VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q42771743  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000208.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q42771743‏
024 ‎‡a  0000-0001-5386-6674‏ ‎‡2  orcid‏
024 ‎‡a  7403269887‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q42771743‏
100 0 ‎‡a  方震中‏
375 ‎‡a  1‏ ‎‡2  iso5218‏
400 0 ‎‡a  Cheng-chung Fang‏ ‎‡c  Taiwanese emergency physician‏ ‎‡9  en‏
400 0 ‎‡a  方震中‏ ‎‡c  臺灣急診科醫生‏ ‎‡9  zh-tw‏
400 0 ‎‡a  팡전중‏ ‎‡c  대만의 응급 의사‏ ‎‡9  ko‏
400 0 ‎‡a  方震中‏ ‎‡c  臺灣急診科醫生‏ ‎‡9  zh-hant‏
400 0 ‎‡a  方震中‏ ‎‡c  臺灣急診科醫生‏ ‎‡9  zh‏
400 0 ‎‡a  方震中‏ ‎‡c  台湾の救急医‏ ‎‡9  ja‏
670 ‎‡a  Author's A misleading chest plain radiograph acquired after the return of spontaneous circulation‏
670 ‎‡a  Author's A mobile indoor positioning system based on iBeacon technology.‏
670 ‎‡a  Author's A novel depth estimation algorithm of chest compression for feedback of high-quality cardiopulmonary resuscitation based on a smartwatch‏
670 ‎‡a  Author's A patient-tailored N-acetylcysteine protocol for acute acetaminophen intoxication‏
670 ‎‡a  Author's Abiotic Synthesis with the C-C Bond Formation in Ethanol from CO2 over (Cu,M)(O,S) Catalysts with M = Ni, Sn, and Co.‏
670 ‎‡a  Author's Acinetobacter peritoneal dialysis peritonitis: a changing landscape over time‏
670 ‎‡a  Author's Active compression-decompression resuscitation and impedance threshold device for out-of-hospital cardiac arrest: a systematic review and metaanalysis of randomized controlled trials.‏
670 ‎‡a  Author's Acute cholinergic syndrome following ingestion of contaminated herbal extract‏
670 ‎‡a  Author's Acute renal failure caused by mushroom poisoning‏
670 ‎‡a  Author's Acute Respiratory Infection and Use of Nonsteroidal Anti-Inflammatory Drugs on Risk of Acute Myocardial Infarction: A Nationwide Case-Crossover Study.‏
670 ‎‡a  Author's An observational study of extracorporeal CPR for in-hospital cardiac arrest secondary to myocardial infarction‏
670 ‎‡a  Author's Analytically confirmed 4-Methyl-N-ethylnorpentedrone (4-MEAP), a synthetic cathinone, in cases presenting to an emergency department‏
670 ‎‡a  Author's Antibiotics induce apoptosis of human peritoneal mesothelial cells.‏
670 ‎‡a  Author's Biphasic versus monophasic defibrillation in out-of-hospital cardiac arrest: a systematic review and meta-analysis‏
670 ‎‡a  Author's Carbon dioxide asphyxiation caused by special-effect dry ice in an election campaign‏
670 ‎‡a  Author's Comparative effectiveness of different oral antibiotics regimens for treatment of urinary tract infection in outpatients: an analysis of national representative claims database‏
670 ‎‡a  Author's Cranberry-containing products for prevention of urinary tract infections in susceptible populations: a systematic review and meta-analysis of randomized controlled trials‏
670 ‎‡a  Author's Data on evaluation of proficiency for the US-CAB curriculum.‏
670 ‎‡a  Author's Diabetes mellitus, superoxide dismutase and peroxisome proliferator activated receptor gamma polymorphisms modify the outcome of end-stage renal disease patients of Han Chinese origin.‏
670 ‎‡a  Author's Diagnosis of primary aldosteronism: comparison of post-captopril active renin concentration and plasma renin activity‏
670 ‎‡a  Author's Diltiazem suppresses collagen synthesis and IL-1beta-induced TGF-beta1 production on human peritoneal mesothelial cells.‏
670 ‎‡a  Author's Dilute-and-shoot enhances sensitivity of phthalate urinary concentrations for assessing the exposure in children‏
670 ‎‡a  Author's Dipyridamole inhibits human peritoneal mesothelial cell proliferation in vitro and attenuates rat peritoneal fibrosis in vivo‏
670 ‎‡a  Author's Ecstasy poisoning in a toddler‏
670 ‎‡a  Author's ED overcrowding in Taiwan: facts and strategies‏
