VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q42862190  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000213.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q42862190‏
024 ‎‡a  0000-0002-0131-4904‏ ‎‡2  orcid‏
035 ‎‡a  (OCoLC)Q42862190‏
100 0 ‎‡a  Nikolaus Schultz‏ ‎‡9  ast‏ ‎‡9  es‏ ‎‡9  sl‏
375 ‎‡a  1‏ ‎‡2  iso5218‏
400 0 ‎‡a  Nikolaus Schultz‏ ‎‡c  researcher‏ ‎‡9  en‏
400 0 ‎‡a  Nikolaus Schultz‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's 18F-fluorodeoxy-glucose positron emission tomography marks MYC-overexpressing human basal-like breast cancers‏
670 ‎‡a  Author's 3D clusters of somatic mutations in cancer reveal numerous rare mutations as functional targets‏
670 ‎‡a  Author's 53BP1 is a haploinsufficient tumor suppressor and protects cells from radiation response in glioma‏
670 ‎‡a  Author's A cluster of cooperating tumor-suppressor gene candidates in chromosomal deletions‏
670 ‎‡a  Author's A Multi-Method Approach for Proteomic Network Inference in 11 Human Cancers‏
670 ‎‡a  Author's Abstract 2608: Global integration of knowledgebases for clinical interpretation of cancer variants‏
670 ‎‡a  Author's Accelerating Discovery of Functional Mutant Alleles in Cancer‏
670 ‎‡a  Author's Adverse outcomes in clear cell renal cell carcinoma with mutations of 3p21 epigenetic regulators BAP1 and SETD2: a report by MSKCC and the KIRC TCGA research network‏
670 ‎‡a  Author's An epidemiologic and genomic investigation into the obesity paradox in renal cell carcinoma‏
670 ‎‡a  Author's Analysis of microRNA-target interactions across diverse cancer types‏
670 ‎‡a  Author's Analytic and clinical validation of a prostate cancer-enhanced messenger RNA detection assay in whole blood as a prognostic biomarker for survival‏
670 ‎‡a  Author's ARF Confers a Context-Dependent Response to Chemotherapy in Muscle-Invasive Bladder Cancer‏
670 ‎‡a  Author's Automated network analysis identifies core pathways in glioblastoma‏
670 ‎‡a  Author's BRCA1 immunohistochemistry in a molecularly characterized cohort of ovarian high-grade serous carcinomas‏
670 ‎‡a  Author's BridgeDb app: unifying identifier mapping services for Cytoscape‏
670 ‎‡a  Author's Cancer cells preferentially lose small chromosomes‏
670 ‎‡a  Author's Chemotherapy Resistance in Diffuse-Type Gastric Adenocarcinoma Is Mediated by RhoA Activation in Cancer Stem-Like Cells‏
670 ‎‡a  Author's Clinical and molecular characterization of patients with cancer of unknown primary in the modern era.‏
670 ‎‡a  Author's Clinical implementation of integrated whole-genome copy number and mutation profiling for glioblastoma‏
670 ‎‡a  Author's Clinical multiplexed exome sequencing distinguishes adult oligodendroglial neoplasms from astrocytic and mixed lineage gliomas‏
670 ‎‡a  Author's Clinical Sequencing Defines the Genomic Landscape of Metastatic Colorectal Cancer‏
670 ‎‡a  Author's Collection, integration and analysis of cancer genomic profiles: from data to insight‏
670 ‎‡a  Author's Comparative analysis of SV40 17kT and LT function in vivo demonstrates that LT's C-terminus re-programs hepatic gene expression and is necessary for tumorigenesis in the liver.‏
670 ‎‡a  Author's Comprehensive Analysis of Alternative Splicing Across Tumors from 8,705 Patients‏
