VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q37376402  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000144.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q37376402‏
024 ‎‡a  0000-0001-8001-2914‏ ‎‡2  orcid‏
024 ‎‡a  55382670400‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q37376402‏
046 ‎‡s  19000000‏
100 0 ‎‡a  Ry Young‏ ‎‡9  sl‏
400 0 ‎‡a  Ry Young‏ ‎‡c  researcher‏ ‎‡9  en‏
400 0 ‎‡a  Ry Young‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
400 0 ‎‡a  Ry Young‏ ‎‡c  investigador/a‏ ‎‡9  es‏
400 0 ‎‡a  Ry Young‏ ‎‡c  investigador‏ ‎‡9  ast‏
670 ‎‡a  Author's 2004 ASM Conference on the New Phage Biology: the 'Phage Summit'‏
670 ‎‡a  Author's A(2) expression and assembly regulates lysis in Qβ infections‏
670 ‎‡a  Author's A Broad-Host-Range Tailocin from Burkholderia cenocepacia.‏
670 ‎‡a  Author's A dominant mutation in the bacteriophage lambda S gene causes premature lysis and an absolute defective plating phenotype‏
670 ‎‡a  Author's A protein antibiotic in the phage Qbeta virion: diversity in lysis targets‏
670 ‎‡a  Author's A viral protein antibiotic inhibits lipid II flippase activity‏
670 ‎‡a  Author's Active Bax and Bak are functional holins‏
670 ‎‡a  Author's An ancient player unmasked: T4 rI encodes a t-specific antiholin.‏
670 ‎‡a  Author's An apparatus for rapid sampling of growing cell cultures‏
670 ‎‡a  Author's Asymmetric binding of membrane proteins to GroEL.‏
670 ‎‡a  Author's Asymmetric cryo-EM structure of the canonical Allolevivirus Qβ reveals a single maturation protein and the genomic ssRNA in situ.‏
670 ‎‡a  Author's Bacteriophage application restores ethanol fermentation characteristics disrupted by Lactobacillus fermentum.‏
670 ‎‡a  Author's Bacteriophages of wastewater foaming-associated filamentous Gordonia reduce host levels in raw activated sludge‏
670 ‎‡a  Author's Biochemical and genetic evidence for three transmembrane domains in the class I holin, lambda S.‏
670 ‎‡a  Author's Burkholderia cenocepacia phage BcepMu and a family of Mu-like phages encoding potential pathogenesis factors‏
670 ‎‡a  Author's Cell lysis by induction of cloned lambda lysis genes‏
670 ‎‡a  Author's Characterization of a Novel Tectivirus Phage Toil and Its Potential as an Agent for Biolipid Extraction.‏
670 ‎‡a  Author's Characterization of novel virulent broad-host-range phages of Xylella fastidiosa and Xanthomonas‏
670 ‎‡a  Author's Characterization of plasmids with antimicrobial resistant genes in Pasteurella haemolytica A1.‏
670 ‎‡a  Author's Characterization of the dual start motif of a class II holin gene.‏
670 ‎‡a  Author's Cloning, sequencing and expression of a Pasteurella haemolytica A1 gene encoding a PurK-like protein‏
670 ‎‡a  Author's Complementation and characterization of the nested Rz and Rz1 reading frames in the genome of bacteriophage lambda‏
670 ‎‡a  Author's Control of Pierce's Disease by Phage‏
670 ‎‡a  Author's Development and use of personalized bacteriophage-based therapeutic cocktails to treat a patient with a disseminated resistant Acinetobacter baumannii infection‏
670 ‎‡a  Author's Dimerization between the holin and holin inhibitor of phage lambda‏
670 ‎‡a  Author's Divergence and mosaicism among virulent soil phages of the Burkholderia cepacia complex‏
670 ‎‡a  Author's Dominance in lambda S mutations and evidence for translational control‏
670 ‎‡a  Author's Evolutionary dominance of holin lysis systems derives from superior genetic malleability.‏
670 ‎‡a  Author's Fluorescent Nanodiamond-bacteriophage Conjugates Maintain Host Specificity.‏