670 ‎‡a  Author's ED presentation of acute porphyria.‏
670 ‎‡a  Author's Effects of Gender on the Association of Urinary Phthalate Metabolites with Thyroid Hormones in Children: A Prospective Cohort Study in Taiwan‏
670 ‎‡a  Author's Effects of intraperitoneal antibiotics on human peritoneal mesothelial cell growth‏
670 ‎‡a  Author's Effects of pre-arrest comorbidities on 90-day survival of patients resuscitated from out-of-hospital cardiac arrest.‏
670 ‎‡a  Author's Elevated plasma cyanide level after hydroxocobalamin infusion for cyanide poisoning‏
670 ‎‡a  Author's Emergent hemodialysis for acyclovir toxicity‏
670 ‎‡a  Author's Erythromycin-induced acute pancreatitis.‏
670 ‎‡a  Author's Extracellular matrix proteins modulate human peritoneal mesothelial cell behavior‏
670 ‎‡a  Author's Fibrin-Induced epithelial-to-mesenchymal transition of peritoneal mesothelial cells as a mechanism of peritoneal fibrosis: effects of pentoxifylline‏
670 ‎‡a  Author's Fulminant hepatic failure due to chronic acetaminophen intoxication in an infant.‏
670 ‎‡a  Author's Health-related quality of life of hemodialysis patients in Taiwan: a multicenter study‏
670 ‎‡a  Author's Healthcare Applications of Smart Watches. A Systematic Review‏
670 ‎‡a  Author's High-dose vs non-high-dose proton pump inhibitors after endoscopic treatment in patients with bleeding peptic ulcer: a systematic review and meta-analysis of randomized controlled trials.‏
670 ‎‡a  Author's High peritoneal KT/V and peritonitis rates are associated with peritoneal calcification‏
670 ‎‡a  Author's Hornet sting-induced toxic hepatitis‏
670 ‎‡a  Author's Hypertensive encephalopathy‏
670 ‎‡a  Author's Impact of diabetes on mortality among patients with community-acquired bacteremia‏
670 ‎‡a  Author's Impact of major illnesses and geographic regions on do-not-resuscitate rate and its potential cost savings in Taiwan‏
670 ‎‡a  Author's Increased rate of DNR status in hospitalized end-of-life patients in Taiwan.‏
670 ‎‡a  Author's Interplay between Superoxide Dismutase, Glutathione Peroxidase, and Peroxisome Proliferator Activated Receptor Gamma Polymorphisms on the Risk of End-Stage Renal Disease among Han Chinese Patients‏
670 ‎‡a  Author's Intraperitoneal vascular endothelial growth factor C level is related to peritoneal dialysis ultrafiltration‏
670 ‎‡a  Author's Key features of the patient-tailored N-acetylcysteine protocol.‏
670 ‎‡a  Author's Long QT syndrome and torsades de pointes induced by acute sulpiride poisoning‏
670 ‎‡a  Author's MDMA-induced acute pulmonary edema in a patient without other organ dysfunction‏
670 ‎‡a  Author's Methylene 3, 4 dioxymethamphetamine-induced acute myocardial infarction‏
670 ‎‡a  Author's National retrospective cohort study to identify age-specific fatality risks of comorbidities among hospitalised patients with influenza-like illness in Taiwan‏
670 ‎‡a  Author's Occult Staphylococcus aureus bacteremia in adult emergency department patients: rare but important‏
670 ‎‡a  Author's Pentoxifylline inhibits human peritoneal mesothelial cell growth and collagen synthesis: effects on TGF-beta.‏
670 ‎‡a  Author's Periarrest Modified Early Warning Score (MEWS) predicts the outcome of in-hospital cardiac arrest.‏
670 ‎‡a  Author's Peritoneal dialysis peritonitis by anaerobic pathogens: a retrospective case series‏
670 ‎‡a  Author's Peritoneal infusion with cold saline decreased postoperative intra-abdominal adhesion formation‏
670 ‎‡a  Author's Peritoneal permeability in patients with encapsulating peritoneal sclerosis‏
670 ‎‡a  Author's Population-based study of venomous snakebite in Taiwan‏
670 ‎‡a  Author's Predicting methicillin resistance among community-onset Staphylococcus aureus bacteremia patients with prior healthcare-associated exposure‏