670 ‎‡a  Author's Comprehensive analysis of long non-coding RNAs in ovarian cancer reveals global patterns and targeted DNA amplification‏
670 ‎‡a  Author's Comprehensive Characterization of Cancer Driver Genes and Mutations‏
670 ‎‡a  Author's Comprehensive Pan-Genomic Characterization of Adrenocortical Carcinoma‏
670 ‎‡a  Author's Conditional Selection of Genomic Alterations Dictates Cancer Evolution and Oncogenic Dependencies‏
670 ‎‡a  Author's Copy number alteration burden predicts prostate cancer relapse‏
670 ‎‡a  Author's Distinct patterns of dysregulated expression of enzymes involved in androgen synthesis and metabolism in metastatic prostate cancer tumors‏
670 ‎‡a  Author's Emerging landscape of oncogenic signatures across human cancers‏
670 ‎‡a  Author's ERF mutations reveal a balance of ETS factors controlling prostate oncogenesis‏
670 ‎‡a  Author's Evaluating cell lines as tumour models by comparison of genomic profiles‏
670 ‎‡a  Author's Exonuclease mutations in DNA polymerase epsilon reveal replication strand specific mutation patterns and human origins of replication‏
670 ‎‡a  Author's Expression of the Carboxy-Terminal Portion of MUC16/CA125 Induces Transformation and Tumor Invasion‏
670 ‎‡a  Author's Frequent alterations and epigenetic silencing of differentiation pathway genes in structurally rearranged liposarcomas‏
670 ‎‡a  Author's G2S: A web-service for annotating genomic variants on 3D protein structures‏
670 ‎‡a  Author's Genetic Determinants of Cisplatin Resistance in Patients With Advanced Germ Cell Tumors‏
670 ‎‡a  Author's Genome Nexus: A Comprehensive Resource for the Annotation and Interpretation of Genomic Variants in Cancer‏
670 ‎‡a  Author's Genome-wide analysis of noncoding regulatory mutations in cancer‏
670 ‎‡a  Author's Genomic Characterization of Upper Tract Urothelial Carcinoma‏
670 ‎‡a  Author's Genomic complexity and AKT dependence in serous ovarian cancer‏
670 ‎‡a  Author's Genomic correlates of clinical outcome in advanced prostate cancer.‏
670 ‎‡a  Author's Genomic Differences Between "Primary" and "Secondary" Muscle-invasive Bladder Cancer as a Basis for Disparate Outcomes to Cisplatin-based Neoadjuvant Chemotherapy‏
670 ‎‡a  Author's Genomic predictors of survival in patients with high-grade urothelial carcinoma of the bladder‏
670 ‎‡a  Author's Identification of low abundance microbiome in clinical samples using whole genome sequencing‏
670 ‎‡a  Author's Identification of PHLPP1 as a tumor suppressor reveals the role of feedback activation in PTEN-mutant prostate cancer progression‏
670 ‎‡a  Author's Identifying actionable targets through integrative analyses of GEM model and human prostate cancer genomic profiling‏
670 ‎‡a  Author's Identifying recurrent mutations in cancer reveals widespread lineage diversity and mutational specificity‏
670 ‎‡a  Author's Inherited DNA-Repair Gene Mutations in Men with Metastatic Prostate Cancer‏
670 ‎‡a  Author's Integrated analyses of microRNAs demonstrate their widespread influence on gene expression in high-grade serous ovarian carcinoma‏
670 ‎‡a  Author's Integrated genomic characterization of endometrial carcinoma‏
670 ‎‡a  Author's Integrated Molecular Characterization of Testicular Germ Cell Tumors‏
670 ‎‡a  Author's Integrating biological pathways and genomic profiles with ChiBE 2.‏
