VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q38801914  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000158.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q38801914‏
024 ‎‡a  0000-0003-4590-9384‏ ‎‡2  orcid‏
024 ‎‡a  7202968786‏ ‎‡2  scopus‏
024 ‎‡a  57193537265‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q38801914‏
100 0 ‎‡a  Helen J. Cooper‏ ‎‡c  investigadora‏ ‎‡9  ast‏
375 ‎‡a  2‏ ‎‡2  iso5218‏
400 0 ‎‡a  হেলেন জে কুপার‏ ‎‡c  গবেষক‏ ‎‡9  bn‏
400 0 ‎‡a  Helen J. Cooper‏ ‎‡c  researcher‏ ‎‡9  en‏
400 0 ‎‡a  Helen J. Cooper‏ ‎‡c  investigadora‏ ‎‡9  es‏
400 0 ‎‡a  Helen J. Cooper‏ ‎‡c  ricercatrice‏ ‎‡9  it‏
400 0 ‎‡a  Helen J. Cooper‏ ‎‡c  onderzoeker‏ ‎‡9  nl‏
670 ‎‡a  Author's Activated Ion Electron Capture Dissociation (AI ECD) of proteins: synchronization of infrared and electron irradiation with ion magnetron motion‏
670 ‎‡a  Author's Ambient ionisation mass spectrometry for in situ analysis of intact proteins.‏
670 ‎‡a  Author's Ambient surface mass spectrometry-ion mobility spectrometry of intact proteins‏
670 ‎‡a  Author's Application of High-Field Asymmetric Waveform Ion Mobility Separation to LESA Mass Spectrometry of Bacteria‏
670 ‎‡a  Author's Can museum egg specimens be used for proteomic analyses?‏
670 ‎‡a  Author's Characterization of amino acid side chain losses in electron capture dissociation.‏
670 ‎‡a  Author's Characterization of polyphosphoesters by Fourier transform ion cyclotron resonance mass spectrometry‏
670 ‎‡a  Author's Characterization of the P13 membrane protein of Borrelia burgdorferi by mass spectrometry.‏
670 ‎‡a  Author's Compound heterozygotes and beta-thalassemia: Top-down mass spectrometry for detection of hemoglobinopathies‏
670 ‎‡a  Author's Comprehensive LESA Mass Spectrometry Imaging of Intact Proteins by Integration of Cylindrical FAIMS‏
670 ‎‡a  Author's Comprehensive mapping of O-glycosylation in flagellin from Campylobacter jejuni 11168: A multienzyme differential ion mobility mass spectrometry approach‏
670 ‎‡a  Author's Correction to Direct Mass Spectrometry Analysis of Protein Complexes and Intact Proteins up to >70 kDa from Tissue‏
670 ‎‡a  Author's Data-dependent electron capture dissociation FT-ICR mass spectrometry for proteomic analyses‏
670 ‎‡a  Author's Database search strategies for proteomic data sets generated by electron capture dissociation mass spectrometry.‏
670 ‎‡a  Author's De novo design of Ln(III) coiled coils for imaging applications.‏
670 ‎‡a  Author's Determination of aberrant O-glycosylation in the IgA1 hinge region by electron capture dissociation fourier transform-ion cyclotron resonance mass spectrometry.‏
670 ‎‡a  Author's Determination of the activation energy for unimolecular dissociation of a non-covalent gas-phase peptide: substrate complex by infrared multiphoton dissociation fourier transform ion cyclotron resonance mass spectrometry‏
670 ‎‡a  Author's Differential phosphoproteomics of fibroblast growth factor signaling: identification of Src family kinase-mediated phosphorylation events‏
670 ‎‡a  Author's Direct analysis of intact proteins from Escherichia coli colonies by liquid extraction surface analysis mass spectrometry.‏
670 ‎‡a  Author's Direct detection and quantitation of He@C60 by ultrahigh-resolution Fourier transform ion cyclotron resonance mass spectrometry‏
670 ‎‡a  Author's Direct identification of bacterial and human proteins from infected wounds in living 3D skin models‏
670 ‎‡a  Author's Direct Mass Spectrometry Analysis of Protein Complexes and Intact Proteins up to >70 kDa from Tissue‏
670 ‎‡a  Author's Direct Tissue Profiling of Protein Complexes: Toward Native Mass Spectrometry Imaging.‏
670 ‎‡a  Author's Dried blood spot proteomics: surface extraction of endogenous proteins coupled with automated sample preparation and mass spectrometry analysis‏
670 ‎‡a  Author's Dynamic range and mass accuracy of wide-scan direct infusion nanoelectrospray fourier transform ion cyclotron resonance mass spectrometry-based metabolomics increased by the spectral stitching method‏
670 ‎‡a  Author's Electron capture dissociation and collision-induced dissociation of metal ion (Ag(+), Cu(2+), Zn(2+), Fe(2+), and Fe(3+)) complexes of polyamidoamine (PAMAM) dendrimers‏
670 ‎‡a  Author's Electron capture dissociation and infrared multiphoton dissociation MS/MS of an N-glycosylated tryptic peptic to yield complementary sequence information‏
670 ‎‡a  Author's Electron capture dissociation, electron detachment dissociation, and collision-induced dissociation of polyamidoamine (PAMAM) dendrimer ions with amino, amidoethanol, and sodium carboxylate surface groups‏
670 ‎‡a  Author's Electron capture dissociation Fourier transform ion cyclotron resonance mass spectrometry of cyclodepsipeptides, branched peptides, and ε-peptides‏
670 ‎‡a  Author's Electron capture dissociation mass spectrometry of metallo-supramolecular complexes‏
670 ‎‡a  Author's Electron capture dissociation mass spectrometry of tyrosine nitrated peptides‏
670 ‎‡a  Author's Electron induced dissociation‏
670 ‎‡a  Author's Electron induced dissociation: A mass spectrometry technique for the structural analysis of trinuclear oxo-centred carboxylate-bridged iron complexes‏
670 ‎‡a  Author's Electron induced dissociation (EID) tandem mass spectrometry of octaethylporphyrin and its iron(iii) complex‏
670 ‎‡a  Author's Electroporation and Mass Spectrometry: A New Paradigm for In Situ Analysis of Intact Proteins Direct from Living Yeast Colonies‏
670 ‎‡a  Author's Electrospray ionization Fourier transform ion cyclotron resonance mass spectrometric analysis of metal-ion selected dynamic protein libraries‏
670 ‎‡a  Author's Electrospray ionization Fourier transform mass spectrometric analysis of wine‏
670 ‎‡a  Author's FAIMS and native mass spectrometry: Analysis of intact protein assemblies and protein complexes‏