670 ‎‡a  Author's Progressive increase of bowel wall thickness is a reliable indicator for surgery in patients with adhesive small bowel obstruction‏
670 ‎‡a  Author's Pseudohyperchloraemia due to bromvalerylurea abuse.‏
670 ‎‡a  Author's Queer consequence of cough: atrial myxoma embolization with acute occlusion of the abdominal aorta‏
670 ‎‡a  Author's Renovascular disease in Taiwan: a long-term nationwide population study‏
670 ‎‡a  Author's Reply to: Potential pros and cons of the real-time feedback mechanism embedded in smartwatches‏
670 ‎‡a  Author's Retroperitoneal fibrosis‏
670 ‎‡a  Author's Risk of stroke associated with use of nonsteroidal anti-inflammatory drugs during acute respiratory infection episode.‏
670 ‎‡a  Author's Sequence variants of peroxisome proliferator-activated receptor-gamma gene and the clinical courses of patients with end-stage renal disease‏
670 ‎‡a  Author's Spontaneous renal artery dissection‏
670 ‎‡a  Author's Sudden death caused by dissecting thoracic aortic aneurysm in a patient with autosomal dominant polycystic kidney disease‏
670 ‎‡a  Author's Sunitinib-induced myxedema coma‏
670 ‎‡a  Author's Target blood pressure for hypotensive resuscitation.‏
670 ‎‡a  Author's The impact of adding clinical assistants on patient waiting time in a crowded emergency department.‏
670 ‎‡a  Author's The Small Molecule Inhibitor QLT-0267 Decreases the Production of Fibrin-Induced Inflammatory Cytokines and Prevents Post-Surgical Peritoneal Adhesions.‏
670 ‎‡a  Author's Treating baclofen overdose by hemodialysis‏
670 ‎‡a  Author's Treatment of baclofen overdose by haemodialysis: a pharmacokinetic study‏
670 ‎‡a  Author's Treatment of fibrate-induced rhabdomyolysis with plasma exchange in ESRD.‏
670 ‎‡a  Author's Ultrasound may decrease the emergency surgery rate of incarcerated inguinal hernia.‏
670 ‎‡a  Author's Underreporting of illicit drug use by patients at emergency departments as revealed by two-tiered urinalysis‏
670 ‎‡a  Author's Urinothorax associated with VURD syndrome‏
670 ‎‡a  Author's US-CAB Protocol for Ultrasonographic Evaluation during Cardiopulmonary Resuscitation: Validation and Potential Impact.‏
670 ‎‡a  Author's Using a smartwatch with real-time feedback improves the delivery of high-quality cardiopulmonary resuscitation by healthcare professionals‏
670 ‎‡a  Author's Value of blood culture time to positivity in identifying complicated nontyphoidal Salmonella bacteremia.‏
670 ‎‡a  Author's Viridans streptococci in peritoneal dialysis peritonitis: clinical courses and long-term outcomes‏
670 ‎‡a  Author's Xylazine abuse: a rare cause of syncope‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/viaf/6163567368416380049‏
909 ‎‡a  (orcid) 0000000153866674‏ ‎‡9  1‏
909 ‎‡a  (scopus) 7403269887‏ ‎‡9  1‏
919 ‎‡a  valueofbloodculturetimetopositivityinidentifyingcomplicatednontyphoidalsalmonellabacteremia‏ ‎‡A  Value of blood culture time to positivity in identifying complicated nontyphoidal Salmonella bacteremia.‏ ‎‡9  1‏
919 ‎‡a  uscabprotocolforultrasonographicevaluationduringcardiopulmonaryresuscitationvalidationandpotentialimpact‏ ‎‡A  US-CAB Protocol for Ultrasonographic Evaluation during Cardiopulmonary Resuscitation: Validation and Potential Impact.‏ ‎‡9  1‏
919 ‎‡a  urinothoraxassociatedwithvurdsyndrome‏ ‎‡A  Urinothorax associated with VURD syndrome‏ ‎‡9  1‏
919 ‎‡a  underreportingofillicitdrugusebypatientsatemergencydepartmentsasrevealedby2tieredurinalysis‏ ‎‡A  Underreporting of illicit drug use by patients at emergency departments as revealed by two-tiered urinalysis‏ ‎‡9  1‏
919 ‎‡a  ultrasoundmaydecreasetheemergencysurgeryrateofincarceratedinguinalhernia‏ ‎‡A  Ultrasound may decrease the emergency surgery rate of incarcerated inguinal hernia.‏ ‎‡9  1‏
919 ‎‡a  treatmentoffibrateinducedrhabdomyolysiswithplasmaexchangeinesrd‏ ‎‡A  Treatment of fibrate-induced rhabdomyolysis with plasma exchange in ESRD.‏ ‎‡9  1‏