670 ‎‡a  Author's Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortal‏
670 ‎‡a  Author's Integrative clinical genomics of advanced prostate cancer‏
670 ‎‡a  Author's Integrative genome-wide analysis of the determinants of RNA splicing in kidney renal clear cell carcinoma‏
670 ‎‡a  Author's Integrative genomic profiling of human prostate cancer‏
670 ‎‡a  Author's Integrative subtype discovery in glioblastoma using iCluster‏
670 ‎‡a  Author's Loss of NF1 in cutaneous melanoma is associated with RAS activation and MEK dependence‏
670 ‎‡a  Author's Loss of the tyrosine phosphatase PTPRD leads to aberrant STAT3 activation and promotes gliomagenesis‏
670 ‎‡a  Author's Machine Learning Detects Pan-cancer Ras Pathway Activation in The Cancer Genome Atlas.‏
670 ‎‡a  Author's MEF promotes stemness in the pathogenesis of gliomas‏
670 ‎‡a  Author's Mitochondrial respiratory gene expression is suppressed in many cancers‏
670 ‎‡a  Author's MLH1-silenced and non-silenced subgroups of hypermutated colorectal carcinomas have distinct mutational landscapes‏
670 ‎‡a  Author's MLL3 is a haploinsufficient 7q tumor suppressor in acute myeloid leukemia‏
670 ‎‡a  Author's Molecular Determinants of Response to Anti-Programmed Cell Death‏
670 ‎‡a  Author's Molecular Determinants of Response to Anti-Programmed Cell Death (PD)-1 and Anti-Programmed Death-Ligand (PD-L)-Ligand 1 Blockade in Patients With Non-Small-Cell Lung Cancer Profiled With Targeted Next-Generation Sequencing‏
670 ‎‡a  Author's Molecular subtypes of uterine leiomyosarcoma and correlation with clinical outcome‏
670 ‎‡a  Author's Morphological characterization of colorectal cancers in The Cancer Genome Atlas reveals distinct morphology-molecular associations: clinical and biological implications‏
670 ‎‡a  Author's Multicenter Phase II Study of Temozolomide and Myeloablative Chemotherapy with Autologous Stem Cell Transplant for Newly Diagnosed Anaplastic Oligodendroglioma‏
670 ‎‡a  Author's Multiplexed immunofluorescence delineates proteomic cancer cell states associated with metabolism‏
670 ‎‡a  Author's MutationAligner: a resource of recurrent mutation hotspots in protein domains in cancer‏
670 ‎‡a  Author's Mutual exclusivity analysis identifies oncogenic network modules‏
670 ‎‡a  Author's Next-generation Sequencing of Nonmuscle Invasive Bladder Cancer Reveals Potential Biomarkers and Rational Therapeutic Targets‏
670 ‎‡a  Author's Off-target effects dominate a large-scale RNAi screen for modulators of the TGF-β pathway and reveal microRNA regulation of TGFBR2‏
670 ‎‡a  Author's Oncogenic Signaling Pathways in The Cancer Genome Atlas.‏
670 ‎‡a  Author's Oncologist use and perception of large panel next-generation tumor sequencing‏
670 ‎‡a  Author's Pan-Cancer Analysis of Mutation Hotspots in Protein Domains‏
670 ‎‡a  Author's Pathway Commons, a web resource for biological pathway data‏
670 ‎‡a  Author's PathwayMapper: a collaborative visual web editor for cancer pathways and genomic data‏
670 ‎‡a  Author's Pattern discovery and cancer gene identification in integrated cancer genomic data‏
670 ‎‡a  Author's PIK3CA mutations are associated with decreased benefit to neoadjuvant human epidermal growth factor receptor 2-targeted therapies in breast cancer‏
670 ‎‡a  Author's Prediction of individualized therapeutic vulnerabilities in cancer from genomic profiles‏