670 ‎‡a  Author's FAIMS and Phosphoproteomics of Fibroblast Growth Factor Signaling: Enhanced Identification of Multiply Phosphorylated Peptides‏
670 ‎‡a  Author's Fourier transform ion cyclotron resonance mass spectrometry for the analysis of small ubiquitin-like modifier‏
670 ‎‡a  Author's Fourier transform ion cyclotron resonance mass spectrometry for the analysis of small ubiquitin-like modifier (SUMO) modification: identification of lysines in RanBP2 and SUMO targeted for modification during the E3 autoSUMOylation reaction‏
670 ‎‡a  Author's Hemoglobin variant analysis via direct surface sampling of dried blood spots coupled with high-resolution mass spectrometry‏
670 ‎‡a  Author's High‐field asymmetric waveform ion mobility spectrometry (FAIMS) coupled with high‐resolution electron transfer dissociation mass spectrometry for the analysis of isobaric phosphopeptides‏
670 ‎‡a  Author's High Field Asymmetric Waveform Ion Mobility Spectrometry in Nontargeted Bottom-up Proteomics of Dried Blood Spots‏
670 ‎‡a  Author's Higher energy collision dissociation‏
670 ‎‡a  Author's Higher energy collision dissociation (HCD) product ion-triggered electron transfer dissociation (ETD) mass spectrometry for the analysis of N-linked glycoproteins‏
670 ‎‡a  Author's Hot electron capture dissociation distinguishes leucine from isoleucine in a novel hemoglobin variant, Hb Askew, beta54(D5)Val-->Ile.‏
670 ‎‡a  Author's Identification of Phosphorylation Sites Altering Pollen Soluble Inorganic Pyrophosphatase Activity.‏
670 ‎‡a  Author's In situ mass spectrometry analysis of intact proteins and protein complexes from biological substrates‏
670 ‎‡a  Author's Investigation of the 12-Month Stability of Dried Blood and Urine Spots Applying Untargeted UHPLC-MS Metabolomic Assays‏
670 ‎‡a  Author's Investigation of the presence of b ions in electron capture dissociation mass spectra‏
670 ‎‡a  Author's Large-scale analysis of peptide sequence variants: the case for high-field asymmetric waveform ion mobility spectrometry‏
670 ‎‡a  Author's Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.‏
670 ‎‡a  Author's LESA FAIMS Mass Spectrometry for the Spatial Profiling of Proteins from Tissue‏
670 ‎‡a  Author's Letter: The Diagnostic Value of Amino Acid Side-Chain Losses in Electron Capture Dissociation of Polypeptides. Comment on: “Can the‏
670 ‎‡a  Author's Letter: The Diagnostic Value of Amino Acid Side-Chain Losses in Electron Capture Dissociation of Polypeptides. Comment on: “Can the (M.−X) Region in Electron Capture Dissociation Provide Reliable Information on Amino Acid Composition of Polypepti‏
670 ‎‡a  Author's Liquid chromatography electron capture dissociation tandem mass spectrometry (LC-ECD-MS/MS) versus liquid chromatography collision-induced dissociation tandem mass spectrometry (LC-CID-MS/MS) for the identification of proteins‏
670 ‎‡a  Author's Liquid Extraction Surface Analysis‏
670 ‎‡a  Author's Liquid extraction surface analysis field asymmetric waveform ion mobility spectrometry mass spectrometry for the analysis of dried blood spots‏
670 ‎‡a  Author's Liquid Extraction Surface Analysis (LESA) Electron-Induced Dissociation and Collision-Induced Dissociation Mass Spectrometry of Small Molecule Drug Compounds‏
670 ‎‡a  Author's Liquid Extraction Surface Analysis Mass Spectrometry Coupled with Field Asymmetric Waveform Ion Mobility Spectrometry for Analysis of Intact Proteins from Biological Substrates‏
670 ‎‡a  Author's Liquid Extraction Surface Analysis Mass Spectrometry of ESKAPE Pathogens‏
670 ‎‡a  Author's Liver tumors in wild flatfish: a histopathological, proteomic, and metabolomic study‏
670 ‎‡a  Author's MALDI Imaging of Liquid Extraction Surface Analysis Sampled Tissue‏
670 ‎‡a  Author's Manipulation of quorum sensing regulation in Pseudomonas fluorescens NCIMB 10586 to increase mupirocin production‏
670 ‎‡a  Author's Mass spectrometry in demonstrating the site-specific nitration of hen egg white lysozyme by an improved electrochemical method‏
670 ‎‡a  Author's MnAl Layered Double Hydroxide Nanoparticles as a Dual-Functional Platform for Magnetic Resonance Imaging and siRNA Delivery‏
670 ‎‡a  Author's Native Ambient Mass Spectrometry of an Intact Membrane Protein Assembly and Soluble Protein Assemblies Directly from Lens Tissue‏
670 ‎‡a  Author's Native ambient mass spectrometry of intact protein assemblies directly from <i>Escherichia coli</i> colonies‏
670 ‎‡a  Author's Native LESA TWIMS-MSI: Spatial, Conformational, and Mass Analysis of Proteins and Protein Complexes‏
670 ‎‡a  Author's Native Liquid Extraction Surface Analysis Mass Spectrometry: Analysis of Noncovalent Protein Complexes Directly from Dried Substrates‏
670 ‎‡a  Author's Native Mass Spectrometry Imaging and In Situ Top-Down Identification of Intact Proteins Directly from Tissue‏
670 ‎‡a  Author's Native Mass Spectrometry Imaging of Proteins and Protein Complexes by Nano-DESI‏
670 ‎‡a  Author's Nitration of lysozyme by ultrasonic waves; demonstration by immunochemistry and mass spectrometry‏
670 ‎‡a  Author's Novel glycosylation sites localized in Campylobacter jejuni flagellin FlaA by liquid chromatography electron capture dissociation tandem mass spectrometry‏
670 ‎‡a  Author's On-line liquid chromatography electron capture dissociation for the characterization of phosphorylation sites in proteins‏
670 ‎‡a  Author's Plasma levels of complement 4a protein are increased in Alzheimer's disease.‏
670 ‎‡a  Author's Probing the complementarity of FAIMS and strong cation exchange chromatography in shotgun proteomics‏
670 ‎‡a  Author's Probing the electron capture dissociation mass spectrometry of phosphopeptides with traveling wave ion mobility spectrometry and molecular dynamics simulations‏