919 ‎‡a  treatmentofbaclofenoverdosebyhaemodialysisapharmacokineticstudy‏ ‎‡A  Treatment of baclofen overdose by haemodialysis: a pharmacokinetic study‏ ‎‡9  1‏
919 ‎‡a  treatingbaclofenoverdosebyhemodialysis‏ ‎‡A  Treating baclofen overdose by hemodialysis‏ ‎‡9  1‏
919 ‎‡a  smallmoleculeinhibitorqlt0267decreasestheproductionoffibrininducedinflammatorycytokinesandpreventspostsurgicalperitonealadhesions‏ ‎‡A  The Small Molecule Inhibitor QLT-0267 Decreases the Production of Fibrin-Induced Inflammatory Cytokines and Prevents Post-Surgical Peritoneal Adhesions.‏ ‎‡9  1‏
919 ‎‡a  impactofaddingclinicalassistantsonpatientwaitingtimeinacrowdedemergencydepartment‏ ‎‡A  The impact of adding clinical assistants on patient waiting time in a crowded emergency department.‏ ‎‡9  1‏
919 ‎‡a  targetbloodpressureforhypotensiveresuscitation‏ ‎‡A  Target blood pressure for hypotensive resuscitation.‏ ‎‡9  1‏
919 ‎‡a  sunitinibinducedmyxedemacoma‏ ‎‡A  Sunitinib-induced myxedema coma‏ ‎‡9  1‏
919 ‎‡a  emergenthemodialysisforacyclovirtoxicity‏ ‎‡A  Emergent hemodialysis for acyclovir toxicity‏ ‎‡9  1‏
919 ‎‡a  erythromycininducedacutepancreatitis‏ ‎‡A  Erythromycin-induced acute pancreatitis.‏ ‎‡9  1‏
919 ‎‡a  extracellularmatrixproteinsmodulatehumanperitonealmesothelialcellbehavior‏ ‎‡A  Extracellular matrix proteins modulate human peritoneal mesothelial cell behavior‏ ‎‡9  1‏
919 ‎‡a  fibrininducedepithelialtomesenchymaltransitionofperitonealmesothelialcellsasamechanismofperitonealfibrosiseffectsofpentoxifylline‏ ‎‡A  Fibrin-Induced epithelial-to-mesenchymal transition of peritoneal mesothelial cells as a mechanism of peritoneal fibrosis: effects of pentoxifylline‏ ‎‡9  1‏
919 ‎‡a  fulminanthepaticfailureduetochronicacetaminophenintoxicationinaninfant‏ ‎‡A  Fulminant hepatic failure due to chronic acetaminophen intoxication in an infant.‏ ‎‡9  1‏
919 ‎‡a  healthrelatedqualityoflifeofhemodialysispatientsintaiwanamulticenterstudy‏ ‎‡A  Health-related quality of life of hemodialysis patients in Taiwan: a multicenter study‏ ‎‡9  1‏
919 ‎‡a  healthcareapplicationsofsmartwatchesasystematicreview‏ ‎‡A  Healthcare Applications of Smart Watches. A Systematic Review‏ ‎‡9  1‏
919 ‎‡a  highdosevsnonhighdoseprotonpumpinhibitorsafterendoscopictreatmentinpatientswithbleedingpepticulcerasystematicreviewandmetaanalysisofrandomizedcontrolledtrials‏ ‎‡A  High-dose vs non-high-dose proton pump inhibitors after endoscopic treatment in patients with bleeding peptic ulcer: a systematic review and meta-analysis of randomized controlled trials.‏ ‎‡9  1‏
919 ‎‡a  highperitonealkt5andperitonitisratesareassociatedwithperitonealcalcification‏ ‎‡A  High peritoneal KT/V and peritonitis rates are associated with peritoneal calcification‏ ‎‡9  1‏
919 ‎‡a  hornetstinginducedtoxichepatitis‏ ‎‡A  Hornet sting-induced toxic hepatitis‏ ‎‡9  1‏
919 ‎‡a  hypertensiveencephalopathy‏ ‎‡A  Hypertensive encephalopathy‏ ‎‡9  1‏
919 ‎‡a  impactofdiabetesonmortalityamongpatientswithcommunityacquiredbacteremia‏ ‎‡A  Impact of diabetes on mortality among patients with community-acquired bacteremia‏ ‎‡9  1‏
919 ‎‡a  suddendeathcausedbydissectingthoracicaorticaneurysminapatientwithautosomaldominantpolycystickidneydisease‏ ‎‡A  Sudden death caused by dissecting thoracic aortic aneurysm in a patient with autosomal dominant polycystic kidney disease‏ ‎‡9  1‏
919 ‎‡a  spontaneousrenalarterydissection‏ ‎‡A  Spontaneous renal artery dissection‏ ‎‡9  1‏
919 ‎‡a  impactofmajorillnessesandgeographicregionsondonotresuscitaterateanditspotentialcostsavingsintaiwan‏ ‎‡A  Impact of major illnesses and geographic regions on do-not-resuscitate rate and its potential cost savings in Taiwan‏ ‎‡9  1‏
