Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q82314427 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241020233042.0 | ||
| 008 | 241020nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q82314427 | ||
| 024 | ‡a 0000-0002-4490-8534 ‡2 orcid | ||
| 035 | ‡a (OCoLC)Q82314427 | ||
| 100 | 0 | ‡a José L Martínez ‡c researcher ‡9 en | |
| 375 | ‡a 1 ‡2 iso5218 | ||
| 400 | 0 | ‡a José L Martínez ‡c wetenschapper ‡9 nl | |
| 670 | ‡a Author's A Physiological Characterization in Controlled Bioreactors Reveals a Novel Survival Strategy for Debaryomyces hansenii at High Salinity | ||
| 670 | ‡a Author's Analysis of a novel calcium auxotrophy in Aspergillus nidulans. | ||
| 670 | ‡a Author's Balanced globin protein expression and heme biosynthesis improve production of human hemoglobin in Saccharomyces cerevisiae. | ||
| 670 | ‡a Author's Correlation of cell growth and heterologous protein production by Saccharomyces cerevisiae. | ||
| 670 | ‡a Author's DebaryOmics: an integrative -omics study to understand the halophilic behaviour of Debaryomyces hansenii | ||
| 670 | ‡a Author's Engineering the oxygen sensing regulation results in an enhanced recombinant human hemoglobin production by Saccharomyces cerevisiae. | ||
| 670 | ‡a Author's Gcn4p and the Crabtree effect of yeast: drawing the causal model of the Crabtree effect in Saccharomyces cerevisiae and explaining evolutionary trade-offs of adaptation to galactose through systems biology | ||
| 670 | ‡a Author's Heme metabolism in stress regulation and protein production: From Cinderella to a key player | ||
| 670 | ‡a Author's Lack of main K+ uptake systems in Saccharomyces cerevisiae cells affects yeast performance in both potassium-sufficient and potassium-limiting conditions. | ||
| 670 | ‡a Author's Monovalent cations regulate expression and activity of the Hak1 potassium transporter in Debaryomyces hansenii | ||
| 670 | ‡a Author's Oxidative stress sensitivity in Debaryomyces hansenii. | ||
| 670 | ‡a Author's Proteomic changes in response to potassium starvation in the extremophilic yeast Debaryomyces hansenii | ||
| 670 | ‡a Author's Ref2, a regulatory subunit of the yeast protein phosphatase 1, is a novel component of cation homoeostasis | ||
| 670 | ‡a Author's Salt and oxidative stress tolerance in Debaryomyces hansenii and Debaryomyces fabryi | ||
| 909 | ‡a (orcid) 0000000244908534 ‡9 1 | ||
| 919 | ‡a hememetabolisminstressregulationandproteinproductionfromcinderellatoakeyplayer ‡A Heme metabolism in stress regulation and protein production: From Cinderella to a key player ‡9 1 | ||
| 919 | ‡a oxidativestresssensitivityindebaryomyceshansenii ‡A Oxidative stress sensitivity in Debaryomyces hansenii. ‡9 1 | ||