670 ‎‡a  Author's Probing the Fundamentals of Native Liquid Extraction Surface Analysis Mass Spectrometry of Proteins: Can Proteins Refold during Extraction?‏
670 ‎‡a  Author's Probing the mechanisms of electron capture dissociation mass spectrometry with nitrated peptides‏
670 ‎‡a  Author's Protein partners in the life history of activated fibroblast growth factor receptors‏
670 ‎‡a  Author's Proteomic analysis of a noninvasive human model of acute inflammation and its resolution: the twenty-one day gingivitis model‏
670 ‎‡a  Author's Proteomics‏
670 ‎‡a  Author's Quantitative Imaging of Proteins in Tissue by Stable Isotope Labeled Mimetic Liquid Extraction Surface Analysis Mass Spectrometry‏
670 ‎‡a  Author's Raster-Mode Continuous-Flow Liquid Microjunction Mass Spectrometry Imaging of Proteins in Thin Tissue Sections‏
670 ‎‡a  Author's Retention of enzyme activity with a boron-doped diamond electrode in the electro-oxidative nitration of lysozyme‏
670 ‎‡a  Author's Self-incompatibility triggers irreversible oxidative modification of proteins in incompatible pollen‏
670 ‎‡a  Author's Separation and identification of isomeric glycopeptides by high field asymmetric waveform ion mobility spectrometry‏
670 ‎‡a  Author's Separation of a set of peptide sequence isomers using differential ion mobility spectrometry‏
670 ‎‡a  Author's Separation of cis and trans Isomers of Polyproline by FAIMS Mass Spectrometry‏
670 ‎‡a  Author's Separation of peptide isomers with variant modified sites by high-resolution differential ion mobility spectrometry‏
670 ‎‡a  Author's SLoMo: automated site localization of modifications from ETD/ECD mass spectra.‏
670 ‎‡a  Author's Specific electrochemical iodination of horse heart myoglobin at tyrosine 103 as determined by Fourier transform ion cyclotron resonance mass spectrometry‏
670 ‎‡a  Author's Specific electrochemical nitration of horse heart myoglobin‏
670 ‎‡a  Author's Strategy for the Identification of Sites of Phosphorylation in Proteins: Neutral Loss Triggered Electron Capture Dissociation‏
670 ‎‡a  Author's Structural Analysis of 14-3-3-ζ-Derived Phosphopeptides Using Electron Capture Dissociation Mass Spectrometry, Traveling Wave Ion Mobility Spectrometry, and Molecular Modeling‏
670 ‎‡a  Author's Subcritical Water Hydrolysis of Peptides: Amino Acid Side-Chain Modifications‏
670 ‎‡a  Author's Subcritical Water Processing of Proteins: An Alternative to Enzymatic Digestion?‏
670 ‎‡a  Author's Supramolecular organization of alpha,alpha'-disubstituted sexithiophenes.‏
670 ‎‡a  Author's Targeted online liquid chromatography electron capture dissociation mass spectrometry for the localization of sites of in vivo phosphorylation in human Sprouty2.‏
670 ‎‡a  Author's The effect of phosphorylation on the electron capture dissociation of peptide ions‏
670 ‎‡a  Author's The radical ion chemistry of S-nitrosylated peptides‏
670 ‎‡a  Author's The role of electron capture dissociation in biomolecular analysis.‏
670 ‎‡a  Author's To What Extent is FAIMS Beneficial in the Analysis of Proteins?‏
670 ‎‡a  Author's Top-down and bottom-up identification of proteins by liquid extraction surface analysis mass spectrometry of healthy and diseased human liver tissue.‏
670 ‎‡a  Author's Top-Down LESA Mass Spectrometry Protein Analysis of Gram-Positive and Gram-Negative Bacteria‏
670 ‎‡a  Author's Top-down mass analysis of protein tyrosine nitration: comparison of electron capture dissociation with "slow-heating" tandem mass spectrometry methods‏
670 ‎‡a  Author's Top-Down Proteomics and Direct Surface Sampling of Neonatal Dried Blood Spots: Diagnosis of Unknown Hemoglobin Variants‏
670 ‎‡a  Author's Unusual ECD fragmentation attributed to gas-phase helix formation in a conformationally dynamic peptide‏
909 ‎‡a  (scopus) 57193537265‏ ‎‡9  1‏
909 ‎‡a  (scopus) 7202968786‏ ‎‡9  1‏
909 ‎‡a  (orcid) 0000000345909384‏ ‎‡9  1‏
919 ‎‡a  unusualecdfragmentationattributedtogasphasehelixformationinaconformationallydynamicpeptide‏ ‎‡A  Unusual ECD fragmentation attributed to gas-phase helix formation in a conformationally dynamic peptide‏ ‎‡9  1‏
919 ‎‡a  topdownproteomicsanddirectsurfacesamplingofneonataldriedbloodspotsdiagnosisofunknownhemoglobinvariants‏ ‎‡A  Top-Down Proteomics and Direct Surface Sampling of Neonatal Dried Blood Spots: Diagnosis of Unknown Hemoglobin Variants‏ ‎‡9  1‏
919 ‎‡a  topdownmassanalysisofproteintyrosinenitrationcomparisonofelectroncapturedissociationwithslowheatingtandemmassspectrometrymethods‏ ‎‡A  Top-down mass analysis of protein tyrosine nitration: comparison of electron capture dissociation with "slow-heating" tandem mass spectrometry methods‏ ‎‡9  1‏
919 ‎‡a  topdownlesamassspectrometryproteinanalysisofgrampositiveandgramnegativebacteria‏ ‎‡A  Top-Down LESA Mass Spectrometry Protein Analysis of Gram-Positive and Gram-Negative Bacteria‏ ‎‡9  1‏
919 ‎‡a  topdownandbottomupidentificationofproteinsbyliquidextractionsurfaceanalysismassspectrometryofhealthyanddiseasedhumanlivertissue‏ ‎‡A  Top-down and bottom-up identification of proteins by liquid extraction surface analysis mass spectrometry of healthy and diseased human liver tissue.‏ ‎‡9  1‏
919 ‎‡a  towhatextentisfaimsbeneficialintheanalysisofproteins‏ ‎‡A  To What Extent is FAIMS Beneficial in the Analysis of Proteins?‏ ‎‡9  1‏
919 ‎‡a  roleofelectroncapturedissociationinbiomolecularanalysis‏ ‎‡A  The role of electron capture dissociation in biomolecular analysis.‏ ‎‡9  1‏
919 ‎‡a  radicalionchemistryofsnitrosylatedpeptides‏ ‎‡A  The radical ion chemistry of S-nitrosylated peptides‏ ‎‡9  1‏
919 ‎‡a  effectofphosphorylationontheelectroncapturedissociationofpeptideions‏ ‎‡A  The effect of phosphorylation on the electron capture dissociation of peptide ions‏ ‎‡9  1‏
919 ‎‡a  targetedonlineliquidchromatographyelectroncapturedissociationmassspectrometryforthelocalizationofsitesofinvivophosphorylationinhumansprouty2‏ ‎‡A  Targeted online liquid chromatography electron capture dissociation mass spectrometry for the localization of sites of in vivo phosphorylation in human Sprouty2.‏ ‎‡9  1‏