670 ‎‡a  Author's Prevalence and co-occurrence of actionable genomic alterations in high-grade bladder cancer‏
670 ‎‡a  Author's Publisher Correction: The long tail of oncogenic drivers in prostate cancer‏
670 ‎‡a  Author's Real-Time Genomic Profiling of Pancreatic Ductal Adenocarcinoma: Potential Actionability and Correlation with Clinical Phenotype‏
670 ‎‡a  Author's Recurrent SMARCA4 mutations in small cell carcinoma of the ovary.‏
670 ‎‡a  Author's Response to MET inhibitors in patients with stage IV lung adenocarcinomas harboring MET mutations causing exon 14 skipping‏
670 ‎‡a  Author's Small cell carcinomas of the bladder and lung are characterized by a convergent but distinct pathogenesis‏
670 ‎‡a  Author's Somatic mutations of the Parkinson's disease-associated gene PARK2 in glioblastoma and other human malignancies‏
670 ‎‡a  Author's SQSTM1 is a pathogenic target of 5q copy number gains in kidney cancer‏
670 ‎‡a  Author's Substantial interindividual and limited intraindividual genomic diversity among tumors from men with metastatic prostate cancer‏
670 ‎‡a  Author's Synthetic lethality in ATM-deficient RAD50-mutant tumors underlies outlier response to cancer therapy‏
670 ‎‡a  Author's Systematic identification of cancer driving signaling pathways based on mutual exclusivity of genomic alterations‏
670 ‎‡a  Author's The Cancer Genome Atlas Comprehensive Molecular Characterization of Renal Cell Carcinoma‏
670 ‎‡a  Author's The cBio cancer genomics portal: an open platform for exploring multidimensional cancer genomics data‏
670 ‎‡a  Author's The long tail of oncogenic drivers in prostate cancer.‏
670 ‎‡a  Author's The molecular diversity of Luminal A breast tumors‏
670 ‎‡a  Author's The mutational landscape of adenoid cystic carcinoma‏
670 ‎‡a  Author's The performance of BRCA1 immunohistochemistry for detecting germline, somatic, and epigenetic BRCA1 loss in high-grade serous ovarian cancer‏
670 ‎‡a  Author's The SS18-SSX Oncoprotein Hijacks KDM2B-PRC1.1 to Drive Synovial Sarcoma‏
670 ‎‡a  Author's The tyrosine phosphatase PTPRD is a tumor suppressor that is frequently inactivated and mutated in glioblastoma and other human cancers‏
670 ‎‡a  Author's Time to recurrence and survival in serous ovarian tumors predicted from integrated genomic profiles‏
670 ‎‡a  Author's Tumor genetic analyses of patients with metastatic renal cell carcinoma and extended benefit from mTOR inhibitor therapy‏
670 ‎‡a  Author's Unifying cancer and normal RNA sequencing data from different sources.‏
670 ‎‡a  Author's Using MEMo to discover mutual exclusivity modules in cancer‏
670 ‎‡a  Author's Will kinase inhibitors make it as glioblastoma drugs?‏
909 ‎‡a  (orcid) 0000000201314904‏ ‎‡9  1‏
912 ‎‡a  integrativeclinicalgenomicsofadvancedprostatecancer‏ ‎‡A  Integrative clinical genomics of advanced prostate cancer‏ ‎‡9  1‏
912 ‎‡a  cancergenomeatlascomprehensivemolecularcharacterizationofrenalcellcarcinoma‏ ‎‡A  The Cancer Genome Atlas Comprehensive Molecular Characterization of Renal Cell Carcinoma‏ ‎‡9  1‏
912 ‎‡a  comprehensiveanalysisofalternativesplicingacrosstumorsfrom8705patients‏ ‎‡A  Comprehensive Analysis of Alternative Splicing Across Tumors from 8,705 Patients‏ ‎‡9  1‏
