decreasesparasiteinvasiontocells‏ ‎‡A Rabbit serum against K1 peptide, an immunogenic epitope of the Trypanosoma cruzi KMP-11, decreases parasite invasion to cells‏ ‎‡9 1‏
919 ‎‡a randomisedtrialofefficacyofspf66vaccineagainstplasmodiumfalciparummalariainchildreninsoutherntanzania‏ ‎‡A Randomised trial of efficacy of SPf66 vaccine against Plasmodium falciparum malaria in children in southern Tanzania.‏ ‎‡9 1‏
919 ‎‡a regulationofhsp70expressionintrypanosomacruzibytemperatureandgrowthphase‏ ‎‡A Regulation of hsp70 expression in Trypanosoma cruzi by temperature and growth phase‏ ‎‡9 1‏
919 ‎‡a reversetranscriptaselikeactivityintrypanosomacruzi‏ ‎‡A Reverse transcriptase-like activity in Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a riskfactorsandprimarypreventionofcongenitalchagasdiseaseinanonendemiccountry‏ ‎‡A Risk factors and primary prevention of congenital Chagas disease in a nonendemic country.‏ ‎‡9 1‏
919 ‎‡a secuenciadenucleotidosdelgenhsp70detrypanosomacruzi‏ ‎‡A Secuencia de nucleótidos del gen hsp70 de Trypanosoma cruzi‏ ‎‡9 1‏
919 ‎‡a sensitivedetectionofcerealfractionsthataretoxictoceliacdiseasepatientsbyusingmonoclonalantibodiestoamainimmunogenicwheatpeptide‏ ‎‡A Sensitive detection of cereal fractions that are toxic to celiac disease patients by using monoclonal antibodies to a main immunogenic wheat peptide‏ ‎‡9 1‏
919 ‎‡a sequenceandexpressionofthedrosophilaphenylalaninehydroxylasemrna‏ ‎‡A Sequence and expression of the Drosophila phenylalanine hydroxylase mRNA.‏ ‎‡9 1‏
919 ‎‡a sequencepolymorphisminthetrypanosomarangelihsp70codinggenesallowstypingoftheparasitekp1‏ ‎‡A Sequence polymorphism in the Trypanosoma rangeli HSP70 coding genes allows typing of the parasite KP1‏ ‎‡9 1‏
919 ‎‡a sequencepolymorphisminthetrypanosomarangelihsp70codinggenesallowstypingoftheparasitekp1+andkp1groups‏ ‎‡A Sequence polymorphism in the Trypanosoma rangeli HSP70 coding genes allows typing of the parasite KP1(+) and KP1(−) groups‏ ‎‡9 1‏
919 ‎‡a serumproteomeofdogsatsubclinicalandclinicalonsetofcanineleishmaniosis‏ ‎‡A Serum proteome of dogs at subclinical and clinical onset of canine leishmaniosis‏ ‎‡9 1‏
919 ‎‡a shorttermfollowupofchagasicpatientsafterbenzonidazoletreatmentusingmultipleserologicalmarkers‏ ‎‡A Short-term follow-up of chagasic patients after benzonidazole treatment using multiple serological markers.‏ ‎‡9 1‏
919 ‎‡a spf66achemicallysynthesizedsubunitmalariavaccineissafeandimmunogenicintanzaniansexposedtointensemalariatransmission‏ ‎‡A SPf66, a chemically synthesized subunit malaria vaccine, is safe and immunogenic in Tanzanians exposed to intense malaria transmission‏ ‎‡9 1‏
919 ‎‡a studiesontheinteractionbetweenantitrypanosomecisddpanalogswithdna‏ ‎‡A Studies on the interaction between antitrypanosome cis-DDP analogs with dna‏ ‎‡9 1‏