919 ‎‡a  increasedrateofdnrstatusinhospitalizedendoflifepatientsintaiwan‏ ‎‡A  Increased rate of DNR status in hospitalized end-of-life patients in Taiwan.‏ ‎‡9  1‏
919 ‎‡a  interplaybetweensuperoxidedismutaseglutathioneperoxidaseandperoxisomeproliferatoractivatedreceptorgammapolymorphismsontheriskofendstagerenaldiseaseamonghanchinesepatients‏ ‎‡A  Interplay between Superoxide Dismutase, Glutathione Peroxidase, and Peroxisome Proliferator Activated Receptor Gamma Polymorphisms on the Risk of End-Stage Renal Disease among Han Chinese Patients‏ ‎‡9  1‏
919 ‎‡a  intraperitonealvascularendothelialgrowthfactor100levelisrelatedtoperitonealdialysisultrafiltration‏ ‎‡A  Intraperitoneal vascular endothelial growth factor C level is related to peritoneal dialysis ultrafiltration‏ ‎‡9  1‏
919 ‎‡a  keyfeaturesofthepatienttailorednacetylcysteineprotocol‏ ‎‡A  Key features of the patient-tailored N-acetylcysteine protocol.‏ ‎‡9  1‏
919 ‎‡a  longqtsyndromeandtorsadesdepointesinducedbyacutesulpiridepoisoning‏ ‎‡A  Long QT syndrome and torsades de pointes induced by acute sulpiride poisoning‏ ‎‡9  1‏
919 ‎‡a  mdmainducedacutepulmonaryedemainapatientwithoutotherorgandysfunction‏ ‎‡A  MDMA-induced acute pulmonary edema in a patient without other organ dysfunction‏ ‎‡9  1‏
919 ‎‡a  methylene34dioxymethamphetamineinducedacutemyocardialinfarction‏ ‎‡A  Methylene 3, 4 dioxymethamphetamine-induced acute myocardial infarction‏ ‎‡9  1‏
919 ‎‡a  nationalretrospectivecohortstudytoidentifyagespecificfatalityrisksofcomorbiditiesamonghospitalisedpatientswithinfluenzalikeillnessintaiwan‏ ‎‡A  National retrospective cohort study to identify age-specific fatality risks of comorbidities among hospitalised patients with influenza-like illness in Taiwan‏ ‎‡9  1‏
919 ‎‡a  occultstaphylococcusaureusbacteremiainadultemergencydepartmentpatientsrarebutimportant‏ ‎‡A  Occult Staphylococcus aureus bacteremia in adult emergency department patients: rare but important‏ ‎‡9  1‏
919 ‎‡a  pentoxifyllineinhibitshumanperitonealmesothelialcellgrowthandcollagensynthesiseffectsontgfbeta‏ ‎‡A  Pentoxifylline inhibits human peritoneal mesothelial cell growth and collagen synthesis: effects on TGF-beta.‏ ‎‡9  1‏
919 ‎‡a  periarrestmodifiedearlywarningscoremewspredictstheoutcomeofinhospitalcardiacarrest‏ ‎‡A  Periarrest Modified Early Warning Score (MEWS) predicts the outcome of in-hospital cardiac arrest.‏ ‎‡9  1‏
919 ‎‡a  peritonealdialysisperitonitisbyanaerobicpathogensaretrospectivecaseseries‏ ‎‡A  Peritoneal dialysis peritonitis by anaerobic pathogens: a retrospective case series‏ ‎‡9  1‏
919 ‎‡a  peritonealinfusionwithcoldsalinedecreasedpostoperativeintraabdominaladhesionformation‏ ‎‡A  Peritoneal infusion with cold saline decreased postoperative intra-abdominal adhesion formation‏ ‎‡9  1‏
919 ‎‡a  peritonealpermeabilityinpatientswithencapsulatingperitonealsclerosis‏ ‎‡A  Peritoneal permeability in patients with encapsulating peritoneal sclerosis‏ ‎‡9  1‏
919 ‎‡a  populationbasedstudyofvenomoussnakebiteintaiwan‏ ‎‡A  Population-based study of venomous snakebite in Taiwan‏ ‎‡9  1‏
919 ‎‡a  predictingmethicillinresistanceamongcommunityonsetstaphylococcusaureusbacteremiapatientswithpriorhealthcareassociatedexposure‏ ‎‡A  Predicting methicillin resistance among community-onset Staphylococcus aureus bacteremia patients with prior healthcare-associated exposure‏ ‎‡9  1‏
919 ‎‡a  sequencevariantsofperoxisomeproliferatoractivatedreceptorgammageneandtheclinicalcoursesofpatientswithendstagerenaldisease‏ ‎‡A  Sequence variants of peroxisome proliferator-activated receptor-gamma gene and the clinical courses of patients with end-stage renal disease‏ ‎‡9  1‏
919 ‎‡a  riskofstrokeassociatedwithuseofnonsteroidalantiinflammatorydrugsduringacuterespiratoryinfectionepisode‏ ‎‡A  Risk of stroke associated with use of nonsteroidal anti-inflammatory drugs during acute respiratory infection episode.‏ ‎‡9  1‏