| 919 | ‡a physiologicalcharacterizationincontrolledbioreactorsrevealsanovelsurvivalstrategyfordebaryomyceshanseniiathighsalinity ‡A A Physiological Characterization in Controlled Bioreactors Reveals a Novel Survival Strategy for Debaryomyces hansenii at High Salinity ‡9 1 | ||
| 919 | ‡a saltandoxidativestresstoleranceindebaryomyceshanseniianddebaryomycesfabryi ‡A Salt and oxidative stress tolerance in Debaryomyces hansenii and Debaryomyces fabryi ‡9 1 | ||
| 919 | ‡a ref2aregulatorysubunitoftheyeastproteinphosphatase1isanovelcomponentofcationhomoeostasis ‡A Ref2, a regulatory subunit of the yeast protein phosphatase 1, is a novel component of cation homoeostasis ‡9 1 | ||
| 919 | ‡a gcn4pandthecrabtreeeffectofyeastdrawingthecausalmodelofthecrabtreeeffectinsaccharomycescerevisiaeandexplainingevolutionarytradeoffsofadaptationtogalactosethroughsystemsbiology ‡A Gcn4p and the Crabtree effect of yeast: drawing the causal model of the Crabtree effect in Saccharomyces cerevisiae and explaining evolutionary trade-offs of adaptation to galactose through systems biology ‡9 1 | ||
| 919 | ‡a lackofmaink+uptakesystemsinsaccharomycescerevisiaecellsaffectsyeastperformanceinbothpotassiumsufficientandpotassiumlimitingconditions ‡A Lack of main K+ uptake systems in Saccharomyces cerevisiae cells affects yeast performance in both potassium-sufficient and potassium-limiting conditions. ‡9 1 | ||
| 919 | ‡a engineeringtheoxygensensingregulationresultsinanenhancedrecombinanthumanhemoglobinproductionbysaccharomycescerevisiae ‡A Engineering the oxygen sensing regulation results in an enhanced recombinant human hemoglobin production by Saccharomyces cerevisiae. ‡9 1 | ||
| 919 | ‡a balancedglobinproteinexpressionandhemebiosynthesisimproveproductionofhumanhemoglobininsaccharomycescerevisiae ‡A Balanced globin protein expression and heme biosynthesis improve production of human hemoglobin in Saccharomyces cerevisiae. ‡9 1 | ||
| 919 | ‡a debaryomicsanintegrativeomicsstudytounderstandthehalophilicbehaviourofdebaryomyceshansenii ‡A DebaryOmics: an integrative -omics study to understand the halophilic behaviour of Debaryomyces hansenii ‡9 1 | ||
| 919 | ‡a correlationofcellgrowthandheterologousproteinproductionbysaccharomycescerevisiae ‡A Correlation of cell growth and heterologous protein production by Saccharomyces cerevisiae. ‡9 1 | ||
| 919 | ‡a proteomicchangesinresponsetopotassiumstarvationintheextremophilicyeastdebaryomyceshansenii ‡A Proteomic changes in response to potassium starvation in the extremophilic yeast Debaryomyces hansenii ‡9 1 | ||
| 919 | ‡a analysisofanovelcalciumauxotrophyinaspergillusnidulans ‡A Analysis of a novel calcium auxotrophy in Aspergillus nidulans. ‡9 1 | ||
| 919 | ‡a monovalentcationsregulateexpressionandactivityofthehak1potassiumtransporterindebaryomyceshansenii ‡A Monovalent cations regulate expression and activity of the Hak1 potassium transporter in Debaryomyces hansenii ‡9 1 | ||