919 ‎‡a antizdnareactivityofzdnaformingsequencesisaffectedbyplatinumantitumordrugs‏ ‎‡A The anti Z-DNA reactivity of Z-DNA forming sequences is affected by platinum antitumor drugs.‏ ‎‡9 1‏
919 ‎‡a biologyandevolutionoftransposableelementsinparasites‏ ‎‡A The biology and evolution of transposable elements in parasites‏ ‎‡9 1‏
919 ‎‡a effectoftemperatureonthestabilityofthesyntheticspf‏ ‎‡A The effect of temperature on the stability of the synthetic SPf‏ ‎‡9 1‏
919 ‎‡a endonucleasenl1tcencodedbythelinel1tcfromtrypanosomacruziprotectsparasitesfromdaunorubicindnadamage‏ ‎‡A The endonuclease NL1Tc encoded by the LINE L1Tc from Trypanosoma cruzi protects parasites from daunorubicin DNA damage.‏ ‎‡9 1‏
919 ‎‡a geneticimmunizationwithparaflagellarrodprotein2fusedtothehsp70confersprotectionagainstlatetrypanosomacruziinfection‏ ‎‡A The genetic immunization with paraflagellar rod protein-2 fused to the HSP70 confers protection against late Trypanosoma cruzi infection‏ ‎‡9 1‏
919 ‎‡a heatshockproteinhsp70bindsinvivotosubregions248bcand358dofthepolytenechromosomesofdrosophilahydei‏ ‎‡A The heat shock protein hsp70 binds in vivo to subregions 2-48BC and 3-58D of the polytene chromosomes of Drosophila hydei.‏ ‎‡9 1‏
919 ‎‡a immunizationofa2k‏ ‎‡A The immunization of A2/K‏ ‎‡9 1‏
919 ‎‡a immunizationofa2kbtransgenicmicewiththekmp11hsp70fusionproteininducesctlresponseagainsthumancellsexpressingthetcruzikmp11antigenidentificationofa2restrictedepitopes‏ ‎‡A The immunization of A2/K(b) transgenic mice with the KMP11-HSP70 fusion protein induces CTL response against human cells expressing the T. cruzi KMP11 antigen: identification of A2-restricted epitopes‏ ‎‡9 1‏
919 ‎‡a innateimmuneresponsestatuscorrelateswithadivergentclinicalcourseincongenitalchagasdiseaseoftwinsborninanonendemiccountry‏ ‎‡A The innate immune response status correlates with a divergent clinical course in congenital Chagas disease of twins born in a non-endemic country.‏ ‎‡9 1‏
919 ‎‡a l1tc100terminaldomainfromtrypanosomacruzinonlongterminalrepeatretrotransposoncodesforaproteinthatbears2c2h2zincfingermotifsandisendowedwithnucleicacidchaperoneactivity‏ ‎‡A The L1Tc C-terminal domain from Trypanosoma cruzi non-long terminal repeat retrotransposon codes for a protein that bears two C2H2 zinc finger motifs and is endowed with nucleic acid chaperone activity.‏ ‎‡9 1‏
919 ‎‡a l1tclonginterspersednucleotideelementfromtrypanosomacruziencodesaproteinwith3phosphataseand3phosphodiesteraseenzymaticactivities‏ ‎‡A The L1Tc, long interspersed nucleotide element from Trypanosoma cruzi, encodes a protein with 3'-phosphatase and 3'-phosphodiesterase enzymatic activities‏ ‎‡9 1‏