670 ‎‡a  Author's Functional analysis of a class I holin, P2 Y.‏
670 ‎‡a  Author's Functional bacteriorhodopsin is efficiently solubilized and delivered to membranes by the chaperonin GroEL‏
670 ‎‡a  Author's Galaxy and Apollo as a biologist-friendly interface for high-quality cooperative phage genome annotation‏
670 ‎‡a  Author's Genetic analysis of MraY inhibition by the phiX174 protein E‏
670 ‎‡a  Author's Genetic Analysis of the Lambda Spanins Rz and Rz1: Identification of Functional Domains.‏
670 ‎‡a  Author's Genetic and biochemical analysis of dimer and oligomer interactions of the lambda S holin‏
670 ‎‡a  Author's Genetic dissection of T4 lysis.‏
670 ‎‡a  Author's Genomes and characterization of phages Bcep22 and BcepIL02, founders of a novel phage type in Burkholderia cenocepacia‏
670 ‎‡a  Author's Genomic and Biochemical Characterization of Acinetobacter Podophage Petty Reveals a Novel Lysis Mechanism and Tail-Associated Depolymerase Activity.‏
670 ‎‡a  Author's Genomic and biological analysis of phage Xfas53 and related prophages of Xylella fastidiosa‏
670 ‎‡a  Author's Genomic and functional analyses of Rhodococcus equi phages ReqiPepy6, ReqiPoco6, ReqiPine5, and ReqiDocB7.‏
670 ‎‡a  Author's Genomic and proteomic features of mycobacteriophage SWU1 isolated from China soil‏
670 ‎‡a  Author's Holins kill without warning‏
670 ‎‡a  Author's Holins: the protein clocks of bacteriophage infections‏
670 ‎‡a  Author's Inhibitory mechanism of the Qβ lysis protein A2.‏
670 ‎‡a  Author's Kinetics of Tn5 transposition‏
670 ‎‡a  Author's Macromolecular composition of bacteria.‏
670 ‎‡a  Author's Mapping the pinhole formation pathway of S21‏
670 ‎‡a  Author's Membrane fusion during phage lysis.‏
670 ‎‡a  Author's MICROBIOLOGY. Phage therapy redux--What is to be done?‏
670 ‎‡a  Author's Molecular genetics of bacteria and phages, 2001.‏
670 ‎‡a  Author's MS2 Lysis of Escherichia coli Depends on Host Chaperone DnaJ.‏
670 ‎‡a  Author's Mutational analysis of the MS2 lysis protein L.‏
670 ‎‡a  Author's Mutational analysis of the S21 pinholin‏
670 ‎‡a  Author's P2 growth restriction on an rpoC mutant is suppressed by alleles of the Rz1 homolog lysC.‏
670 ‎‡a  Author's Phage lysis: do we have the hole story yet?‏
670 ‎‡a  Author's Phage Lysis: Multiple Genes for Multiple Barriers‏
670 ‎‡a  Author's Phage lysis: three steps, three choices, one outcome‏
670 ‎‡a  Author's Phage single-gene lysis: Finding the weak spot in the bacterial cell wall‏
670 ‎‡a  Author's Phage spanins: diversity, topological dynamics and gene convergence‏
670 ‎‡a  Author's Phages will out: strategies of host cell lysis‏
670 ‎‡a  Author's Phi X174 lysis requires slyD, a host gene which is related to the FKBP family of peptidyl-prolyl cis-trans isomerases.‏
670 ‎‡a  Author's Plasmid expression vector using the lambda late promoter‏
670 ‎‡a  Author's Probing the structure of the S105 hole‏
670 ‎‡a  Author's Protein determinants of phage T4 lysis inhibition.‏
670 ‎‡a  Author's Purification and functional characterization of phiX174 lysis protein E.‏
670 ‎‡a  Author's Rapid de novo evolution of lysis genes in single-stranded RNA phages‏
670 ‎‡a  Author's Regulation of a phage endolysin by disulfide caging‏
670 ‎‡a  Author's Relation between growth and replication in bacteria‏
670 ‎‡a  Author's Role of phages in the pathogenesis of Burkholderia, or 'Where are the toxin genes in Burkholderia phages?'.‏
670 ‎‡a  Author's Rz/Rz1 lysis gene equivalents in phages of Gram-negative hosts.‏
670 ‎‡a  Author's Separable domains define target cell specificities of an RTX hemolysin from Actinobacillus pleuropneumoniae‏