919 ‎‡a  retroperitonealfibrosis‏ ‎‡A  Retroperitoneal fibrosis‏ ‎‡9  1‏
919 ‎‡a  replytopotentialprosandconsoftherealtimefeedbackmechanismembeddedinsmartwatches‏ ‎‡A  Reply to: Potential pros and cons of the real-time feedback mechanism embedded in smartwatches‏ ‎‡9  1‏
919 ‎‡a  renovasculardiseaseintaiwanalongtermnationwidepopulationstudy‏ ‎‡A  Renovascular disease in Taiwan: a long-term nationwide population study‏ ‎‡9  1‏
919 ‎‡a  queerconsequenceofcoughatrialmyxomaembolizationwithacuteocclusionoftheabdominalaorta‏ ‎‡A  Queer consequence of cough: atrial myxoma embolization with acute occlusion of the abdominal aorta‏ ‎‡9  1‏
919 ‎‡a  pseudohyperchloraemiaduetobromvalerylureaabuse‏ ‎‡A  Pseudohyperchloraemia due to bromvalerylurea abuse.‏ ‎‡9  1‏
919 ‎‡a  progressiveincreaseofbowelwallthicknessisareliableindicatorforsurgeryinpatientswithadhesivesmallbowelobstruction‏ ‎‡A  Progressive increase of bowel wall thickness is a reliable indicator for surgery in patients with adhesive small bowel obstruction‏ ‎‡9  1‏
919 ‎‡a  usingasmartwatchwithrealtimefeedbackimprovesthedeliveryofhighqualitycardiopulmonaryresuscitationbyhealthcareprofessionals‏ ‎‡A  Using a smartwatch with real-time feedback improves the delivery of high-quality cardiopulmonary resuscitation by healthcare professionals‏ ‎‡9  1‏
919 ‎‡a  misleadingchestplainradiographacquiredafterthereturnofspontaneouscirculation‏ ‎‡A  A misleading chest plain radiograph acquired after the return of spontaneous circulation‏ ‎‡9  1‏
919 ‎‡a  mobileindoorpositioningsystembasedonibeacontechnology‏ ‎‡A  A mobile indoor positioning system based on iBeacon technology.‏ ‎‡9  1‏
919 ‎‡a  noveldepthestimationalgorithmofchestcompressionforfeedbackofhighqualitycardiopulmonaryresuscitationbasedonasmartwatch‏ ‎‡A  A novel depth estimation algorithm of chest compression for feedback of high-quality cardiopulmonary resuscitation based on a smartwatch‏ ‎‡9  1‏
919 ‎‡a  patienttailorednacetylcysteineprotocolforacuteacetaminophenintoxication‏ ‎‡A  A patient-tailored N-acetylcysteine protocol for acute acetaminophen intoxication‏ ‎‡9  1‏
919 ‎‡a  abioticsynthesiswiththe100100bondformationinethanolfromco2overcu1000oscatalystswith10002snandco‏ ‎‡A  Abiotic Synthesis with the C-C Bond Formation in Ethanol from CO2 over (Cu,M)(O,S) Catalysts with M = Ni, Sn, and Co.‏ ‎‡9  1‏
919 ‎‡a  acinetobacterperitonealdialysisperitonitisachanginglandscapeovertime‏ ‎‡A  Acinetobacter peritoneal dialysis peritonitis: a changing landscape over time‏ ‎‡9  1‏
919 ‎‡a  activecompressiondecompressionresuscitationandimpedancethresholddeviceforoutofhospitalcardiacarrestasystematicreviewandmetaanalysisofrandomizedcontrolledtrials‏ ‎‡A  Active compression-decompression resuscitation and impedance threshold device for out-of-hospital cardiac arrest: a systematic review and metaanalysis of randomized controlled trials.‏ ‎‡9  1‏
919 ‎‡a  acutecholinergicsyndromefollowingingestionofcontaminatedherbalextract‏ ‎‡A  Acute cholinergic syndrome following ingestion of contaminated herbal extract‏ ‎‡9  1‏
919 ‎‡a  acuterenalfailurecausedbymushroompoisoning‏ ‎‡A  Acute renal failure caused by mushroom poisoning‏ ‎‡9  1‏
919 ‎‡a  acuterespiratoryinfectionanduseofnonsteroidalantiinflammatorydrugsonriskofacutemyocardialinfarctionanationwidecasecrossoverstudy‏ ‎‡A  Acute Respiratory Infection and Use of Nonsteroidal Anti-Inflammatory Drugs on Risk of Acute Myocardial Infarction: A Nationwide Case-Crossover Study.‏ ‎‡9  1‏
919 ‎‡a  observationalstudyofextracorporealcprforinhospitalcardiacarrestsecondarytomyocardialinfarction‏ ‎‡A  An observational study of extracorporeal CPR for in-hospital cardiac arrest secondary to myocardial infarction‏ ‎‡9  1‏