919 ‎‡a l1tcnonltrretrotransposonoftrypanosomacruzicontainsaninternalrnapol2dependentpromoterthatstronglyactivatesgenetranscriptionandgeneratesunsplicedtranscripts‏ ‎‡A The L1Tc non-LTR retrotransposon of Trypanosoma cruzi contains an internal RNA-pol II-dependent promoter that strongly activates gene transcription and generates unspliced transcripts.‏ ‎‡9 1‏
919 ‎‡a nonltr‏ ‎‡A The non-LTR‏ ‎‡9 1‏
919 ‎‡a nonltrlongterminalrepeatretrotransposonl1tcfromtrypanosomacruzicodesforaproteinwithrnasehactivity‏ ‎‡A The non-LTR (long terminal repeat) retrotransposon L1Tc from Trypanosoma cruzi codes for a protein with RNase H activity.‏ ‎‡9 1‏
919 ‎‡a openreadingframe1ofthel1tcretrotransposonoftrypanosomacruzicodesforaproteinwithapurinicapyrimidinicnucleaseactivity‏ ‎‡A The open reading frame 1 of the L1Tc retrotransposon of Trypanosoma cruzi codes for a protein with apurinic-apyrimidinic nuclease activity‏ ‎‡9 1‏
919 ‎‡a sider2elementsinterspersedrepeatedsequencesthatpopulatetheleishmaniagenomesconstitutesubfamiliesshowingchromosomalproximityrelationship‏ ‎‡A The SIDER2 elements, interspersed repeated sequences that populate the Leishmania genomes, constitute subfamilies showing chromosomal proximity relationship‏ ‎‡9 1‏
919 ‎‡a stabilityandmaturationoftheh2ahistonemrnasfromtrypanosomacruziareimplicatedintheirposttranscriptionalregulation‏ ‎‡A The stability and maturation of the H2A histone mRNAs from Trypanosoma cruzi are implicated in their post-transcriptional regulation‏ ‎‡9 1‏
919 ‎‡a trypanosomarangelihistoneh2agenesequenceservesasadifferentialmarkerforkp1strains‏ ‎‡A The Trypanosoma rangeli histone H2A gene sequence serves as a differential marker for KP1 strains‏ ‎‡9 1‏
919 ‎‡a trypanosomatidpr77hallmarkcontainsadownstreamcorepromoterelementessentialfortranscriptionactivityofthetrypanosomacruzil1tcretrotransposon‏ ‎‡A The Trypanosomatid Pr77-hallmark contains a downstream core promoter element essential for transcription activity of the Trypanosoma cruzi L1Tc retrotransposon.‏ ‎‡9 1‏
919 ‎‡a wideexpansionofhepatitisdeltaviruslikeribozymesthroughouttrypanosomatidgenomesislinkedtothespreadingofl1tcingiclademobileelements‏ ‎‡A The wide expansion of hepatitis delta virus-like ribozymes throughout trypanosomatid genomes is linked to the spreading of L1Tc/ingi clade mobile elements.‏ ‎‡9 1‏
919 ‎‡a towardtheassessmentoffoodtoxicityforceliacpatientscharacterizationofmonoclonalantibodiestoamainimmunogenicglutenpeptide‏ ‎‡A Toward the assessment of food toxicity for celiac patients: characterization of monoclonal antibodies to a main immunogenic gluten peptide.‏ ‎‡9 1‏
919 ‎‡a towardsaparadigmshiftinthetreatmentofchronicchagasdisease‏ ‎‡A Towards a paradigm shift in the treatment of chronic Chagas disease.‏ ‎‡9 1‏