670 ‎‡a  Author's Sizing the holin lesion with an endolysin-beta-galactosidase fusion‏
670 ‎‡a  Author's Solubilization and delivery by GroEL of megadalton complexes of the lambda holin‏
670 ‎‡a  Author's Spanin function requires subunit homodimerization through intermolecular disulfide bonds‏
670 ‎‡a  Author's ssRNA phage penetration triggers detachment of the F-pilus‏
670 ‎‡a  Author's Stable micron-scale holes are a general feature of canonical holins‏
670 ‎‡a  Author's Structures of Qβ virions, virus-like particles, and the Qβ-MurA complex reveal internal coat proteins and the mechanism of host lysis.‏
670 ‎‡a  Author's Suppressor Analysis of the Fusogenic Lambda Spanins.‏
670 ‎‡a  Author's Synthesis of two bacteriophage lambda S proteins in an in vivo system‏
670 ‎‡a  Author's The Caulobacter crescentus phage phiCbK: genomics of a canonical phage‏
670 ‎‡a  Author's The Escherichia coli FKBP-type PPIase SlyD is required for the stabilization of the E lysis protein of bacteriophage phi X174.‏
670 ‎‡a  Author's The essential Escherichia coli apolipoprotein N-acyltransferase‏
670 ‎‡a  Author's The essential Escherichia coli apolipoprotein N-acyltransferase (Lnt) exists as an extracytoplasmic thioester acyl-enzyme intermediate‏
670 ‎‡a  Author's The Global Reciprocal Reprogramming between Mycobacteriophage SWU1 and Mycobacterium Reveals the Molecular Strategy of Subversion and Promotion of Phage Infection‏
670 ‎‡a  Author's The holin of bacteriophage lambda forms rings with large diameter‏
670 ‎‡a  Author's The Last r Locus Unveiled: T4 RIII Is a Cytoplasmic Antiholin.‏
670 ‎‡a  Author's The lysis protein E of phi X174 is a specific inhibitor of the MraY-catalyzed step in peptidoglycan synthesis.‏
670 ‎‡a  Author's The multicomponent antirestriction system of phage P1 is linked to capsid morphogenesis.‏
670 ‎‡a  Author's The N-terminal transmembrane domain of lambda S is required for holin but not antiholin function‏
670 ‎‡a  Author's The pinholin of lambdoid phage 21: control of lysis by membrane depolarization.‏
670 ‎‡a  Author's The spanin complex is essential for lambda lysis‏
670 ‎‡a  Author's The T4 RI antiholin has an N-terminal signal anchor release domain that targets it for degradation by DegP.‏
670 ‎‡a  Author's Thiol protection in membrane protein purifications: a study with phage holins‏
670 ‎‡a  Author's Transposition mutagenesis of bacteriophage lambda: a new gene affecting cell lysis‏
670 ‎‡a  Author's Transposition of the kanamycin-resistance transposon Tn903.‏
670 ‎‡a  Author's Visualization of pinholin lesions in vivo.‏
909 ‎‡a  (orcid) 0000000180012914‏ ‎‡9  1‏
909 ‎‡a  (scopus) 55382670400‏ ‎‡9  1‏
919 ‎‡a  2expressionandassemblyregulateslysisinqβinfections‏ ‎‡A  A(2) expression and assembly regulates lysis in Qβ infections‏ ‎‡9  1‏
919 ‎‡a  2004asmconferenceonthenewphagebiologythephagesummit‏ ‎‡A  2004 ASM Conference on the New Phage Biology: the 'Phage Summit'‏ ‎‡9  1‏
919 ‎‡a  visualizationofpinholinlesionsinvivo‏ ‎‡A  Visualization of pinholin lesions in vivo.‏ ‎‡9  1‏
919 ‎‡a  transpositionofthekanamycinresistancetransposontn903‏ ‎‡A  Transposition of the kanamycin-resistance transposon Tn903.‏ ‎‡9  1‏
919 ‎‡a  transpositionmutagenesisofbacteriophagelambdaanewgeneaffectingcelllysis‏ ‎‡A  Transposition mutagenesis of bacteriophage lambda: a new gene affecting cell lysis‏ ‎‡9  1‏
919 ‎‡a  thiolprotectioninmembraneproteinpurificationsastudywithphageholins‏ ‎‡A  Thiol protection in membrane protein purifications: a study with phage holins‏ ‎‡9  1‏