919 ‎‡a  supramolecularorganizationofalphaalphadisubstitutedsexithiophenes‏ ‎‡A  Supramolecular organization of alpha,alpha'-disubstituted sexithiophenes.‏ ‎‡9  1‏
919 ‎‡a  subcriticalwaterprocessingofproteinsanalternativetoenzymaticdigestion‏ ‎‡A  Subcritical Water Processing of Proteins: An Alternative to Enzymatic Digestion?‏ ‎‡9  1‏
919 ‎‡a  subcriticalwaterhydrolysisofpeptidesaminoacidsidechainmodifications‏ ‎‡A  Subcritical Water Hydrolysis of Peptides: Amino Acid Side-Chain Modifications‏ ‎‡9  1‏
919 ‎‡a  structuralanalysisof1433ζderivedphosphopeptidesusingelectroncapturedissociationmassspectrometrytravelingwaveionmobilityspectrometryandmolecularmodeling‏ ‎‡A  Structural Analysis of 14-3-3-ζ-Derived Phosphopeptides Using Electron Capture Dissociation Mass Spectrometry, Traveling Wave Ion Mobility Spectrometry, and Molecular Modeling‏ ‎‡9  1‏
919 ‎‡a  strategyfortheidentificationofsitesofphosphorylationinproteinsneutrallosstriggeredelectroncapturedissociation‏ ‎‡A  Strategy for the Identification of Sites of Phosphorylation in Proteins: Neutral Loss Triggered Electron Capture Dissociation‏ ‎‡9  1‏
919 ‎‡a  specificelectrochemicalnitrationofhorseheartmyoglobin‏ ‎‡A  Specific electrochemical nitration of horse heart myoglobin‏ ‎‡9  1‏
919 ‎‡a  specificelectrochemicaliodinationofhorseheartmyoglobinattyrosine103asdeterminedbyfouriertransformioncyclotronresonancemassspectrometry‏ ‎‡A  Specific electrochemical iodination of horse heart myoglobin at tyrosine 103 as determined by Fourier transform ion cyclotron resonance mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  slomoautomatedsitelocalizationofmodificationsfrometdecdmassspectra‏ ‎‡A  SLoMo: automated site localization of modifications from ETD/ECD mass spectra.‏ ‎‡9  1‏
919 ‎‡a  separationofpeptideisomerswithvariantmodifiedsitesbyhighresolutiondifferentialionmobilityspectrometry‏ ‎‡A  Separation of peptide isomers with variant modified sites by high-resolution differential ion mobility spectrometry‏ ‎‡9  1‏
919 ‎‡a  separationofcisandtransisomersofpolyprolinebyfaimsmassspectrometry‏ ‎‡A  Separation of cis and trans Isomers of Polyproline by FAIMS Mass Spectrometry‏ ‎‡9  1‏
919 ‎‡a  separationofasetofpeptidesequenceisomersusingdifferentialionmobilityspectrometry‏ ‎‡A  Separation of a set of peptide sequence isomers using differential ion mobility spectrometry‏ ‎‡9  1‏
919 ‎‡a  separationandidentificationofisomericglycopeptidesbyhighfieldasymmetricwaveformionmobilityspectrometry‏ ‎‡A  Separation and identification of isomeric glycopeptides by high field asymmetric waveform ion mobility spectrometry‏ ‎‡9  1‏
919 ‎‡a  selfincompatibilitytriggersirreversibleoxidativemodificationofproteinsinincompatiblepollen‏ ‎‡A  Self-incompatibility triggers irreversible oxidative modification of proteins in incompatible pollen‏ ‎‡9  1‏
919 ‎‡a  retentionofenzymeactivitywithaborondopeddiamondelectrodeintheelectrooxidativenitrationoflysozyme‏ ‎‡A  Retention of enzyme activity with a boron-doped diamond electrode in the electro-oxidative nitration of lysozyme‏ ‎‡9  1‏
919 ‎‡a  rastermodecontinuousflowliquidmicrojunctionmassspectrometryimagingofproteinsinthintissuesections‏ ‎‡A  Raster-Mode Continuous-Flow Liquid Microjunction Mass Spectrometry Imaging of Proteins in Thin Tissue Sections‏ ‎‡9  1‏
919 ‎‡a  quantitativeimagingofproteinsintissuebystableisotopelabeledmimeticliquidextractionsurfaceanalysismassspectrometry‏ ‎‡A  Quantitative Imaging of Proteins in Tissue by Stable Isotope Labeled Mimetic Liquid Extraction Surface Analysis Mass Spectrometry‏ ‎‡9  1‏
919 ‎‡a  proteomics‏ ‎‡A  Proteomics‏ ‎‡9  1‏
919 ‎‡a  proteomicanalysisofanoninvasivehumanmodelofacuteinflammationanditsresolutionthe201daygingivitismodel‏ ‎‡A  Proteomic analysis of a noninvasive human model of acute inflammation and its resolution: the twenty-one day gingivitis model‏ ‎‡9  1‏
919 ‎‡a  proteinpartnersinthelifehistoryofactivatedfibroblastgrowthfactorreceptors‏ ‎‡A  Protein partners in the life history of activated fibroblast growth factor receptors‏ ‎‡9  1‏
919 ‎‡a  probingthemechanismsofelectroncapturedissociationmassspectrometrywithnitratedpeptides‏ ‎‡A  Probing the mechanisms of electron capture dissociation mass spectrometry with nitrated peptides‏ ‎‡9  1‏
919 ‎‡a  probingthefundamentalsofnativeliquidextractionsurfaceanalysismassspectrometryofproteinscanproteinsrefoldduringextraction‏ ‎‡A  Probing the Fundamentals of Native Liquid Extraction Surface Analysis Mass Spectrometry of Proteins: Can Proteins Refold during Extraction?‏ ‎‡9  1‏
919 ‎‡a  probingtheelectroncapturedissociationmassspectrometryofphosphopeptideswithtravelingwaveionmobilityspectrometryandmoleculardynamicssimulations‏ ‎‡A  Probing the electron capture dissociation mass spectrometry of phosphopeptides with traveling wave ion mobility spectrometry and molecular dynamics simulations‏ ‎‡9  1‏
919 ‎‡a  probingthecomplementarityoffaimsandstrongcationexchangechromatographyinshotgunproteomics‏ ‎‡A  Probing the complementarity of FAIMS and strong cation exchange chromatography in shotgun proteomics‏ ‎‡9  1‏
919 ‎‡a  plasmalevelsofcomplement4aproteinareincreasedinalzheimersdisease‏ ‎‡A  Plasma levels of complement 4a protein are increased in Alzheimer's disease.‏ ‎‡9  1‏
919 ‎‡a  onlineliquidchromatographyelectroncapturedissociationforthecharacterizationofphosphorylationsitesinproteins‏ ‎‡A  On-line liquid chromatography electron capture dissociation for the characterization of phosphorylation sites in proteins‏ ‎‡9  1‏