919 ‎‡a towardsthephysicalmapofthetrypanosomacruzinucleargenomeconstructionofyacandbaclibrariesofthereferenceclonetcruzi150brener‏ ‎‡A Towards the physical map of the Trypanosoma cruzi nuclear genome: construction of YAC and BAC libraries of the reference clone T. cruzi CL-Brener‏ ‎‡9 1‏
919 ‎‡a transcriptionalprofilingofimmunerelatedgenesinleishmaniainfantuminfectedmiceidentificationofpotentialbiomarkersofinfectionandprogressionofdisease‏ ‎‡A Transcriptional Profiling of Immune-Related Genes in Leishmania infantum-Infected Mice: Identification of Potential Biomarkers of Infection and Progression of Disease.‏ ‎‡9 1‏
919 ‎‡a trypanosomacruzigenotypingsupportsacommonsourceofinfectioninaschoolrelatedoraloutbreakofacutechagasdiseaseinvenezuela‏ ‎‡A Trypanosoma cruzi genotyping supports a common source of infection in a school-related oral outbreak of acute Chagas disease in Venezuela.‏ ‎‡9 1‏
919 ‎‡a trypanosomacruziheatshockprotein70kdaaloneorfusedtotheparasitekmp11antigeninducesfunctionalmaturationofmurinedendriticcells‏ ‎‡A Trypanosoma cruzi heat-shock protein-70 kDa,alone or fused to the parasite KMP11 antigen, induces functional maturation of murine dendritic cells‏ ‎‡9 1‏
919 ‎‡a trypanosomacruziparaflagellarrodproteins2and3containimmunodominantcd8‏ ‎‡A Trypanosoma cruzi paraflagellar rod proteins 2 and 3 contain immunodominant CD8‏ ‎‡9 1‏
919 ‎‡a trypanosomacruziparaflagellarrodproteins2and3containimmunodominantcd8+tcellepitopesthatarerecognizedbycytotoxictcellsfromchagasdiseasepatients‏ ‎‡A Trypanosoma cruzi paraflagellar rod proteins 2 and 3 contain immunodominant CD8(+) T-cell epitopes that are recognized by cytotoxic T cells from Chagas disease patients.‏ ‎‡9 1‏
919 ‎‡a zdnaintranscriptionallyactivechromosomes‏ ‎‡A Z-DNA in transcriptionally active chromosomes‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 BNE|XX1671633‏
996 ‎‡2 BNE|XX821983‏
996 ‎‡2 BNC|981058519543106706‏
996 ‎‡2 DNB|1213063973‏
996 ‎‡2 SUDOC|185064949‏
996 ‎‡2 BNE|XX1377291‏
996 ‎‡2 ISNI|0000000078221605‏
996 ‎‡2 NII|DA02449869‏
996 ‎‡2 ISNI|0000000113793482‏
996 ‎‡2 BNE|XX5504137‏
996 ‎‡2 BNC|981058525862406706‏
996 ‎‡2 PTBNP|479278‏
996 ‎‡2 BNF|13337740‏
996 ‎‡2 BNE|XX1728063‏
996 ‎‡2 BNC|981058515212106706‏
996 ‎‡2 LC|no2014160460‏
996 ‎‡2 LC|no2008103837‏
996 ‎‡2 NII|DA17913085‏
996 ‎‡2 BNE|XX1486661‏
996 ‎‡2 LC|no2007051773‏
996 ‎‡2 BNE|XX938683‏
996 ‎‡2 SUDOC|076733564‏
996 ‎‡2 LC|n 79007108‏
996 ‎‡2 ISNI|0000000034791198‏
996 ‎‡2 RERO|A003541271‏
996 ‎‡2 BNC|981058599346906706‏
996 ‎‡2 DNB|170527573‏
996 ‎‡2 BNE|XX825725‏
996 ‎‡2 RERO|A003541275‏
996 ‎‡2 BNE|XX822797‏
996 ‎‡2 BNE|XX1004295‏
996 ‎‡2 BNE|XX1565431‏
996 ‎‡2 BNC|981058612810706706‏
996 ‎‡2 DNB|1057481823‏
996 ‎‡2 BNF|12890363‏
996 ‎‡2 DNB|131595873‏
996 ‎‡2 DE633|pe41019605‏
996 ‎‡2 BNE|XX5017508‏
996 ‎‡2 ARBABN|000046377‏
996 ‎‡2 LC|no2010124205‏