912 ‎‡a  comprehensivecharacterizationofcancerdrivergenesandmutations‏ ‎‡A  Comprehensive Characterization of Cancer Driver Genes and Mutations‏ ‎‡9  1‏
912 ‎‡a  comprehensivepangenomiccharacterizationofadrenocorticalcarcinoma‏ ‎‡A  Comprehensive Pan-Genomic Characterization of Adrenocortical Carcinoma‏ ‎‡9  1‏
919 ‎‡a  erfmutationsrevealabalanceofetsfactorscontrollingprostateoncogenesis‏ ‎‡A  ERF mutations reveal a balance of ETS factors controlling prostate oncogenesis‏ ‎‡9  1‏
919 ‎‡a  mutationaligneraresourceofrecurrentmutationhotspotsinproteindomainsincancer‏ ‎‡A  MutationAligner: a resource of recurrent mutation hotspots in protein domains in cancer‏ ‎‡9  1‏
919 ‎‡a  moleculardeterminantsofresponsetoantiprogrammedcelldeath‏ ‎‡A  Molecular Determinants of Response to Anti-Programmed Cell Death‏ ‎‡9  1‏
919 ‎‡a  multiplexedimmunofluorescencedelineatesproteomiccancercellstatesassociatedwithmetabolism‏ ‎‡A  Multiplexed immunofluorescence delineates proteomic cancer cell states associated with metabolism‏ ‎‡9  1‏
919 ‎‡a  inheriteddnarepairgenemutationsinmenwithmetastaticprostatecancer‏ ‎‡A  Inherited DNA-Repair Gene Mutations in Men with Metastatic Prostate Cancer‏ ‎‡9  1‏
919 ‎‡a  multicenterphase2studyoftemozolomideandmyeloablativechemotherapywithautologousstemcelltransplantfornewlydiagnosedanaplasticoligodendroglioma‏ ‎‡A  Multicenter Phase II Study of Temozolomide and Myeloablative Chemotherapy with Autologous Stem Cell Transplant for Newly Diagnosed Anaplastic Oligodendroglioma‏ ‎‡9  1‏
919 ‎‡a  53bp1isahaploinsufficienttumorsuppressorandprotectscellsfromradiationresponseinglioma‏ ‎‡A  53BP1 is a haploinsufficient tumor suppressor and protects cells from radiation response in glioma‏ ‎‡9  1‏
919 ‎‡a  evaluatingcelllinesastumourmodelsbycomparisonofgenomicprofiles‏ ‎‡A  Evaluating cell lines as tumour models by comparison of genomic profiles‏ ‎‡9  1‏
919 ‎‡a  tyrosinephosphataseptprdisatumorsuppressorthatisfrequentlyinactivatedandmutatedinglioblastomaandotherhumancancers‏ ‎‡A  The tyrosine phosphatase PTPRD is a tumor suppressor that is frequently inactivated and mutated in glioblastoma and other human cancers‏ ‎‡9  1‏
919 ‎‡a  responsetometinhibitorsinpatientswithstage4lungadenocarcinomasharboringmetmutationscausingexon14skipping‏ ‎‡A  Response to MET inhibitors in patients with stage IV lung adenocarcinomas harboring MET mutations causing exon 14 skipping‏ ‎‡9  1‏
919 ‎‡a  integratedanalysesofmicrornasdemonstratetheirwidespreadinfluenceongeneexpressioninhighgradeserousovariancarcinoma‏ ‎‡A  Integrated analyses of microRNAs demonstrate their widespread influence on gene expression in high-grade serous ovarian carcinoma‏ ‎‡9  1‏
919 ‎‡a  3dclustersofsomaticmutationsincancerrevealnumerousraremutationsasfunctionaltargets‏ ‎‡A  3D clusters of somatic mutations in cancer reveal numerous rare mutations as functional targets‏ ‎‡9  1‏
919 ‎‡a  integratedgenomiccharacterizationofendometrialcarcinoma‏ ‎‡A  Integrated genomic characterization of endometrial carcinoma‏ ‎‡9  1‏
919 ‎‡a  integratedmolecularcharacterizationoftesticulargermcelltumors‏ ‎‡A  Integrated Molecular Characterization of Testicular Germ Cell Tumors‏ ‎‡9  1‏
919 ‎‡a  exonucleasemutationsindnapolymeraseepsilonrevealreplicationstrandspecificmutationpatternsandhumanoriginsofreplication‏ ‎‡A  Exonuclease mutations in DNA polymerase epsilon reveal replication strand specific mutation patterns and human origins of replication‏ ‎‡9  1‏