919 ‎‡a  novelglycosylationsiteslocalizedincampylobacterjejuniflagellinflaabyliquidchromatographyelectroncapturedissociationtandemmassspectrometry‏ ‎‡A  Novel glycosylation sites localized in Campylobacter jejuni flagellin FlaA by liquid chromatography electron capture dissociation tandem mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  nitrationoflysozymebyultrasonicwavesdemonstrationbyimmunochemistryandmassspectrometry‏ ‎‡A  Nitration of lysozyme by ultrasonic waves; demonstration by immunochemistry and mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  nativemassspectrometryimagingofproteinsandproteincomplexesbynanodesi‏ ‎‡A  Native Mass Spectrometry Imaging of Proteins and Protein Complexes by Nano-DESI‏ ‎‡9  1‏
919 ‎‡a  nativemassspectrometryimagingandinsitutopdownidentificationofintactproteinsdirectlyfromtissue‏ ‎‡A  Native Mass Spectrometry Imaging and In Situ Top-Down Identification of Intact Proteins Directly from Tissue‏ ‎‡9  1‏
919 ‎‡a  nativeliquidextractionsurfaceanalysismassspectrometryanalysisofnoncovalentproteincomplexesdirectlyfromdriedsubstrates‏ ‎‡A  Native Liquid Extraction Surface Analysis Mass Spectrometry: Analysis of Noncovalent Protein Complexes Directly from Dried Substrates‏ ‎‡9  1‏
919 ‎‡a  nativelesatwimsmsispatialconformationalandmassanalysisofproteinsandproteincomplexes‏ ‎‡A  Native LESA TWIMS-MSI: Spatial, Conformational, and Mass Analysis of Proteins and Protein Complexes‏ ‎‡9  1‏
919 ‎‡a  nativeambientmassspectrometryofintactproteinassembliesdirectlyfrom1escherichiacoli1colonies‏ ‎‡A  Native ambient mass spectrometry of intact protein assemblies directly from <i>Escherichia coli</i> colonies‏ ‎‡9  1‏
919 ‎‡a  nativeambientmassspectrometryofanintactmembraneproteinassemblyandsolubleproteinassembliesdirectlyfromlenstissue‏ ‎‡A  Native Ambient Mass Spectrometry of an Intact Membrane Protein Assembly and Soluble Protein Assemblies Directly from Lens Tissue‏ ‎‡9  1‏
919 ‎‡a  mnallayereddoublehydroxidenanoparticlesasadualfunctionalplatformformagneticresonanceimagingandsirnadelivery‏ ‎‡A  MnAl Layered Double Hydroxide Nanoparticles as a Dual-Functional Platform for Magnetic Resonance Imaging and siRNA Delivery‏ ‎‡9  1‏
919 ‎‡a  massspectrometryindemonstratingthesitespecificnitrationofheneggwhitelysozymebyanimprovedelectrochemicalmethod‏ ‎‡A  Mass spectrometry in demonstrating the site-specific nitration of hen egg white lysozyme by an improved electrochemical method‏ ‎‡9  1‏
919 ‎‡a  manipulationofquorumsensingregulationinpseudomonasfluorescensncimb10586toincreasemupirocinproduction‏ ‎‡A  Manipulation of quorum sensing regulation in Pseudomonas fluorescens NCIMB 10586 to increase mupirocin production‏ ‎‡9  1‏
919 ‎‡a  maldiimagingofliquidextractionsurfaceanalysissampledtissue‏ ‎‡A  MALDI Imaging of Liquid Extraction Surface Analysis Sampled Tissue‏ ‎‡9  1‏
919 ‎‡a  livertumorsinwildflatfishahistopathologicalproteomicandmetabolomicstudy‏ ‎‡A  Liver tumors in wild flatfish: a histopathological, proteomic, and metabolomic study‏ ‎‡9  1‏
919 ‎‡a  liquidextractionsurfaceanalysismassspectrometryofeskapepathogens‏ ‎‡A  Liquid Extraction Surface Analysis Mass Spectrometry of ESKAPE Pathogens‏ ‎‡9  1‏
919 ‎‡a  liquidextractionsurfaceanalysismassspectrometrycoupledwithfieldasymmetricwaveformionmobilityspectrometryforanalysisofintactproteinsfrombiologicalsubstrates‏ ‎‡A  Liquid Extraction Surface Analysis Mass Spectrometry Coupled with Field Asymmetric Waveform Ion Mobility Spectrometry for Analysis of Intact Proteins from Biological Substrates‏ ‎‡9  1‏
919 ‎‡a  liquidextractionsurfaceanalysislesaelectroninduceddissociationandcollisioninduceddissociationmassspectrometryofsmallmoleculedrugcompounds‏ ‎‡A  Liquid Extraction Surface Analysis (LESA) Electron-Induced Dissociation and Collision-Induced Dissociation Mass Spectrometry of Small Molecule Drug Compounds‏ ‎‡9  1‏
919 ‎‡a  liquidextractionsurfaceanalysisfieldasymmetricwaveformionmobilityspectrometrymassspectrometryfortheanalysisofdriedbloodspots‏ ‎‡A  Liquid extraction surface analysis field asymmetric waveform ion mobility spectrometry mass spectrometry for the analysis of dried blood spots‏ ‎‡9  1‏
919 ‎‡a  liquidextractionsurfaceanalysis‏ ‎‡A  Liquid Extraction Surface Analysis‏ ‎‡9  1‏
919 ‎‡a  liquidchromatographyelectroncapturedissociationtandemmassspectrometrylcecdmsmsversusliquidchromatographycollisioninduceddissociationtandemmassspectrometrylccidmsmsfortheidentificationofproteins‏ ‎‡A  Liquid chromatography electron capture dissociation tandem mass spectrometry (LC-ECD-MS/MS) versus liquid chromatography collision-induced dissociation tandem mass spectrometry (LC-CID-MS/MS) for the identification of proteins‏ ‎‡9  1‏
919 ‎‡a  letterthediagnosticvalueofaminoacidsidechainlossesinelectroncapturedissociationofpolypeptidescommentoncanthe100010regioninelectroncapturedissociationprovidereliableinformationonaminoacidcompositionofpolypepti‏ ‎‡A  Letter: The Diagnostic Value of Amino Acid Side-Chain Losses in Electron Capture Dissociation of Polypeptides. Comment on: “Can the (M.−X) Region in Electron Capture Dissociation Provide Reliable Information on Amino Acid Composition of Polypepti‏ ‎‡9  1‏
919 ‎‡a  letterthediagnosticvalueofaminoacidsidechainlossesinelectroncapturedissociationofpolypeptidescommentoncanthe‏ ‎‡A  Letter: The Diagnostic Value of Amino Acid Side-Chain Losses in Electron Capture Dissociation of Polypeptides. Comment on: “Can the‏ ‎‡9  1‏
919 ‎‡a  lesafaimsmassspectrometryforthespatialprofilingofproteinsfromtissue‏ ‎‡A  LESA FAIMS Mass Spectrometry for the Spatial Profiling of Proteins from Tissue‏ ‎‡9  1‏
919 ‎‡a  largescalelocalizationofproteinphosphorylationbyuseofelectroncapturedissociationmassspectrometry‏ ‎‡A  Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.‏ ‎‡9  1‏
919 ‎‡a  largescaleanalysisofpeptidesequencevariantsthecaseforhighfieldasymmetricwaveformionmobilityspectrometry‏ ‎‡A  Large-scale analysis of peptide sequence variants: the case for high-field asymmetric waveform ion mobility spectrometry‏ ‎‡9  1‏