996 ‎‡2 BNE|XX1346340‏
996 ‎‡2 BNE|XX4859417‏
996 ‎‡2 BNE|XX1004686‏
996 ‎‡2 ISNI|0000000049936847‏
996 ‎‡2 DNB|170721086‏
996 ‎‡2 LC|no 97013551‏
996 ‎‡2 SUDOC|250265974‏
996 ‎‡2 ISNI|0000000431687909‏
996 ‎‡2 BNE|XX1044722‏
996 ‎‡2 J9U|987007289312305171‏
996 ‎‡2 ISNI|0000000060989173‏
996 ‎‡2 ISNI|0000000060754147‏
996 ‎‡2 ISNI|0000000066367746‏
996 ‎‡2 BNC|981058513013806706‏
996 ‎‡2 SUDOC|192343149‏
996 ‎‡2 BNE|XX4432086‏
996 ‎‡2 BNE|XX873571‏
996 ‎‡2 BNE|XX1186233‏
996 ‎‡2 BNE|XX1187481‏
996 ‎‡2 ISNI|0000000121455221‏
996 ‎‡2 BNE|XX5820651‏
996 ‎‡2 ISNI|000000037607448X‏
996 ‎‡2 SUDOC|095232699‏
996 ‎‡2 SZ|1057070262‏
996 ‎‡2 BNE|XX991322‏
996 ‎‡2 BNE|XX890130‏
996 ‎‡2 LC|no2011016027‏
996 ‎‡2 RERO|A000195242‏
996 ‎‡2 BNE|XX5142864‏
996 ‎‡2 BNE|XX1732228‏
996 ‎‡2 NKC|jcu2011637677‏
996 ‎‡2 SUDOC|241438454‏
996 ‎‡2 ISNI|0000000059723597‏
996 ‎‡2 DNB|1339105314‏
996 ‎‡2 LC|no 94020361‏
996 ‎‡2 SUDOC|071198946‏
996 ‎‡2 BNE|XX1408847‏
996 ‎‡2 NII|DA0875642X‏
996 ‎‡2 RERO|A003238715‏
996 ‎‡2 BNE|XX1001780‏
996 ‎‡2 DNB|170402045‏
996 ‎‡2 SUDOC|234775653‏
996 ‎‡2 BIBSYS|10028783‏
996 ‎‡2 BNE|XX1156469‏
996 ‎‡2 ISNI|000000042820008X‏
996 ‎‡2 ISNI|0000000114461244‏
996 ‎‡2 CAOONL|ncf10709681‏
996 ‎‡2 BNF|12403378‏
996 ‎‡2 BNC|981058518749806706‏
996 ‎‡2 ISNI|0000000059511981‏
996 ‎‡2 ISNI|0000000431441060‏
996 ‎‡2 BNE|XX1776682‏
996 ‎‡2 BNF|12207944‏
996 ‎‡2 ISNI|0000000060208963‏
996 ‎‡2 LC|no2021075158‏
996 ‎‡2 SUDOC|028434072‏
996 ‎‡2 BNC|981058510139106706‏
996 ‎‡2 LC|nr2004020980‏
996 ‎‡2 ARBABN|000040484‏
996 ‎‡2 BNE|XX1197587‏
996 ‎‡2 BNCHL|10000000000000000119034‏
996 ‎‡2 LC|n 97099854‏
996 ‎‡2 LC|no2006116030‏
996 ‎‡2 DNB|1143551168‏
996 ‎‡2 BNF|12197602‏
996 ‎‡2 BNE|XX1022387‏
996 ‎‡2 CAOONL|ncf11739001‏
996 ‎‡2 CAOONL|ncf11946464‏
996 ‎‡2 LC|no2004047358‏
996 ‎‡2 RERO|A003541278‏
996 ‎‡2 BNF|16696282‏
996 ‎‡2 BNE|XX1752455‏
996 ‎‡2 LC|no2020130294‏
996 ‎‡2 SUDOC|099456400‏
996 ‎‡2 ISNI|0000000501534992‏
996 ‎‡2 SUDOC|132275651‏
996 ‎‡2 NLR|RU NLR AUTH 770214090‏
996 ‎‡2 LC|n 78040700‏
996 ‎‡2 DNB|17290675X‏
996 ‎‡2 DNB|1226784070‏
996 ‎‡2 BNE|XX859144‏
996 ‎‡2 ISNI|0000000061353513‏
996 ‎‡2 BIBSYS|15016802‏
996 ‎‡2 BNE|XX1274302‏
996 ‎‡2 ISNI|0000000079761208‏
996 ‎‡2 DNB|1340471728‏
996 ‎‡2 LC|n 82019381‏
996 ‎‡2 ISNI|0000000060534013‏
996 ‎‡2 BNE|XX1647292‏
996 ‎‡2 BNE|XX1514694‏
996 ‎‡2 ISNI|0000000054820486‏
996 ‎‡2 ISNI|0000000371236208‏
996 ‎‡2 BNE|XX1347329‏
996 ‎‡2 ISNI|0000000059451608‏
996 ‎‡2 RERO|A003113964‏
996 ‎‡2 NUKAT|n 99034506‏
996 ‎‡2 BNE|XX1132550‏
996 ‎‡2 DNB|1056365587‏
996 ‎‡2 ISNI|0000000371970373‏
996 ‎‡2 SUDOC|171668715‏
996 ‎‡2 J9U|987007498603305171‏
996 ‎‡2 BNE|XX944887‏
996 ‎‡2 SUDOC|144448963‏
996 ‎‡2 BNC|981058515076406706‏
996 ‎‡2 LC|ns2016001548‏
996 ‎‡2 BNE|XX5152810‏