| 946 | ‡a b ‡9 1 | ||
| 996 | ‡2 CAOONL|ncf10725760 | ||
| 996 | ‡2 BNE|XX1169360 | ||
| 996 | ‡2 BNE|XX1240983 | ||
| 996 | ‡2 BNE|XX1678817 | ||
| 996 | ‡2 SUDOC|262920077 | ||
| 996 | ‡2 ISNI|0000000120723044 | ||
| 996 | ‡2 LC|n 80164418 | ||
| 996 | ‡2 RERO|A022266665 | ||
| 996 | ‡2 CAOONL|ncf10508896 | ||
| 996 | ‡2 ISNI|0000000059263084 | ||
| 996 | ‡2 ISNI|0000000059468936 | ||
| 996 | ‡2 SUDOC|186141300 | ||
| 996 | ‡2 BNC|981058522584106706 | ||
| 996 | ‡2 ISNI|0000000059409194 | ||
| 996 | ‡2 PTBNP|1841812 | ||
| 996 | ‡2 LC|n 2010077968 | ||
| 996 | ‡2 NSK|000178731 | ||
| 996 | ‡2 LC|n 93080350 | ||
| 996 | ‡2 BNE|XX1177196 | ||
| 996 | ‡2 LC|no2003114421 | ||
| 996 | ‡2 DNB|1161959602 | ||
| 996 | ‡2 BNE|XX1021023 | ||
| 996 | ‡2 ISNI|0000000059275739 | ||
| 996 | ‡2 SUDOC|128214511 | ||
| 996 | ‡2 ISNI|0000000059459247 | ||
| 996 | ‡2 BNE|XX857542 | ||
| 996 | ‡2 SUDOC|03300255X | ||
| 996 | ‡2 BNE|XX1736133 | ||
| 996 | ‡2 ISNI|0000000037144471 | ||
| 996 | ‡2 BNE|XX1074446 | ||
| 996 | ‡2 NUKAT|n 2007147618 | ||
| 996 | ‡2 BNC|981058514883606706 | ||
| 996 | ‡2 SUDOC|179417401 | ||
| 996 | ‡2 SUDOC|268590923 | ||
| 996 | ‡2 BNE|XX905858 | ||
| 996 | ‡2 BNF|17726812 | ||
| 996 | ‡2 NTA|298569043 | ||
| 996 | ‡2 ISNI|0000000078274061 | ||
| 996 | ‡2 SUDOC|241968402 | ||
| 996 | ‡2 BNE|XX906146 | ||
| 996 | ‡2 NII|DA13129586 | ||
| 996 | ‡2 DNB|1286434378 | ||
| 996 | ‡2 BNF|14613940 | ||
| 996 | ‡2 BNE|XX931395 | ||
| 996 | ‡2 BNE|XX5376527 | ||
| 996 | ‡2 BNF|16715028 | ||
| 996 | ‡2 J9U|987007400175905171 | ||
| 996 | ‡2 DNB|1157058809 | ||
| 996 | ‡2 BNE|XX1118809 | ||
| 996 | ‡2 BNF|16253402 | ||
| 996 | ‡2 LC|n 00044023 | ||
| 996 | ‡2 BNE|XX930738 | ||
| 996 | ‡2 LC|ns2015003013 | ||
| 996 | ‡2 ISNI|0000000078239338 | ||
| 996 | ‡2 ISNI|0000000117511825 | ||
| 996 | ‡2 BNE|XX1019830 | ||
| 996 | ‡2 LC|no2009174023 | ||
| 996 | ‡2 SUDOC|032068670 | ||
| 996 | ‡2 BNE|XX1170383 | ||
| 996 | ‡2 BNC|981058529939106706 | ||
| 996 | ‡2 ISNI|0000000357292369 | ||
| 996 | ‡2 ISNI|0000000119927787 | ||
| 996 | ‡2 BNE|XX4660253 | ||
| 996 | ‡2 CAOONL|ncf11946421 | ||
| 996 | ‡2 ISNI|0000000079143207 | ||
| 996 | ‡2 ISNI|0000000045997992 | ||
| 996 | ‡2 LC|n 83033399 | ||
| 996 | ‡2 LC|no2001001642 | ||
| 996 | ‡2 LC|nr 88010765 | ||
| 996 | ‡2 DNB|141523581 | ||
| 996 | ‡2 BNE|XX5451149 | ||
| 996 | ‡2 LC|n 2011021021 | ||
| 996 | ‡2 BNE|XX1305878 | ||
| 996 | ‡2 J9U|987007371756705171 | ||
| 996 | ‡2 NKC|mub2013785085 | ||
| 996 | ‡2 DNB|137954999 | ||
| 996 | ‡2 BNE|XX1098817 | ||
| 996 | ‡2 ISNI|0000000054499178 | ||
| 996 | ‡2 SUDOC|098992015 | ||
| 996 | ‡2 ISNI|0000000116382718 | ||
| 996 | ‡2 LC|no2010137597 | ||
| 996 | ‡2 BNE|XX821540 | ||