919 ‎‡a  analyticallyconfirmed4methylnethylnorpentedrone4meapasyntheticcathinoneincasespresentingtoanemergencydepartment‏ ‎‡A  Analytically confirmed 4-Methyl-N-ethylnorpentedrone (4-MEAP), a synthetic cathinone, in cases presenting to an emergency department‏ ‎‡9  1‏
919 ‎‡a  antibioticsinduceapoptosisofhumanperitonealmesothelialcells‏ ‎‡A  Antibiotics induce apoptosis of human peritoneal mesothelial cells.‏ ‎‡9  1‏
919 ‎‡a  biphasicversusmonophasicdefibrillationinoutofhospitalcardiacarrestasystematicreviewandmetaanalysis‏ ‎‡A  Biphasic versus monophasic defibrillation in out-of-hospital cardiac arrest: a systematic review and meta-analysis‏ ‎‡9  1‏
919 ‎‡a  carbondioxideasphyxiationcausedbyspecialeffectdryiceinanelectioncampaign‏ ‎‡A  Carbon dioxide asphyxiation caused by special-effect dry ice in an election campaign‏ ‎‡9  1‏
919 ‎‡a  comparativeeffectivenessofdifferentoralantibioticsregimensfortreatmentofurinarytractinfectioninoutpatientsananalysisofnationalrepresentativeclaimsdatabase‏ ‎‡A  Comparative effectiveness of different oral antibiotics regimens for treatment of urinary tract infection in outpatients: an analysis of national representative claims database‏ ‎‡9  1‏
919 ‎‡a  cranberrycontainingproductsforpreventionofurinarytractinfectionsinsusceptiblepopulationsasystematicreviewandmetaanalysisofrandomizedcontrolledtrials‏ ‎‡A  Cranberry-containing products for prevention of urinary tract infections in susceptible populations: a systematic review and meta-analysis of randomized controlled trials‏ ‎‡9  1‏
919 ‎‡a  dataonevaluationofproficiencyfortheuscabcurriculum‏ ‎‡A  Data on evaluation of proficiency for the US-CAB curriculum.‏ ‎‡9  1‏
919 ‎‡a  diabetesmellitussuperoxidedismutaseandperoxisomeproliferatoractivatedreceptorgammapolymorphismsmodifytheoutcomeofendstagerenaldiseasepatientsofhanchineseorigin‏ ‎‡A  Diabetes mellitus, superoxide dismutase and peroxisome proliferator activated receptor gamma polymorphisms modify the outcome of end-stage renal disease patients of Han Chinese origin.‏ ‎‡9  1‏
919 ‎‡a  diagnosisofprimaryaldosteronismcomparisonofpostcaptoprilactivereninconcentrationandplasmareninactivity‏ ‎‡A  Diagnosis of primary aldosteronism: comparison of post-captopril active renin concentration and plasma renin activity‏ ‎‡9  1‏
919 ‎‡a  diltiazemsuppressescollagensynthesisandil1betainducedtgfbeta1productiononhumanperitonealmesothelialcells‏ ‎‡A  Diltiazem suppresses collagen synthesis and IL-1beta-induced TGF-beta1 production on human peritoneal mesothelial cells.‏ ‎‡9  1‏
919 ‎‡a  diluteandshootenhancessensitivityofphthalateurinaryconcentrationsforassessingtheexposureinchildren‏ ‎‡A  Dilute-and-shoot enhances sensitivity of phthalate urinary concentrations for assessing the exposure in children‏ ‎‡9  1‏
919 ‎‡a  dipyridamoleinhibitshumanperitonealmesothelialcellproliferationinvitroandattenuatesratperitonealfibrosisinvivo‏ ‎‡A  Dipyridamole inhibits human peritoneal mesothelial cell proliferation in vitro and attenuates rat peritoneal fibrosis in vivo‏ ‎‡9  1‏
919 ‎‡a  ecstasypoisoninginatoddler‏ ‎‡A  Ecstasy poisoning in a toddler‏ ‎‡9  1‏
919 ‎‡a  edovercrowdingintaiwanfactsandstrategies‏ ‎‡A  ED overcrowding in Taiwan: facts and strategies‏ ‎‡9  1‏
919 ‎‡a  edpresentationofacuteporphyria‏ ‎‡A  ED presentation of acute porphyria.‏ ‎‡9  1‏
919 ‎‡a  effectsofgenderontheassociationofurinaryphthalatemetaboliteswiththyroidhormonesinchildrenaprospectivecohortstudyintaiwan‏ ‎‡A  Effects of Gender on the Association of Urinary Phthalate Metabolites with Thyroid Hormones in Children: A Prospective Cohort Study in Taiwan‏ ‎‡9  1‏
919 ‎‡a  effectsofintraperitonealantibioticsonhumanperitonealmesothelialcellgrowth‏ ‎‡A  Effects of intraperitoneal antibiotics on human peritoneal mesothelial cell growth‏ ‎‡9  1‏
919 ‎‡a  effectsofprearrestcomorbiditieson90daysurvivalofpatientsresuscitatedfromoutofhospitalcardiacarrest‏ ‎‡A  Effects of pre-arrest comorbidities on 90-day survival of patients resuscitated from out-of-hospital cardiac arrest.‏ ‎‡9  1‏