919 ‎‡a  investigationofthepresenceofbionsinelectroncapturedissociationmassspectra‏ ‎‡A  Investigation of the presence of b ions in electron capture dissociation mass spectra‏ ‎‡9  1‏
919 ‎‡a  investigationofthe12monthstabilityofdriedbloodandurinespotsapplyinguntargeteduhplcmsmetabolomicassays‏ ‎‡A  Investigation of the 12-Month Stability of Dried Blood and Urine Spots Applying Untargeted UHPLC-MS Metabolomic Assays‏ ‎‡9  1‏
919 ‎‡a  insitumassspectrometryanalysisofintactproteinsandproteincomplexesfrombiologicalsubstrates‏ ‎‡A  In situ mass spectrometry analysis of intact proteins and protein complexes from biological substrates‏ ‎‡9  1‏
919 ‎‡a  identificationofphosphorylationsitesalteringpollensolubleinorganicpyrophosphataseactivity‏ ‎‡A  Identification of Phosphorylation Sites Altering Pollen Soluble Inorganic Pyrophosphatase Activity.‏ ‎‡9  1‏
919 ‎‡a  hotelectroncapturedissociationdistinguishesleucinefromisoleucineinanovelhemoglobinvarianthbaskewbeta54d5valile‏ ‎‡A  Hot electron capture dissociation distinguishes leucine from isoleucine in a novel hemoglobin variant, Hb Askew, beta54(D5)Val-->Ile.‏ ‎‡9  1‏
919 ‎‡a  higherenergycollisiondissociationhcdproductiontriggeredelectrontransferdissociationetdmassspectrometryfortheanalysisofnlinkedglycoproteins‏ ‎‡A  Higher energy collision dissociation (HCD) product ion-triggered electron transfer dissociation (ETD) mass spectrometry for the analysis of N-linked glycoproteins‏ ‎‡9  1‏
919 ‎‡a  higherenergycollisiondissociation‏ ‎‡A  Higher energy collision dissociation‏ ‎‡9  1‏
919 ‎‡a  highfieldasymmetricwaveformionmobilityspectrometryinnontargetedbottomupproteomicsofdriedbloodspots‏ ‎‡A  High Field Asymmetric Waveform Ion Mobility Spectrometry in Nontargeted Bottom-up Proteomics of Dried Blood Spots‏ ‎‡9  1‏
919 ‎‡a  highfieldasymmetricwaveformionmobilityspectrometryfaimscoupledwithhighresolutionelectrontransferdissociationmassspectrometryfortheanalysisofisobaricphosphopeptides‏ ‎‡A  High‐field asymmetric waveform ion mobility spectrometry (FAIMS) coupled with high‐resolution electron transfer dissociation mass spectrometry for the analysis of isobaric phosphopeptides‏ ‎‡9  1‏
919 ‎‡a  hemoglobinvariantanalysisviadirectsurfacesamplingofdriedbloodspotscoupledwithhighresolutionmassspectrometry‏ ‎‡A  Hemoglobin variant analysis via direct surface sampling of dried blood spots coupled with high-resolution mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  fouriertransformioncyclotronresonancemassspectrometryfortheanalysisofsmallubiquitinlikemodifiersumomodificationidentificationoflysinesinranbp2andsumotargetedformodificationduringthee3autosumoylationreaction‏ ‎‡A  Fourier transform ion cyclotron resonance mass spectrometry for the analysis of small ubiquitin-like modifier (SUMO) modification: identification of lysines in RanBP2 and SUMO targeted for modification during the E3 autoSUMOylation reaction‏ ‎‡9  1‏
919 ‎‡a  fouriertransformioncyclotronresonancemassspectrometryfortheanalysisofsmallubiquitinlikemodifier‏ ‎‡A  Fourier transform ion cyclotron resonance mass spectrometry for the analysis of small ubiquitin-like modifier‏ ‎‡9  1‏
919 ‎‡a  faimsandphosphoproteomicsoffibroblastgrowthfactorsignalingenhancedidentificationofmultiplyphosphorylatedpeptides‏ ‎‡A  FAIMS and Phosphoproteomics of Fibroblast Growth Factor Signaling: Enhanced Identification of Multiply Phosphorylated Peptides‏ ‎‡9  1‏
919 ‎‡a  faimsandnativemassspectrometryanalysisofintactproteinassembliesandproteincomplexes‏ ‎‡A  FAIMS and native mass spectrometry: Analysis of intact protein assemblies and protein complexes‏ ‎‡9  1‏
919 ‎‡a  electrosprayionizationfouriertransformmassspectrometricanalysisofwine‏ ‎‡A  Electrospray ionization Fourier transform mass spectrometric analysis of wine‏ ‎‡9  1‏
919 ‎‡a  electrosprayionizationfouriertransformioncyclotronresonancemassspectrometricanalysisofmetalionselecteddynamicproteinlibraries‏ ‎‡A  Electrospray ionization Fourier transform ion cyclotron resonance mass spectrometric analysis of metal-ion selected dynamic protein libraries‏ ‎‡9  1‏
919 ‎‡a  electroporationandmassspectrometryanewparadigmforinsituanalysisofintactproteinsdirectfromlivingyeastcolonies‏ ‎‡A  Electroporation and Mass Spectrometry: A New Paradigm for In Situ Analysis of Intact Proteins Direct from Living Yeast Colonies‏ ‎‡9  1‏
919 ‎‡a  electroninduceddissociationeidtandemmassspectrometryofoctaethylporphyrinanditsiron3complex‏ ‎‡A  Electron induced dissociation (EID) tandem mass spectrometry of octaethylporphyrin and its iron(iii) complex‏ ‎‡9  1‏
919 ‎‡a  electroninduceddissociationamassspectrometrytechniqueforthestructuralanalysisoftrinuclearoxocentredcarboxylatebridgedironcomplexes‏ ‎‡A  Electron induced dissociation: A mass spectrometry technique for the structural analysis of trinuclear oxo-centred carboxylate-bridged iron complexes‏ ‎‡9  1‏
919 ‎‡a  electroncapturedissociationmassspectrometryoftyrosinenitratedpeptides‏ ‎‡A  Electron capture dissociation mass spectrometry of tyrosine nitrated peptides‏ ‎‡9  1‏
919 ‎‡a  electroncapturedissociationmassspectrometryofmetallosupramolecularcomplexes‏ ‎‡A  Electron capture dissociation mass spectrometry of metallo-supramolecular complexes‏ ‎‡9  1‏
919 ‎‡a  electroncapturedissociationfouriertransformioncyclotronresonancemassspectrometryofcyclodepsipeptidesbranchedpeptidesandεpeptides‏ ‎‡A  Electron capture dissociation Fourier transform ion cyclotron resonance mass spectrometry of cyclodepsipeptides, branched peptides, and ε-peptides‏ ‎‡9  1‏
919 ‎‡a  electroncapturedissociationelectrondetachmentdissociationandcollisioninduceddissociationofpolyamidoaminepamamdendrimerionswithaminoamidoethanolandsodiumcarboxylatesurfacegroups‏ ‎‡A  Electron capture dissociation, electron detachment dissociation, and collision-induced dissociation of polyamidoamine (PAMAM) dendrimer ions with amino, amidoethanol, and sodium carboxylate surface groups‏ ‎‡9  1‏