919 ‎‡a  t4riantiholinhasannterminalsignalanchorreleasedomainthattargetsitfordegradationbydegp‏ ‎‡A  The T4 RI antiholin has an N-terminal signal anchor release domain that targets it for degradation by DegP.‏ ‎‡9  1‏
919 ‎‡a  spanincomplexisessentialforlambdalysis‏ ‎‡A  The spanin complex is essential for lambda lysis‏ ‎‡9  1‏
919 ‎‡a  pinholinoflambdoidphage21controloflysisbymembranedepolarization‏ ‎‡A  The pinholin of lambdoid phage 21: control of lysis by membrane depolarization.‏ ‎‡9  1‏
919 ‎‡a  nterminaltransmembranedomainoflambdasisrequiredforholinbutnotantiholinfunction‏ ‎‡A  The N-terminal transmembrane domain of lambda S is required for holin but not antiholin function‏ ‎‡9  1‏
919 ‎‡a  multicomponentantirestrictionsystemofphagep1islinkedtocapsidmorphogenesis‏ ‎‡A  The multicomponent antirestriction system of phage P1 is linked to capsid morphogenesis.‏ ‎‡9  1‏
919 ‎‡a  lysisproteineofphix174isaspecificinhibitorofthemraycatalyzedstepinpeptidoglycansynthesis‏ ‎‡A  The lysis protein E of phi X174 is a specific inhibitor of the MraY-catalyzed step in peptidoglycan synthesis.‏ ‎‡9  1‏
919 ‎‡a  lastrlocusunveiledt4riiiisacytoplasmicantiholin‏ ‎‡A  The Last r Locus Unveiled: T4 RIII Is a Cytoplasmic Antiholin.‏ ‎‡9  1‏
919 ‎‡a  holinofbacteriophagelambdaformsringswithlargediameter‏ ‎‡A  The holin of bacteriophage lambda forms rings with large diameter‏ ‎‡9  1‏
919 ‎‡a  globalreciprocalreprogrammingbetweenmycobacteriophageswu1andmycobacteriumrevealsthemolecularstrategyofsubversionandpromotionofphageinfection‏ ‎‡A  The Global Reciprocal Reprogramming between Mycobacteriophage SWU1 and Mycobacterium Reveals the Molecular Strategy of Subversion and Promotion of Phage Infection‏ ‎‡9  1‏
919 ‎‡a  essentialescherichiacoliapolipoproteinnacyltransferaselntexistsasanextracytoplasmicthioesteracylenzymeintermediate‏ ‎‡A  The essential Escherichia coli apolipoprotein N-acyltransferase (Lnt) exists as an extracytoplasmic thioester acyl-enzyme intermediate‏ ‎‡9  1‏
919 ‎‡a  essentialescherichiacoliapolipoproteinnacyltransferase‏ ‎‡A  The essential Escherichia coli apolipoprotein N-acyltransferase‏ ‎‡9  1‏
919 ‎‡a  escherichiacolifkbptypeppiaseslydisrequiredforthestabilizationoftheelysisproteinofbacteriophagephix174‏ ‎‡A  The Escherichia coli FKBP-type PPIase SlyD is required for the stabilization of the E lysis protein of bacteriophage phi X174.‏ ‎‡9  1‏
919 ‎‡a  caulobactercrescentusphagephicbkgenomicsofacanonicalphage‏ ‎‡A  The Caulobacter crescentus phage phiCbK: genomics of a canonical phage‏ ‎‡9  1‏
919 ‎‡a  synthesisof2bacteriophagelambdasproteinsinaninvivosystem‏ ‎‡A  Synthesis of two bacteriophage lambda S proteins in an in vivo system‏ ‎‡9  1‏
919 ‎‡a  suppressoranalysisofthefusogeniclambdaspanins‏ ‎‡A  Suppressor Analysis of the Fusogenic Lambda Spanins.‏ ‎‡9  1‏
919 ‎‡a  structuresofqβvirionsviruslikeparticlesandtheqβmuracomplexrevealinternalcoatproteinsandthemechanismofhostlysis‏ ‎‡A  Structures of Qβ virions, virus-like particles, and the Qβ-MurA complex reveal internal coat proteins and the mechanism of host lysis.‏ ‎‡9  1‏
919 ‎‡a  stablemicronscaleholesareageneralfeatureofcanonicalholins‏ ‎‡A  Stable micron-scale holes are a general feature of canonical holins‏ ‎‡9  1‏
919 ‎‡a  ssrnaphagepenetrationtriggersdetachmentofthefpilus‏ ‎‡A  ssRNA phage penetration triggers detachment of the F-pilus‏ ‎‡9  1‏
919 ‎‡a  spaninfunctionrequiressubunithomodimerizationthroughintermoleculardisulfidebonds‏ ‎‡A  Spanin function requires subunit homodimerization through intermolecular disulfide bonds‏ ‎‡9  1‏