919 ‎‡a  elevatedplasmacyanidelevelafterhydroxocobalamininfusionforcyanidepoisoning‏ ‎‡A  Elevated plasma cyanide level after hydroxocobalamin infusion for cyanide poisoning‏ ‎‡9  1‏
919 ‎‡a  xylazineabuseararecauseofsyncope‏ ‎‡A  Xylazine abuse: a rare cause of syncope‏ ‎‡9  1‏
919 ‎‡a  viridansstreptococciinperitonealdialysisperitonitisclinicalcoursesandlongtermoutcomes‏ ‎‡A  Viridans streptococci in peritoneal dialysis peritonitis: clinical courses and long-term outcomes‏ ‎‡9  1‏
946 ‎‡a  b‏ ‎‡9  1‏
996 ‎‡2  DNB|1052423639‏
996 ‎‡2  DNB|1138297798‏
996 ‎‡2  DNB|1193211999‏
996 ‎‡2  DNB|1191772160‏
996 ‎‡2  CYT|AC000207484‏
996 ‎‡2  BIBSYS|8012790‏
996 ‎‡2  DNB|1012149455‏
996 ‎‡2  SUDOC|145523268‏
996 ‎‡2  CAOONL|ncf11908358‏
996 ‎‡2  DNB|1022088084‏
996 ‎‡2  SUDOC|163989974‏
996 ‎‡2  NTA|40102329X‏
996 ‎‡2  LC|n 89120212‏
996 ‎‡2  CYT|AC000207987‏
996 ‎‡2  DNB|1037329708‏
996 ‎‡2  DNB|136690424‏
996 ‎‡2  DNB|1112331913‏
996 ‎‡2  ISNI|0000000063798727‏
996 ‎‡2  DNB|14062841X‏
996 ‎‡2  NSK|000736256‏
996 ‎‡2  PLWABN|9810680912505606‏
996 ‎‡2  CYT|AC000642653‏
996 ‎‡2  LC|nr 98008727‏
996 ‎‡2  ISNI|0000000063180070‏
996 ‎‡2  BNF|17162236‏
996 ‎‡2  NKC|xx0106000‏
996 ‎‡2  LC|n 80038651‏
996 ‎‡2  ISNI|0000000078092735‏
996 ‎‡2  BNF|15108826‏
996 ‎‡2  LC|no2016124572‏
996 ‎‡2  ISNI|0000000064216899‏
996 ‎‡2  DNB|123673976‏
996 ‎‡2  DNB|1297869354‏
996 ‎‡2  LC|n 79028726‏
996 ‎‡2  DNB|1239859171‏
996 ‎‡2  RERO|A023537032‏
996 ‎‡2  DNB|1174649518‏
996 ‎‡2  LC|no2023118690‏
996 ‎‡2  ISNI|0000000451183636‏
996 ‎‡2  LC|n 81046951‏
996 ‎‡2  DNB|1056936592‏
996 ‎‡2  CYT|AC000208019‏
996 ‎‡2  ISNI|0000000064368331‏
996 ‎‡2  ISNI|0000000041798769‏
996 ‎‡2  LC|nr 98031840‏
996 ‎‡2  CYT|AC000635397‏
996 ‎‡2  DNB|1132823382‏
996 ‎‡2  CYT|AC000637550‏
996 ‎‡2  PLWABN|9813280904505606‏
996 ‎‡2  DNB|118722611‏
996 ‎‡2  LC|nr2001029672‏
996 ‎‡2  LC|nb2017014948‏
996 ‎‡2  ISNI|0000000064010436‏
996 ‎‡2  LC|n 2020042208‏
996 ‎‡2  DNB|119142155‏
996 ‎‡2  ISNI|0000000046500992‏
996 ‎‡2  DBC|87097968299349‏
996 ‎‡2  LC|no 95036804‏
996 ‎‡2  LC|no 89006108‏
996 ‎‡2  LC|no 97049581‏
996 ‎‡2  CYT|AC000207945‏
996 ‎‡2  LC|n 80031466‏
996 ‎‡2  ISNI|0000000115754284‏
996 ‎‡2  LC|n 88034270‏
996 ‎‡2  DNB|1038538874‏
996 ‎‡2  ISNI|0000000356365845‏
996 ‎‡2  DNB|1156281784‏
996 ‎‡2  LC|nr 91036790‏
996 ‎‡2  ISNI|0000000041682766‏
996 ‎‡2  PLWABN|9810539276105606‏
996 ‎‡2  RERO|A012117331‏
996 ‎‡2  BIBSYS|90279707‏
996 ‎‡2  DNB|1070946273‏
996 ‎‡2  DNB|1207014508‏
996 ‎‡2  LC|no2022109415‏
996 ‎‡2  DNB|1059145456‏
996 ‎‡2  ISNI|0000000064076021‏
996 ‎‡2  NTA|242196101‏
996 ‎‡2  LC|n 86121444‏
996 ‎‡2  DNB|1137241977‏
996 ‎‡2  ISNI|000000007693656X‏
996 ‎‡2  CYT|AC000647141‏
996 ‎‡2  ISNI|0000000035638857‏
996 ‎‡2  BIBSYS|3099646‏
996 ‎‡2  CYT|AC000207689‏
996 ‎‡2  SUDOC|085508373‏
996 ‎‡2  SUDOC|17330673X‏
996 ‎‡2  ISNI|0000000084273479‏
996 ‎‡2  CYT|AC000648684‏
996 ‎‡2  ISNI|0000000063422607‏
996 ‎‡2  J9U|987007434748505171‏
996 ‎‡2  DNB|171771427‏
996 ‎‡2  ISNI|0000000064339776‏
996 ‎‡2  CYT|AC000207965‏
996 ‎‡2  SUDOC|172277558‏
996 ‎‡2  LC|n 87929415‏
996 ‎‡2  DNB|1233247239‏
996 ‎‡2  DNB|1247571017‏
996 ‎‡2  ISNI|0000000063695111‏
996 ‎‡2  LC|n 2015045500‏
996 ‎‡2  DNB|1261173945‏
996 ‎‡2  DNB|1129698254‏
996 ‎‡2  LC|n 2014009137‏
996 ‎‡2  DNB|17375032X‏
996 ‎‡2  DNB|1020679492‏
996 ‎‡2  ISNI|0000000416564687‏
996 ‎‡2  ISNI|0000000063730298‏
996 ‎‡2  SELIBR|380414‏
996 ‎‡2  DNB|1137970855‏
996 ‎‡2  DNB|172682304‏
996 ‎‡2  ISNI|0000000381479326‏
996 ‎‡2  DNB|1197325107‏
996 ‎‡2  LC|n 2007075609‏
996 ‎‡2  NTA|156419491‏
996 ‎‡2  DNB|1159309647‏
996 ‎‡2  LC|nr 91013183‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏
998 ‎‡a  方震中‏ ‎‡2  CYT|AC000637872‏ ‎‡3  viafid‏