919 ‎‡a  electroncapturedissociationandinfraredmultiphotondissociationmsmsofannglycosylatedtrypticpeptictoyieldcomplementarysequenceinformation‏ ‎‡A  Electron capture dissociation and infrared multiphoton dissociation MS/MS of an N-glycosylated tryptic peptic to yield complementary sequence information‏ ‎‡9  1‏
919 ‎‡a  electroncapturedissociationandcollisioninduceddissociationofmetalionag+cu2+zn2+fe2+andfe3+complexesofpolyamidoaminepamamdendrimers‏ ‎‡A  Electron capture dissociation and collision-induced dissociation of metal ion (Ag(+), Cu(2+), Zn(2+), Fe(2+), and Fe(3+)) complexes of polyamidoamine (PAMAM) dendrimers‏ ‎‡9  1‏
919 ‎‡a  dynamicrangeandmassaccuracyofwidescandirectinfusionnanoelectrosprayfouriertransformioncyclotronresonancemassspectrometrybasedmetabolomicsincreasedbythespectralstitchingmethod‏ ‎‡A  Dynamic range and mass accuracy of wide-scan direct infusion nanoelectrospray fourier transform ion cyclotron resonance mass spectrometry-based metabolomics increased by the spectral stitching method‏ ‎‡9  1‏
919 ‎‡a  driedbloodspotproteomicssurfaceextractionofendogenousproteinscoupledwithautomatedsamplepreparationandmassspectrometryanalysis‏ ‎‡A  Dried blood spot proteomics: surface extraction of endogenous proteins coupled with automated sample preparation and mass spectrometry analysis‏ ‎‡9  1‏
919 ‎‡a  directtissueprofilingofproteincomplexestowardnativemassspectrometryimaging‏ ‎‡A  Direct Tissue Profiling of Protein Complexes: Toward Native Mass Spectrometry Imaging.‏ ‎‡9  1‏
919 ‎‡a  directmassspectrometryanalysisofproteincomplexesandintactproteinsupto70kdafromtissue‏ ‎‡A  Direct Mass Spectrometry Analysis of Protein Complexes and Intact Proteins up to >70 kDa from Tissue‏ ‎‡9  1‏
919 ‎‡a  directidentificationofbacterialandhumanproteinsfrominfectedwoundsinliving3dskinmodels‏ ‎‡A  Direct identification of bacterial and human proteins from infected wounds in living 3D skin models‏ ‎‡9  1‏
919 ‎‡a  directdetectionandquantitationofhe@c60byultrahighresolutionfouriertransformioncyclotronresonancemassspectrometry‏ ‎‡A  Direct detection and quantitation of He@C60 by ultrahigh-resolution Fourier transform ion cyclotron resonance mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  directanalysisofintactproteinsfromescherichiacolicoloniesbyliquidextractionsurfaceanalysismassspectrometry‏ ‎‡A  Direct analysis of intact proteins from Escherichia coli colonies by liquid extraction surface analysis mass spectrometry.‏ ‎‡9  1‏
919 ‎‡a  differentialphosphoproteomicsoffibroblastgrowthfactorsignalingidentificationofsrcfamilykinasemediatedphosphorylationevents‏ ‎‡A  Differential phosphoproteomics of fibroblast growth factor signaling: identification of Src family kinase-mediated phosphorylation events‏ ‎‡9  1‏
919 ‎‡a  determinationoftheactivationenergyforunimoleculardissociationofanoncovalentgasphasepeptidesubstratecomplexbyinfraredmultiphotondissociationfouriertransformioncyclotronresonancemassspectrometry‏ ‎‡A  Determination of the activation energy for unimolecular dissociation of a non-covalent gas-phase peptide: substrate complex by infrared multiphoton dissociation fourier transform ion cyclotron resonance mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  determinationofaberrantoglycosylationintheiga1hingeregionbyelectroncapturedissociationfouriertransformioncyclotronresonancemassspectrometry‏ ‎‡A  Determination of aberrant O-glycosylation in the IgA1 hinge region by electron capture dissociation fourier transform-ion cyclotron resonance mass spectrometry.‏ ‎‡9  1‏
919 ‎‡a  novodesignofln3coiledcoilsforimagingapplications‏ ‎‡A  De novo design of Ln(III) coiled coils for imaging applications.‏ ‎‡9  1‏
919 ‎‡a  databasesearchstrategiesforproteomicdatasetsgeneratedbyelectroncapturedissociationmassspectrometry‏ ‎‡A  Database search strategies for proteomic data sets generated by electron capture dissociation mass spectrometry.‏ ‎‡9  1‏
919 ‎‡a  datadependentelectroncapturedissociationfticrmassspectrometryforproteomicanalyses‏ ‎‡A  Data-dependent electron capture dissociation FT-ICR mass spectrometry for proteomic analyses‏ ‎‡9  1‏
919 ‎‡a  correctiontodirectmassspectrometryanalysisofproteincomplexesandintactproteinsupto70kdafromtissue‏ ‎‡A  Correction to Direct Mass Spectrometry Analysis of Protein Complexes and Intact Proteins up to >70 kDa from Tissue‏ ‎‡9  1‏
919 ‎‡a  comprehensivemappingofoglycosylationinflagellinfromcampylobacterjejuni11168amultienzymedifferentialionmobilitymassspectrometryapproach‏ ‎‡A  Comprehensive mapping of O-glycosylation in flagellin from Campylobacter jejuni 11168: A multienzyme differential ion mobility mass spectrometry approach‏ ‎‡9  1‏
919 ‎‡a  comprehensivelesamassspectrometryimagingofintactproteinsbyintegrationofcylindricalfaims‏ ‎‡A  Comprehensive LESA Mass Spectrometry Imaging of Intact Proteins by Integration of Cylindrical FAIMS‏ ‎‡9  1‏
919 ‎‡a  compoundheterozygotesandbetathalassemiatopdownmassspectrometryfordetectionofhemoglobinopathies‏ ‎‡A  Compound heterozygotes and beta-thalassemia: Top-down mass spectrometry for detection of hemoglobinopathies‏ ‎‡9  1‏
919 ‎‡a  characterizationofthep13membraneproteinofborreliaburgdorferibymassspectrometry‏ ‎‡A  Characterization of the P13 membrane protein of Borrelia burgdorferi by mass spectrometry.‏ ‎‡9  1‏
919 ‎‡a  characterizationofpolyphosphoestersbyfouriertransformioncyclotronresonancemassspectrometry‏ ‎‡A  Characterization of polyphosphoesters by Fourier transform ion cyclotron resonance mass spectrometry‏ ‎‡9  1‏
919 ‎‡a  characterizationofaminoacidsidechainlossesinelectroncapturedissociation‏ ‎‡A  Characterization of amino acid side chain losses in electron capture dissociation.‏ ‎‡9  1‏
919 ‎‡a  canmuseumeggspecimensbeusedforproteomicanalyses‏ ‎‡A  Can museum egg specimens be used for proteomic analyses?‏ ‎‡9  1‏