919 ‎‡a  solubilizationanddeliverybygroelofmegadaltoncomplexesofthelambdaholin‏ ‎‡A  Solubilization and delivery by GroEL of megadalton complexes of the lambda holin‏ ‎‡9  1‏
919 ‎‡a  sizingtheholinlesionwithanendolysinbetagalactosidasefusion‏ ‎‡A  Sizing the holin lesion with an endolysin-beta-galactosidase fusion‏ ‎‡9  1‏
919 ‎‡a  separabledomainsdefinetargetcellspecificitiesofanrtxhemolysinfromactinobacilluspleuropneumoniae‏ ‎‡A  Separable domains define target cell specificities of an RTX hemolysin from Actinobacillus pleuropneumoniae‏ ‎‡9  1‏
919 ‎‡a  rzrz1lysisgeneequivalentsinphagesofgramnegativehosts‏ ‎‡A  Rz/Rz1 lysis gene equivalents in phages of Gram-negative hosts.‏ ‎‡9  1‏
919 ‎‡a  roleofphagesinthepathogenesisofburkholderiaorwherearethetoxingenesinburkholderiaphages‏ ‎‡A  Role of phages in the pathogenesis of Burkholderia, or 'Where are the toxin genes in Burkholderia phages?'.‏ ‎‡9  1‏
919 ‎‡a  relationbetweengrowthandreplicationinbacteria‏ ‎‡A  Relation between growth and replication in bacteria‏ ‎‡9  1‏
919 ‎‡a  regulationofaphageendolysinbydisulfidecaging‏ ‎‡A  Regulation of a phage endolysin by disulfide caging‏ ‎‡9  1‏
919 ‎‡a  rapiddenovoevolutionoflysisgenesinsinglestrandedrnaphages‏ ‎‡A  Rapid de novo evolution of lysis genes in single-stranded RNA phages‏ ‎‡9  1‏
919 ‎‡a  purificationandfunctionalcharacterizationofphix174lysisproteine‏ ‎‡A  Purification and functional characterization of phiX174 lysis protein E.‏ ‎‡9  1‏
919 ‎‡a  proteindeterminantsofphaget4lysisinhibition‏ ‎‡A  Protein determinants of phage T4 lysis inhibition.‏ ‎‡9  1‏
919 ‎‡a  probingthestructureofthes105hole‏ ‎‡A  Probing the structure of the S105 hole‏ ‎‡9  1‏
919 ‎‡a  plasmidexpressionvectorusingthelambdalatepromoter‏ ‎‡A  Plasmid expression vector using the lambda late promoter‏ ‎‡9  1‏
919 ‎‡a  phix174lysisrequiresslydahostgenewhichisrelatedtothefkbpfamilyofpeptidylprolylcistransisomerases‏ ‎‡A  Phi X174 lysis requires slyD, a host gene which is related to the FKBP family of peptidyl-prolyl cis-trans isomerases.‏ ‎‡9  1‏
919 ‎‡a  phageswilloutstrategiesofhostcelllysis‏ ‎‡A  Phages will out: strategies of host cell lysis‏ ‎‡9  1‏
919 ‎‡a  phagespaninsdiversitytopologicaldynamicsandgeneconvergence‏ ‎‡A  Phage spanins: diversity, topological dynamics and gene convergence‏ ‎‡9  1‏
919 ‎‡a  phagesinglegenelysisfindingtheweakspotinthebacterialcellwall‏ ‎‡A  Phage single-gene lysis: Finding the weak spot in the bacterial cell wall‏ ‎‡9  1‏
919 ‎‡a  phagelysis3steps3choices1outcome‏ ‎‡A  Phage lysis: three steps, three choices, one outcome‏ ‎‡9  1‏
919 ‎‡a  phagelysismultiplegenesformultiplebarriers‏ ‎‡A  Phage Lysis: Multiple Genes for Multiple Barriers‏ ‎‡9  1‏
919 ‎‡a  phagelysisdowehavetheholestoryyet‏ ‎‡A  Phage lysis: do we have the hole story yet?‏ ‎‡9  1‏
919 ‎‡a  p2growthrestrictiononanrpocmutantissuppressedbyallelesoftherz1homologlysc‏ ‎‡A  P2 growth restriction on an rpoC mutant is suppressed by alleles of the Rz1 homolog lysC.‏ ‎‡9  1‏
919 ‎‡a  mutationalanalysisofthes21pinholin‏ ‎‡A  Mutational analysis of the S21 pinholin‏ ‎‡9  1‏
919 ‎‡a  mutationalanalysisofthems2lysisprotein50‏ ‎‡A  Mutational analysis of the MS2 lysis protein L.‏ ‎‡9  1‏
919 ‎‡a  ms2lysisofescherichiacolidependsonhostchaperonednaj‏ ‎‡A  MS2 Lysis of Escherichia coli Depends on Host Chaperone DnaJ.‏ ‎‡9  1‏
919 ‎‡a  moleculargeneticsofbacteriaandphages‏ ‎‡A  Molecular genetics of bacteria and phages, 2001.‏ ‎‡9  1‏
919 ‎‡a  microbiologyphagetherapyreduxwhatistobedone‏ ‎‡A  MICROBIOLOGY. Phage therapy redux--What is to be done?‏ ‎‡9  1‏