| 996 | ‡2 BNE|XX1363322 | ||
| 996 | ‡2 PLWABN|9811496432105606 | ||
| 996 | ‡2 BNF|14612120 | ||
| 996 | ‡2 BNE|XX1040082 | ||
| 996 | ‡2 LC|n 82152776 | ||
| 996 | ‡2 LC|n 82152770 | ||
| 996 | ‡2 BNE|XX1113654 | ||
| 996 | ‡2 ISNI|0000000060073181 | ||
| 996 | ‡2 BLBNB|000444394 | ||
| 996 | ‡2 BIBSYS|15017899 | ||
| 996 | ‡2 RERO|A000072061 | ||
| 996 | ‡2 XA|8916 | ||
| 996 | ‡2 SUDOC|232637822 | ||
| 996 | ‡2 BNE|XX855764 | ||
| 996 | ‡2 SUDOC|083279784 | ||
| 996 | ‡2 BNE|XX1020692 | ||
| 996 | ‡2 BNC|981058611186906706 | ||
| 996 | ‡2 LC|n 2004032812 | ||
| 996 | ‡2 BNE|XX1620909 | ||
| 996 | ‡2 BNE|XX6436549 | ||
| 996 | ‡2 BNC|981058511939406706 | ||
| 996 | ‡2 BNE|XX991398 | ||
| 996 | ‡2 NLA|000035331579 | ||
| 996 | ‡2 ISNI|000000004545033X | ||
| 996 | ‡2 DBC|87097991514540 | ||
| 996 | ‡2 LC|no2006094225 | ||
| 996 | ‡2 BNF|16668677 | ||
| 996 | ‡2 BNE|XX1195454 | ||
| 996 | ‡2 ISNI|0000000116559915 | ||
| 996 | ‡2 BNE|XX1098881 | ||
| 996 | ‡2 BNE|XX879396 | ||
| 996 | ‡2 ISNI|0000000079775757 | ||
| 996 | ‡2 LC|no2014158489 | ||
| 996 | ‡2 BNCHL|10000000000000000011586 | ||
| 996 | ‡2 BNE|XX1712765 | ||
| 996 | ‡2 ISNI|0000000047244679 | ||
| 996 | ‡2 SUDOC|082084076 | ||
| 996 | ‡2 SUDOC|11009347X | ||
| 996 | ‡2 BNC|981058516396506706 | ||
| 996 | ‡2 BNC|981060913879006706 | ||
| 996 | ‡2 BNF|17016228 | ||
| 996 | ‡2 DNB|11925042X | ||
| 996 | ‡2 BNE|XX1062166 | ||
| 996 | ‡2 LC|nr2004021638 | ||
| 996 | ‡2 RERO|A018645309 | ||
| 996 | ‡2 BNC|981058525635706706 | ||
| 996 | ‡2 NUKAT|n 2015226235 | ||
| 996 | ‡2 BLBNB|001573958 | ||
| 996 | ‡2 CAOONL|ncf11422384 | ||
| 996 | ‡2 LC|no2010132940 | ||
| 996 | ‡2 LC|no 96058865 | ||
| 996 | ‡2 BNE|XX4615587 | ||
| 996 | ‡2 SUDOC|080233392 | ||
| 996 | ‡2 PTBNP|1705908 | ||
| 996 | ‡2 ISNI|0000000059626842 | ||
| 996 | ‡2 BNE|XX875044 | ||
| 996 | ‡2 DNB|129602663 | ||
| 996 | ‡2 BNC|981058524682406706 | ||
| 996 | ‡2 LC|ns2019000800 | ||
| 996 | ‡2 BIBSYS|12073237 | ||
| 996 | ‡2 ISNI|0000000428339356 | ||
| 996 | ‡2 BNE|XX960348 | ||
| 996 | ‡2 DNB|13340336X | ||
| 996 | ‡2 BNF|12316910 | ||
| 996 | ‡2 BNE|XX827815 | ||
| 996 | ‡2 BNE|XX1058913 | ||
| 996 | ‡2 ISNI|0000000113286085 | ||
| 996 | ‡2 BNE|XX1761594 | ||
| 996 | ‡2 NTA|128401974 | ||
| 996 | ‡2 SUDOC|167012371 | ||
| 996 | ‡2 BNE|XX849283 | ||
| 996 | ‡2 LC|no2008174348 | ||
| 996 | ‡2 ISNI|0000000052854199 | ||
| 996 | ‡2 DNB|1056292261 | ||
| 996 | ‡2 BNE|XX909538 | ||
| 996 | ‡2 BNF|16000748 | ||
| 996 | ‡2 ISNI|000000011579717X | ||
| 996 | ‡2 BNE|XX1645135 | ||
| 996 | ‡2 SUDOC|08965353X | ||
| 996 | ‡2 BNF|18046459 | ||
| 996 | ‡2 LC|no2013042732 | ||
| 996 | ‡2 NTA|173012299 | ||
| 996 | ‡2 J9U|987007394282105171 | ||
| 996 | ‡2 LC|nr 93023484 | ||
| 996 | ‡2 BNE|XX1102253 | ||
| 996 | ‡2 BNE|XX1107374 | ||