919 ‎‡a  18ffluorodeoxyglucosepositronemissiontomographymarksmycoverexpressinghumanbasallikebreastcancers‏ ‎‡A  18F-fluorodeoxy-glucose positron emission tomography marks MYC-overexpressing human basal-like breast cancers‏ ‎‡9  1‏
919 ‎‡a  expressionofthecarboxyterminalportionofmuc16ca125inducestransformationandtumorinvasion‏ ‎‡A  Expression of the Carboxy-Terminal Portion of MUC16/CA125 Induces Transformation and Tumor Invasion‏ ‎‡9  1‏
919 ‎‡a  frequentalterationsandepigeneticsilencingofdifferentiationpathwaygenesinstructurallyrearrangedliposarcomas‏ ‎‡A  Frequent alterations and epigenetic silencing of differentiation pathway genes in structurally rearranged liposarcomas‏ ‎‡9  1‏
919 ‎‡a  g2sawebserviceforannotatinggenomicvariantson3dproteinstructures‏ ‎‡A  G2S: A web-service for annotating genomic variants on 3D protein structures‏ ‎‡9  1‏
919 ‎‡a  tumorgeneticanalysesofpatientswithmetastaticrenalcellcarcinomaandextendedbenefitfrommtorinhibitortherapy‏ ‎‡A  Tumor genetic analyses of patients with metastatic renal cell carcinoma and extended benefit from mTOR inhibitor therapy‏ ‎‡9  1‏
919 ‎‡a  morphologicalcharacterizationofcolorectalcancersinthecancergenomeatlasrevealsdistinctmorphologymolecularassociationsclinicalandbiologicalimplications‏ ‎‡A  Morphological characterization of colorectal cancers in The Cancer Genome Atlas reveals distinct morphology-molecular associations: clinical and biological implications‏ ‎‡9  1‏
919 ‎‡a  geneticdeterminantsofcisplatinresistanceinpatientswithadvancedgermcelltumors‏ ‎‡A  Genetic Determinants of Cisplatin Resistance in Patients With Advanced Germ Cell Tumors‏ ‎‡9  1‏
919 ‎‡a  genomenexusacomprehensiveresourcefortheannotationandinterpretationofgenomicvariantsincancer‏ ‎‡A  Genome Nexus: A Comprehensive Resource for the Annotation and Interpretation of Genomic Variants in Cancer‏ ‎‡9  1‏
919 ‎‡a  genomewideanalysisofnoncodingregulatorymutationsincancer‏ ‎‡A  Genome-wide analysis of noncoding regulatory mutations in cancer‏ ‎‡9  1‏
919 ‎‡a  genomiccharacterizationofuppertracturothelialcarcinoma‏ ‎‡A  Genomic Characterization of Upper Tract Urothelial Carcinoma‏ ‎‡9  1‏
919 ‎‡a  integratingbiologicalpathwaysandgenomicprofileswithchibe2‏ ‎‡A  Integrating biological pathways and genomic profiles with ChiBE 2.‏ ‎‡9  1‏
919 ‎‡a  integrativeanalysisofcomplexcancergenomicsandclinicalprofilesusingthecbioportal‏ ‎‡A  Integrative analysis of complex cancer genomics and clinical profiles using the cBioPortal‏ ‎‡9  1‏
919 ‎‡a  genomiccomplexityandaktdependenceinserousovariancancer‏ ‎‡A  Genomic complexity and AKT dependence in serous ovarian cancer‏ ‎‡9  1‏
919 ‎‡a  integrativegenomewideanalysisofthedeterminantsofrnasplicinginkidneyrenalclearcellcarcinoma‏ ‎‡A  Integrative genome-wide analysis of the determinants of RNA splicing in kidney renal clear cell carcinoma‏ ‎‡9  1‏
919 ‎‡a  willkinaseinhibitorsmakeitasglioblastomadrugs‏ ‎‡A  Will kinase inhibitors make it as glioblastoma drugs?‏ ‎‡9  1‏
919 ‎‡a  integrativegenomicprofilingofhumanprostatecancer‏ ‎‡A  Integrative genomic profiling of human prostate cancer‏ ‎‡9  1‏
919 ‎‡a  genomiccorrelatesofclinicaloutcomeinadvancedprostatecancer‏ ‎‡A  Genomic correlates of clinical outcome in advanced prostate cancer.‏ ‎‡9  1‏