996 ‎‡2 LC|n 97049114‏
996 ‎‡2 SUDOC|100464092‏
996 ‎‡2 DNB|118968769‏
996 ‎‡2 ISNI|0000000059203727‏
996 ‎‡2 LC|no2010161006‏
996 ‎‡2 ISNI|0000000080937741‏
996 ‎‡2 LC|nb2015023195‏
996 ‎‡2 BNCHL|10000000000000000007568‏
996 ‎‡2 BNE|XX1281440‏
996 ‎‡2 LC|n 91117918‏
996 ‎‡2 BNC|981059719170906706‏
996 ‎‡2 LC|no2017083090‏
996 ‎‡2 BNE|XX4951506‏
996 ‎‡2 RERO|A012441119‏
996 ‎‡2 BNE|XX5309020‏
996 ‎‡2 LC|n 91119318‏
996 ‎‡2 BLBNB|000596542‏
996 ‎‡2 BNE|XX5842227‏
996 ‎‡2 DNB|1024301702‏
996 ‎‡2 BNF|16247454‏
996 ‎‡2 BNE|XX1075441‏
996 ‎‡2 PTBNP|1341746‏
996 ‎‡2 BNE|XX1710726‏
996 ‎‡2 ISNI|0000000069897048‏
996 ‎‡2 BNE|XX5607332‏
996 ‎‡2 BNE|XX974324‏
996 ‎‡2 ISNI|0000000055157356‏
996 ‎‡2 BNE|XX1160468‏
996 ‎‡2 BNC|981058527075706706‏
996 ‎‡2 ICCU|RAVV072687‏
996 ‎‡2 BNE|XX4713454‏
996 ‎‡2 SUDOC|030247780‏
996 ‎‡2 SUDOC|030591597‏
996 ‎‡2 LC|nr 96044168‏
996 ‎‡2 ISNI|0000000120762713‏
996 ‎‡2 BNCHL|10000000000000000068106‏
996 ‎‡2 ISNI|0000000121394692‏
996 ‎‡2 SUDOC|234895055‏
996 ‎‡2 DNB|1157365973‏
996 ‎‡2 BNE|XX1102139‏
996 ‎‡2 NTA|071370072‏
996 ‎‡2 LC|n 2017036722‏
996 ‎‡2 SUDOC|033136858‏
996 ‎‡2 BNE|XX5301260‏
996 ‎‡2 LC|n 79125823‏
996 ‎‡2 ISNI|0000000059223381‏
996 ‎‡2 BNE|XX1342332‏
996 ‎‡2 SUDOC|225390523‏
996 ‎‡2 LC|n 2008067979‏
996 ‎‡2 BNE|XX1149059‏
996 ‎‡2 BNE|XX5184101‏
996 ‎‡2 ISNI|0000000060405350‏
996 ‎‡2 SUDOC|06026005X‏
996 ‎‡2 SUDOC|185299024‏
996 ‎‡2 BNE|XX1539136‏
996 ‎‡2 PLWABN|9810684322205606‏
996 ‎‡2 LC|no2021154969‏
996 ‎‡2 RERO|A000096210‏
996 ‎‡2 BNF|12168897‏
996 ‎‡2 BNC|981058589163906706‏
996 ‎‡2 ISNI|0000000060526646‏
996 ‎‡2 ISNI|0000000059273477‏
996 ‎‡2 BNE|XX1147798‏
996 ‎‡2 BNE|XX6104070‏
996 ‎‡2 BNE|XX1363809‏
996 ‎‡2 BNE|XX884451‏
996 ‎‡2 ISNI|0000000046702527‏
996 ‎‡2 BNC|981058512880306706‏
996 ‎‡2 ISNI|0000000080553000‏
996 ‎‡2 BNC|981058517364906706‏
996 ‎‡2 BNC|981058601794106706‏
996 ‎‡2 ISNI|0000000059333652‏
996 ‎‡2 LC|no2015157457‏
996 ‎‡2 BNE|XX1414095‏
996 ‎‡2 BNE|XX946287‏
996 ‎‡2 ISNI|0000000051060880‏
996 ‎‡2 BNE|XX4916824‏
996 ‎‡2 BNE|XX1186860‏
996 ‎‡2 LC|no 90006503‏
996 ‎‡2 BNC|981058517548806706‏
996 ‎‡2 RERO|A020115295‏
996 ‎‡2 BNF|17167836‏
996 ‎‡2 BNF|12315798‏
996 ‎‡2 DNB|1122701438‏
996 ‎‡2 NUKAT|n 97006572‏
996 ‎‡2 BNCHL|10000000000000000081166‏
996 ‎‡2 SUDOC|094892903‏
996 ‎‡2 ISNI|0000000060554778‏
996 ‎‡2 LC|no2017081718‏
996 ‎‡2 NTA|098397613‏
996 ‎‡2 BIBSYS|98051231‏
996 ‎‡2 SUDOC|055387896‏
996 ‎‡2 BNC|981058613619606706‏
996 ‎‡2 DNB|1122698143‏
996 ‎‡2 BNE|XX5569009‏
996 ‎‡2 SUDOC|170036138‏
996 ‎‡2 ISNI|0000000434853570‏
996 ‎‡2 DNB|134780388‏
996 ‎‡2 J9U|987007459757805171‏
996 ‎‡2 NYNYRILM|221739‏
996 ‎‡2 BNE|XX1040015‏
996 ‎‡2 NUKAT|n 2016004101‏
996 ‎‡2 BNE|XX1702913‏
996 ‎‡2 BNE|XX6087473‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