919 ‎‡a  applicationofhighfieldasymmetricwaveformionmobilityseparationtolesamassspectrometryofbacteria‏ ‎‡A  Application of High-Field Asymmetric Waveform Ion Mobility Separation to LESA Mass Spectrometry of Bacteria‏ ‎‡9  1‏
919 ‎‡a  ambientsurfacemassspectrometryionmobilityspectrometryofintactproteins‏ ‎‡A  Ambient surface mass spectrometry-ion mobility spectrometry of intact proteins‏ ‎‡9  1‏
919 ‎‡a  ambientionisationmassspectrometryforinsituanalysisofintactproteins‏ ‎‡A  Ambient ionisation mass spectrometry for in situ analysis of intact proteins.‏ ‎‡9  1‏
919 ‎‡a  activatedionelectroncapturedissociationaiecdofproteinssynchronizationofinfraredandelectronirradiationwithionmagnetronmotion‏ ‎‡A  Activated Ion Electron Capture Dissociation (AI ECD) of proteins: synchronization of infrared and electron irradiation with ion magnetron motion‏ ‎‡9  1‏
919 ‎‡a  electroninduceddissociation‏ ‎‡A  Electron induced dissociation‏ ‎‡9  1‏
946 ‎‡a  a‏ ‎‡9  1‏
996 ‎‡2  ISNI|0000000067980278‏
996 ‎‡2  SUDOC|087708485‏
996 ‎‡2  BIBSYS|90637091‏
996 ‎‡2  SUDOC|230310052‏
996 ‎‡2  J9U|987007439878005171‏
996 ‎‡2  ISNI|0000000496735473‏
996 ‎‡2  BNF|12298562‏
996 ‎‡2  LC|no2016116359‏
996 ‎‡2  NII|DA13346358‏
996 ‎‡2  LC|n 2018018063‏
996 ‎‡2  NDL|00464889‏
996 ‎‡2  SUDOC|19058338X‏
996 ‎‡2  NTA|074306189‏
996 ‎‡2  NSK|000460286‏
996 ‎‡2  BIBSYS|12010624‏
996 ‎‡2  LC|no2015118018‏
996 ‎‡2  DNB|1080541284‏
996 ‎‡2  PLWABN|9810636127205606‏
996 ‎‡2  NTA|42103663X‏
996 ‎‡2  NII|DA06254635‏
996 ‎‡2  DNB|139404805‏
996 ‎‡2  DBC|87097968258758‏
996 ‎‡2  LC|no2009053759‏
996 ‎‡2  BAV|495_143094‏
996 ‎‡2  BIBSYS|4096362‏
996 ‎‡2  NKC|pna2008424908‏
996 ‎‡2  J9U|987007376390205171‏
996 ‎‡2  BIBSYS|90314979‏
996 ‎‡2  LC|n 2002033904‏
996 ‎‡2  NII|DA15293208‏
996 ‎‡2  SELIBR|182191‏
996 ‎‡2  SELIBR|182192‏
996 ‎‡2  DNB|134698444‏
996 ‎‡2  DNB|1349301825‏
996 ‎‡2  DNB|1252530862‏
996 ‎‡2  ICCU|TO0V628442‏
996 ‎‡2  SUDOC|280639112‏
996 ‎‡2  NTA|316084190‏
996 ‎‡2  SUDOC|030908078‏
996 ‎‡2  PTBNP|145855‏
996 ‎‡2  LC|n 83045532‏
996 ‎‡2  PLWABN|9811330638905606‏
996 ‎‡2  RERO|A003188882‏
996 ‎‡2  J9U|987007274400005171‏
996 ‎‡2  J9U|987007390219205171‏
996 ‎‡2  LC|no2021123125‏
996 ‎‡2  NKC|xx0033002‏
996 ‎‡2  NKC|xx0267238‏
996 ‎‡2  LC|nb2009028917‏
996 ‎‡2  BIBSYS|90388363‏
996 ‎‡2  NUKAT|n 2009700810‏
996 ‎‡2  NSK|000337549‏
996 ‎‡2  NTA|095020500‏
996 ‎‡2  J9U|987007603911605171‏
996 ‎‡2  BNE|XX1078055‏
996 ‎‡2  LC|no2005076525‏
996 ‎‡2  N6I|vtls002231735‏
996 ‎‡2  ISNI|0000000496737858‏
996 ‎‡2  DNB|1349300497‏
996 ‎‡2  ISNI|0000000041553972‏
996 ‎‡2  BNF|16611392‏
996 ‎‡2  ISNI|0000000447217100‏
996 ‎‡2  NUKAT|n 2022032362‏
996 ‎‡2  NUKAT|n 2023016728‏
996 ‎‡2  BNF|12574785‏
996 ‎‡2  NUKAT|n 96403570‏
996 ‎‡2  CAOONL|ncf11375396‏
996 ‎‡2  ISNI|0000000036446179‏
996 ‎‡2  SUDOC|075937964‏
996 ‎‡2  BNF|12026632‏
996 ‎‡2  NUKAT|n 2019030343‏
996 ‎‡2  LC|nb2017013019‏
996 ‎‡2  DNB|1055081739‏
996 ‎‡2  ISNI|0000000090439957‏
996 ‎‡2  CAOONL|ncf10254344‏
996 ‎‡2  ISNI|0000000423418581‏
996 ‎‡2  RERO|A018959812‏
996 ‎‡2  RERO|A003133642‏
996 ‎‡2  RERO|A003133641‏
996 ‎‡2  LC|n 2014062822‏
996 ‎‡2  BIBSYS|90587293‏
996 ‎‡2  NII|DA10881297‏
996 ‎‡2  N6I|vtls002383013‏
996 ‎‡2  RERO|A003133643‏
996 ‎‡2  ISNI|0000000116917508‏
996 ‎‡2  NTA|069216916‏
996 ‎‡2  SUDOC|069908044‏
996 ‎‡2  LC|no 97005559‏
996 ‎‡2  RERO|A003133638‏
996 ‎‡2  RERO|A003133639‏
996 ‎‡2  CAOONL|ncf10078500‏
996 ‎‡2  LIH|LNB:DS_y__r_;=CS‏
996 ‎‡2  B2Q|0000806524‏
996 ‎‡2  NUKAT|n 2018063765‏
996 ‎‡2  LC|nb2013025087‏
996 ‎‡2  NII|DA10209292‏
996 ‎‡2  ISNI|000000010800352X‏
996 ‎‡2  ISNI|0000000109072156‏
996 ‎‡2  LC|n 79098422‏
996 ‎‡2  ISNI|0000000021486813‏
996 ‎‡2  J9U|987007358578005171‏
996 ‎‡2  PTBNP|1228271‏
996 ‎‡2  BNF|12341079‏
996 ‎‡2  LC|no2018113651‏
996 ‎‡2  PLWABN|9810555067705606‏
996 ‎‡2  CAOONL|ncf10270145‏
996 ‎‡2  BNF|15327336‏
996 ‎‡2  NLA|000035351007‏
996 ‎‡2  LC|no2018081238‏
996 ‎‡2  DNB|131954555‏
996 ‎‡2  J9U|987007381106205171‏
996 ‎‡2  DNB|113522756X‏
996 ‎‡2  NDL|00436588‏
996 ‎‡2  PTBNP|278261‏
996 ‎‡2  DNB|1118510712‏
996 ‎‡2  SUDOC|031846068‏
996 ‎‡2  LNB|LNC10-000065718‏
996 ‎‡2  PTBNP|1457566‏
996 ‎‡2  BLBNB|000347202‏
996 ‎‡2  LC|no2009150268‏
996 ‎‡2  NTA|071465936‏
996 ‎‡2  DNB|188477896‏
996 ‎‡2  SUDOC|060546921‏
996 ‎‡2  LC|n 87897505‏
996 ‎‡2  ISNI|0000000063464145‏
996 ‎‡2  BIBSYS|1606126541467‏
996 ‎‡2  RERO|A012311513‏
996 ‎‡2  NKC|xx0183373‏
996 ‎‡2  CAOONL|ncf11357418‏
996 ‎‡2  ISNI|0000000453057457‏
996 ‎‡2  BIBSYS|90112552‏
996 ‎‡2  LC|no2015012310‏
996 ‎‡2  PLWABN|9810541274005606‏
996 ‎‡2  LC|n 97081135‏
996 ‎‡2  PLWABN|9812075661305606‏
996 ‎‡2  DNB|1168753945‏
996 ‎‡2  LC|n 2007183704‏
996 ‎‡2  LC|nb2017013093‏
996 ‎‡2  PLWABN|9812806501805606‏
996 ‎‡2  NTA|164021221‏
996 ‎‡2  NDL|00883624‏
996 ‎‡2  SUDOC|032367600‏
996 ‎‡2  BNF|12222986‏
996 ‎‡2  SUDOC|177101946‏
996 ‎‡2  DBC|87097969429785‏
996 ‎‡2  CAOONL|ncf11021595‏
996 ‎‡2  NTA|068553404‏
996 ‎‡2  SUDOC|112230326‏
996 ‎‡2  SIMACOB|5518691‏
996 ‎‡2  NII|DA04240039‏
996 ‎‡2  KRNLK|KAC200006769‏
996 ‎‡2  LC|no 97024015‏
996 ‎‡2  SZ|113522756X‏
996 ‎‡2  W2Z|1606126541467‏
996 ‎‡2  J9U|987007297474205171‏
996 ‎‡2  NUKAT|n 2004068665‏
996 ‎‡2  DNB|1152408496‏
996 ‎‡2  J9U|987007336657705171‏
996 ‎‡2  J9U|987008729611505171‏
996 ‎‡2  NTA|431327572‏
996 ‎‡2  DNB|131954571‏
996 ‎‡2  LC|no2017102333‏
996 ‎‡2  ISNI|0000000045708150‏
996 ‎‡2  LC|n 87920729‏
996 ‎‡2  J9U|987007336997405171‏
996 ‎‡2  LC|n 88019193‏
996 ‎‡2  NLA|000035092528‏
996 ‎‡2  ISNI|0000000079802938‏
996 ‎‡2  LC|n 2005175256‏
996 ‎‡2  ISNI|0000000066242855‏
996 ‎‡2  LC|nb2017013098‏
996 ‎‡2  NTA|069439915‏
996 ‎‡2  LC|n 84132075‏
996 ‎‡2  NSK|000568291‏
996 ‎‡2  LC|n 99264598‏
996 ‎‡2  BIBSYS|90205617‏
996 ‎‡2  BIBSYS|9051707‏
996 ‎‡2  BIBSYS|13066429‏
996 ‎‡2  DBC|87097968223504‏
996 ‎‡2  KRNLK|KAC200711067‏
996 ‎‡2  DNB|1054059837‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