919 ‎‡a  membranefusionduringphagelysis‏ ‎‡A  Membrane fusion during phage lysis.‏ ‎‡9  1‏
919 ‎‡a  mappingthepinholeformationpathwayofs21‏ ‎‡A  Mapping the pinhole formation pathway of S21‏ ‎‡9  1‏
919 ‎‡a  macromolecularcompositionofbacteria‏ ‎‡A  Macromolecular composition of bacteria.‏ ‎‡9  1‏
919 ‎‡a  kineticsoftn5transposition‏ ‎‡A  Kinetics of Tn5 transposition‏ ‎‡9  1‏
919 ‎‡a  inhibitorymechanismoftheqβlysisproteina2‏ ‎‡A  Inhibitory mechanism of the Qβ lysis protein A2.‏ ‎‡9  1‏
919 ‎‡a  holinstheproteinclocksofbacteriophageinfections‏ ‎‡A  Holins: the protein clocks of bacteriophage infections‏ ‎‡9  1‏
919 ‎‡a  holinskillwithoutwarning‏ ‎‡A  Holins kill without warning‏ ‎‡9  1‏
919 ‎‡a  genomicandproteomicfeaturesofmycobacteriophageswu1isolatedfromchinasoil‏ ‎‡A  Genomic and proteomic features of mycobacteriophage SWU1 isolated from China soil‏ ‎‡9  1‏
919 ‎‡a  genomicandfunctionalanalysesofrhodococcusequiphagesreqipepy6reqipoco6reqipine5andreqidocb7‏ ‎‡A  Genomic and functional analyses of Rhodococcus equi phages ReqiPepy6, ReqiPoco6, ReqiPine5, and ReqiDocB7.‏ ‎‡9  1‏
919 ‎‡a  genomicandbiologicalanalysisofphagexfas53andrelatedprophagesofxylellafastidiosa‏ ‎‡A  Genomic and biological analysis of phage Xfas53 and related prophages of Xylella fastidiosa‏ ‎‡9  1‏
919 ‎‡a  genomicandbiochemicalcharacterizationofacinetobacterpodophagepettyrevealsanovellysismechanismandtailassociateddepolymeraseactivity‏ ‎‡A  Genomic and Biochemical Characterization of Acinetobacter Podophage Petty Reveals a Novel Lysis Mechanism and Tail-Associated Depolymerase Activity.‏ ‎‡9  1‏
919 ‎‡a  genomesandcharacterizationofphagesbcep22andbcepil02foundersofanovelphagetypeinburkholderiacenocepacia‏ ‎‡A  Genomes and characterization of phages Bcep22 and BcepIL02, founders of a novel phage type in Burkholderia cenocepacia‏ ‎‡9  1‏
919 ‎‡a  geneticdissectionoft4lysis‏ ‎‡A  Genetic dissection of T4 lysis.‏ ‎‡9  1‏
919 ‎‡a  geneticandbiochemicalanalysisofdimerandoligomerinteractionsofthelambdasholin‏ ‎‡A  Genetic and biochemical analysis of dimer and oligomer interactions of the lambda S holin‏ ‎‡9  1‏
919 ‎‡a  geneticanalysisofthelambdaspaninsrzandrz1identificationoffunctionaldomains‏ ‎‡A  Genetic Analysis of the Lambda Spanins Rz and Rz1: Identification of Functional Domains.‏ ‎‡9  1‏
919 ‎‡a  geneticanalysisofmrayinhibitionbythephix174proteine‏ ‎‡A  Genetic analysis of MraY inhibition by the phiX174 protein E‏ ‎‡9  1‏
919 ‎‡a  galaxyandapolloasabiologistfriendlyinterfaceforhighqualitycooperativephagegenomeannotation‏ ‎‡A  Galaxy and Apollo as a biologist-friendly interface for high-quality cooperative phage genome annotation‏ ‎‡9  1‏
919 ‎‡a  functionalbacteriorhodopsinisefficientlysolubilizedanddeliveredtomembranesbythechaperoningroel‏ ‎‡A  Functional bacteriorhodopsin is efficiently solubilized and delivered to membranes by the chaperonin GroEL‏ ‎‡9  1‏
919 ‎‡a  functionalanalysisofaclass1holinp2y‏ ‎‡A  Functional analysis of a class I holin, P2 Y.‏ ‎‡9  1‏
919 ‎‡a  fluorescentnanodiamondbacteriophageconjugatesmaintainhostspecificity‏ ‎‡A  Fluorescent Nanodiamond-bacteriophage Conjugates Maintain Host Specificity.‏ ‎‡9  1‏
919 ‎‡a  evolutionarydominanceofholinlysissystemsderivesfromsuperiorgeneticmalleability‏ ‎‡A  Evolutionary dominance of holin lysis systems derives from superior genetic malleability.‏ ‎‡9  1‏
919 ‎‡a  dominanceinlambdasmutationsandevidencefortranslationalcontrol‏ ‎‡A  Dominance in lambda S mutations and evidence for translational control‏ ‎‡9  1‏
919 ‎‡a  divergenceandmosaicismamongvirulentsoilphagesoftheburkholderiacepaciacomplex‏ ‎‡A  Divergence and mosaicism among virulent soil phages of the Burkholderia cepacia complex‏ ‎‡9  1‏