| 996 | ‡2 BNE|XX1023389 | ||
| 996 | ‡2 BNE|XX1364729 | ||
| 996 | ‡2 BIBSYS|90697269 | ||
| 996 | ‡2 BNE|XX1702404 | ||
| 996 | ‡2 ISNI|000000006041760X | ||
| 996 | ‡2 BNCHL|10000000000000000114110 | ||
| 996 | ‡2 BNE|XX1039326 | ||
| 996 | ‡2 BNE|XX5144072 | ||
| 996 | ‡2 LC|nb2015013855 | ||
| 996 | ‡2 BNC|981058521940406706 | ||
| 996 | ‡2 LC|no2008149057 | ||
| 996 | ‡2 BNC|981058513774206706 | ||
| 996 | ‡2 ISNI|0000000059684022 | ||
| 996 | ‡2 BNC|981061137376106706 | ||
| 996 | ‡2 J9U|987007445356805171 | ||
| 996 | ‡2 BNE|XX1267407 | ||
| 996 | ‡2 DNB|1057367060 | ||
| 996 | ‡2 SUDOC|26427556X | ||
| 996 | ‡2 PLWABN|9810693348905606 | ||
| 996 | ‡2 BNC|981058511081706706 | ||
| 996 | ‡2 ISNI|0000000059512968 | ||
| 996 | ‡2 BNE|XX892221 | ||
| 996 | ‡2 LC|no2009153130 | ||
| 996 | ‡2 BLBNB|000526073 | ||
| 996 | ‡2 RERO|A018802662 | ||
| 996 | ‡2 RERO|A025747559 | ||
| 996 | ‡2 LC|n 2013059063 | ||
| 996 | ‡2 BNE|XX1738063 | ||
| 996 | ‡2 LC|no2010174119 | ||
| 996 | ‡2 BNE|XX1730072 | ||
| 996 | ‡2 ISNI|0000000059416458 | ||
| 996 | ‡2 ISNI|0000000059922545 | ||
| 996 | ‡2 BLBNB|000220412 | ||
| 996 | ‡2 LC|n 84077572 | ||
| 996 | ‡2 SUDOC|169789926 | ||
| 996 | ‡2 CAOONL|ncf10675240 | ||
| 996 | ‡2 ISNI|0000000448051229 | ||
| 996 | ‡2 ISNI|000000006144743X | ||
| 996 | ‡2 BIBSYS|90594952 | ||
| 996 | ‡2 ISNI|0000000109172042 | ||
| 996 | ‡2 ISNI|0000000116351954 | ||
| 996 | ‡2 BNE|XX4863807 | ||
| 996 | ‡2 NYNYRILM|155803 | ||
| 996 | ‡2 ISNI|0000000118873895 | ||
| 996 | ‡2 ISNI|0000000114886496 | ||
| 996 | ‡2 LC|n 2004088368 | ||
| 996 | ‡2 ISNI|0000000118661825 | ||
| 996 | ‡2 BNE|XX871816 | ||
| 996 | ‡2 SUDOC|23374455X | ||
| 996 | ‡2 ISNI|0000000059319017 | ||
| 996 | ‡2 LC|n 50053385 | ||
| 996 | ‡2 BNF|15050815 | ||
| 996 | ‡2 SUDOC|078695651 | ||
| 996 | ‡2 ISNI|0000000038243383 | ||
| 996 | ‡2 BNE|XX1703628 | ||
| 996 | ‡2 DNB|115726431X | ||
| 996 | ‡2 NUKAT|n 2012067284 | ||
| 996 | ‡2 SUDOC|103190082 | ||
| 996 | ‡2 SUDOC|184596947 | ||
| 996 | ‡2 BNE|XX5471613 | ||
| 996 | ‡2 LC|n 88056199 | ||
| 996 | ‡2 ISNI|0000000120908583 | ||
| 996 | ‡2 J9U|987007383000105171 | ||
| 996 | ‡2 BNE|XX893268 | ||
| 996 | ‡2 LC|no2010142382 | ||
| 996 | ‡2 DNB|1157143040 | ||
| 996 | ‡2 BNF|11991105 | ||
| 996 | ‡2 ISNI|0000000047197200 | ||
| 996 | ‡2 BNE|XX822394 | ||
| 996 | ‡2 BNE|XX5851506 | ||
| 996 | ‡2 DNB|172654920 | ||
| 996 | ‡2 BNE|XX1648629 | ||
| 996 | ‡2 BNE|XX1109029 | ||
| 996 | ‡2 BNE|XX1030151 | ||
| 996 | ‡2 DNB|1057415936 | ||
| 996 | ‡2 BNC|981058516285606706 | ||
| 996 | ‡2 BNE|XX943137 | ||
| 996 | ‡2 LC|n 84168774 | ||
| 996 | ‡2 BNF|13975666 | ||
| 996 | ‡2 LC|no2004117338 | ||
| 996 | ‡2 BNE|XX957452 | ||
| 996 | ‡2 SUDOC|130279099 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 |