919 ‎‡a  dimerizationbetweentheholinandholininhibitorofphagelambda‏ ‎‡A  Dimerization between the holin and holin inhibitor of phage lambda‏ ‎‡9  1‏
919 ‎‡a  developmentanduseofpersonalizedbacteriophagebasedtherapeuticcocktailstotreatapatientwithadisseminatedresistantacinetobacterbaumanniiinfection‏ ‎‡A  Development and use of personalized bacteriophage-based therapeutic cocktails to treat a patient with a disseminated resistant Acinetobacter baumannii infection‏ ‎‡9  1‏
919 ‎‡a  controlofpiercesdiseasebyphage‏ ‎‡A  Control of Pierce's Disease by Phage‏ ‎‡9  1‏
919 ‎‡a  complementationandcharacterizationofthenestedrzandrz1readingframesinthegenomeofbacteriophagelambda‏ ‎‡A  Complementation and characterization of the nested Rz and Rz1 reading frames in the genome of bacteriophage lambda‏ ‎‡9  1‏
919 ‎‡a  cloningsequencingandexpressionofapasteurellahaemolyticaa1geneencodingapurklikeprotein‏ ‎‡A  Cloning, sequencing and expression of a Pasteurella haemolytica A1 gene encoding a PurK-like protein‏ ‎‡9  1‏
919 ‎‡a  characterizationofthedualstartmotifofaclass2holingene‏ ‎‡A  Characterization of the dual start motif of a class II holin gene.‏ ‎‡9  1‏
919 ‎‡a  characterizationofplasmidswithantimicrobialresistantgenesinpasteurellahaemolyticaa1‏ ‎‡A  Characterization of plasmids with antimicrobial resistant genes in Pasteurella haemolytica A1.‏ ‎‡9  1‏
919 ‎‡a  characterizationofnovelvirulentbroadhostrangephagesofxylellafastidiosaandxanthomonas‏ ‎‡A  Characterization of novel virulent broad-host-range phages of Xylella fastidiosa and Xanthomonas‏ ‎‡9  1‏
919 ‎‡a  characterizationofanoveltectivirusphagetoilanditspotentialasanagentforbiolipidextraction‏ ‎‡A  Characterization of a Novel Tectivirus Phage Toil and Its Potential as an Agent for Biolipid Extraction.‏ ‎‡9  1‏
919 ‎‡a  celllysisbyinductionofclonedlambdalysisgenes‏ ‎‡A  Cell lysis by induction of cloned lambda lysis genes‏ ‎‡9  1‏
919 ‎‡a  burkholderiacenocepaciaphagebcepmuandafamilyofmulikephagesencodingpotentialpathogenesisfactors‏ ‎‡A  Burkholderia cenocepacia phage BcepMu and a family of Mu-like phages encoding potential pathogenesis factors‏ ‎‡9  1‏
919 ‎‡a  biochemicalandgeneticevidencefor3transmembranedomainsintheclass1holinlambdas‏ ‎‡A  Biochemical and genetic evidence for three transmembrane domains in the class I holin, lambda S.‏ ‎‡9  1‏
919 ‎‡a  bacteriophagesofwastewaterfoamingassociatedfilamentousgordoniareducehostlevelsinrawactivatedsludge‏ ‎‡A  Bacteriophages of wastewater foaming-associated filamentous Gordonia reduce host levels in raw activated sludge‏ ‎‡9  1‏
919 ‎‡a  bacteriophageapplicationrestoresethanolfermentationcharacteristicsdisruptedbylactobacillusfermentum‏ ‎‡A  Bacteriophage application restores ethanol fermentation characteristics disrupted by Lactobacillus fermentum.‏ ‎‡9  1‏
919 ‎‡a  asymmetriccryoemstructureofthecanonicalallolevivirusqβrevealsasinglematurationproteinandthegenomicssrnainsitu‏ ‎‡A  Asymmetric cryo-EM structure of the canonical Allolevivirus Qβ reveals a single maturation protein and the genomic ssRNA in situ.‏ ‎‡9  1‏
919 ‎‡a  asymmetricbindingofmembraneproteinstogroel‏ ‎‡A  Asymmetric binding of membrane proteins to GroEL.‏ ‎‡9  1‏
919 ‎‡a  apparatusforrapidsamplingofgrowingcellcultures‏ ‎‡A  An apparatus for rapid sampling of growing cell cultures‏ ‎‡9  1‏
919 ‎‡a  ancientplayerunmaskedt4riencodesatspecificantiholin‏ ‎‡A  An ancient player unmasked: T4 rI encodes a t-specific antiholin.‏ ‎‡9  1‏
919 ‎‡a  activebaxandbakarefunctionalholins‏ ‎‡A  Active Bax and Bak are functional holins‏ ‎‡9  1‏
919 ‎‡a  viralproteinantibioticinhibitslipid2flippaseactivity‏ ‎‡A  A viral protein antibiotic inhibits lipid II flippase activity‏ ‎‡9  1‏
919 ‎‡a  proteinantibioticinthephageqbetaviriondiversityinlysistargets‏ ‎‡A  A protein antibiotic in the phage Qbeta virion: diversity in lysis targets‏ ‎‡9  1‏
919 ‎‡a  dominantmutationinthebacteriophagelambdasgenecausesprematurelysisandanabsolutedefectiveplatingphenotype‏ ‎‡A  A dominant mutation in the bacteriophage lambda S gene causes premature lysis and an absolute defective plating phenotype‏ ‎‡9  1‏
919 ‎‡a  broadhostrangetailocinfromburkholderiacenocepacia‏ ‎‡A  A Broad-Host-Range Tailocin from Burkholderia cenocepacia.‏ ‎‡9  1‏
943 ‎‡a  200x‏ ‎‡A  2001‏ ‎‡9  1‏
996 ‎‡2  NTA|108840107‏
996 ‎‡2  LC|n 88040087‏
996 ‎‡2  CAOONL|ncf11560428‏
996 ‎‡2  BIBSYS|90113902‏
996 ‎‡2  JPG|500663190‏
996 ‎‡2  BIBSYS|90878083‏
996 ‎‡2  J9U|987007357827405171‏
996 ‎‡2  LC|nb2003067016‏
996 ‎‡2  LC|n 82215018‏
996 ‎‡2  NSK|000613111‏
996 ‎‡2  BIBSYS|1055802‏
996 ‎‡2  LC|nr 89013222‏
996 ‎‡2  J9U|987007328507305171‏
996 ‎‡2  DNB|117200891‏
996 ‎‡2  LC|n 96114624‏
996 ‎‡2  LC|n 2011070651‏
996 ‎‡2  RERO|A024016535‏
996 ‎‡2  J9U|987007388912205171‏
996 ‎‡2  BAV|495_264977‏
996 ‎‡2  NUKAT|n 2006146828‏
996 ‎‡2  RERO|A003992672‏
996 ‎‡2  LC|nr 97016542‏
996 ‎‡2  RERO|A003992670‏
996 ‎‡2  SUDOC|161901395‏
996 ‎‡2  LC|n 2011022466‏
996 ‎‡2  LC|no2024114757‏
996 ‎‡2  BIBSYS|1675321645471‏
996 ‎‡2  ISNI|0000000025344927‏
996 ‎‡2  LC|nb2013004041‏
996 ‎‡2  NTA|073979600‏
996 ‎‡2  ISNI|0000000409154217‏
996 ‎‡2  J9U|987007323425205171‏
996 ‎‡2  NTA|068183313‏
996 ‎‡2  SUDOC|254798357‏
996 ‎‡2  BIBSYS|98045704‏
996 ‎‡2  SUDOC|110109740‏
996 ‎‡2  B2Q|0000136467‏
996 ‎‡2  BIBSYS|90168389‏
996 ‎‡2  LC|nb2009010554‏
996 ‎‡2  LC|n 96091467‏
996 ‎‡2  CAOONL|ncf10278315‏
996 ‎‡2  LC|nb2009012537‏
996 ‎‡2  RERO|A006430476‏
996 ‎‡2  LC|n 82208821‏
996 ‎‡2  J9U|987007380970105171‏
996 ‎‡2  BIBSYS|43999‏
996 ‎‡2  LC|n 86817407‏
996 ‎‡2  ISNI|0000000072681176‏
996 ‎‡2  LC|n 80124070‏
996 ‎‡2  J9U|987007330876405171‏
996 ‎‡2  RERO|A024018703‏
996 ‎‡2  SUDOC|22892233X‏
996 ‎‡2  LC|n 2018040233‏
996 ‎‡2  CAOONL|ncf10113284‏
996 ‎‡2  CAOONL|ncf10953537‏
996 ‎‡2  LIH|LNB:DU65;=BA‏
996 ‎‡2  NKC|jo2012706510‏
996 ‎‡2  JPG|500182863‏
996 ‎‡2  NTA|304011665‏
996 ‎‡2  BIBSYS|55198‏
996 ‎‡2  LC|no 97048963‏
996 ‎‡2  NTA|069425825‏
996 ‎‡2  ISNI|0000000391196645‏
996 ‎‡2  NUKAT|n 2018164174‏
996 ‎‡2  NUKAT|n 2020066144‏
996 ‎‡2  SUDOC|181323494‏
996 ‎‡2  ISNI|0000000389314104‏
996 ‎‡2  DNB|1048416186‏
996 ‎‡2  SUDOC|058457321‏
996 ‎‡2  DNB|1158087616‏
996 ‎‡2  LC|nr 93043642‏
996 ‎‡2  ISNI|0000000030522900‏
996 ‎‡2  ISNI|0000000117499897‏
996 ‎‡2  BNF|12429547‏
996 ‎‡2  J9U|987007364592005171‏
996 ‎‡2  LC|n 83311705‏
996 ‎‡2  RERO|A028180253‏
996 ‎‡2  NUKAT|n 2002064791‏
996 ‎‡2  ISNI|0000000073831164‏
996 ‎‡2  NII|DA08358121‏
996 ‎‡2  BNF|16601471‏
996 ‎‡2  SUDOC|033429235‏
996 ‎‡2  BIBSYS|11082073‏
996 ‎‡2  LC|nr 96037342‏
996 ‎‡2  CAOONL|ncf10083489‏
996 ‎‡2  ISNI|000000006657557X‏
996 ‎‡2  CAOONL|ncf10248660‏
996 ‎‡2  BNF|12280401‏
996 ‎‡2  ISNI|0000000035171150‏
996 ‎‡2  J9U|987007307468005171‏
996 ‎‡2  CAOONL|ncf10150111‏
996 ‎‡2  ISNI|0000000363163504‏
996 ‎‡2  ISNI|0000000044103977‏
996 ‎‡2  DNB|1052505252‏
996 ‎‡2  ISNI|0000000006486970‏
996 ‎‡2  ISNI|0000000110351785‏
996 ‎‡2  PLWABN|9810613898405606‏
996 ‎‡2  CAOONL|ncf10972743‏
996 ‎‡2  ISNI|0000000117445178‏
996 ‎‡2  RERO|A027215336‏
996 ‎‡2  SUDOC|115581383‏
997 ‎‡a  1900 0 flourished 0000 0‏ ‎‡9  1‏