919 ‎‡a  integrativesubtypediscoveryinglioblastomausingicluster‏ ‎‡A  Integrative subtype discovery in glioblastoma using iCluster‏ ‎‡9  1‏
919 ‎‡a  mefpromotesstemnessinthepathogenesisofgliomas‏ ‎‡A  MEF promotes stemness in the pathogenesis of gliomas‏ ‎‡9  1‏
919 ‎‡a  genomicdifferencesbetweenprimaryandsecondarymuscleinvasivebladdercancerasabasisfordisparateoutcomestocisplatinbasedneoadjuvantchemotherapy‏ ‎‡A  Genomic Differences Between "Primary" and "Secondary" Muscle-invasive Bladder Cancer as a Basis for Disparate Outcomes to Cisplatin-based Neoadjuvant Chemotherapy‏ ‎‡9  1‏
919 ‎‡a  lossofnf1incutaneousmelanomaisassociatedwithrasactivationandmekdependence‏ ‎‡A  Loss of NF1 in cutaneous melanoma is associated with RAS activation and MEK dependence‏ ‎‡9  1‏
919 ‎‡a  ss18ssxoncoproteinhijackskdm2bprc11todrivesynovialsarcoma‏ ‎‡A  The SS18-SSX Oncoprotein Hijacks KDM2B-PRC1.1 to Drive Synovial Sarcoma‏ ‎‡9  1‏
919 ‎‡a  genomicpredictorsofsurvivalinpatientswithhighgradeurothelialcarcinomaofthebladder‏ ‎‡A  Genomic predictors of survival in patients with high-grade urothelial carcinoma of the bladder‏ ‎‡9  1‏
919 ‎‡a  machinelearningdetectspancancerraspathwayactivationinthecancergenomeatlas‏ ‎‡A  Machine Learning Detects Pan-cancer Ras Pathway Activation in The Cancer Genome Atlas.‏ ‎‡9  1‏
919 ‎‡a  recurrentsmarca4mutationsinsmallcellcarcinomaoftheovary‏ ‎‡A  Recurrent SMARCA4 mutations in small cell carcinoma of the ovary.‏ ‎‡9  1‏
919 ‎‡a  identificationoflowabundancemicrobiomeinclinicalsamplesusingwholegenomesequencing‏ ‎‡A  Identification of low abundance microbiome in clinical samples using whole genome sequencing‏ ‎‡9  1‏
919 ‎‡a  realtimegenomicprofilingofpancreaticductaladenocarcinomapotentialactionabilityandcorrelationwithclinicalphenotype‏ ‎‡A  Real-Time Genomic Profiling of Pancreatic Ductal Adenocarcinoma: Potential Actionability and Correlation with Clinical Phenotype‏ ‎‡9  1‏
919 ‎‡a  cbiocancergenomicsportalanopenplatformforexploringmultidimensionalcancergenomicsdata‏ ‎‡A  The cBio cancer genomics portal: an open platform for exploring multidimensional cancer genomics data‏ ‎‡9  1‏
919 ‎‡a  publishercorrectionthelongtailofoncogenicdriversinprostatecancer‏ ‎‡A  Publisher Correction: The long tail of oncogenic drivers in prostate cancer‏ ‎‡9  1‏
919 ‎‡a  usingmemotodiscovermutualexclusivitymodulesincancer‏ ‎‡A  Using MEMo to discover mutual exclusivity modules in cancer‏ ‎‡9  1‏
919 ‎‡a  identificationofphlpp1asatumorsuppressorrevealstheroleoffeedbackactivationinptenmutantprostatecancerprogression‏ ‎‡A  Identification of PHLPP1 as a tumor suppressor reveals the role of feedback activation in PTEN-mutant prostate cancer progression‏ ‎‡9  1‏
919 ‎‡a  longtailofoncogenicdriversinprostatecancer‏ ‎‡A  The long tail of oncogenic drivers in prostate cancer.‏ ‎‡9  1‏
919 ‎‡a  unifyingcancerandnormalrnasequencingdatafromdifferentsources‏ ‎‡A  Unifying cancer and normal RNA sequencing data from different sources.‏ ‎‡9  1‏
919 ‎‡a  identifyingactionabletargetsthroughintegrativeanalysesofgemmodelandhumanprostatecancergenomicprofiling‏ ‎‡A  Identifying actionable targets through integrative analyses of GEM model and human prostate cancer genomic profiling‏ ‎‡9  1‏
919 ‎‡a  moleculardiversityofluminalabreasttumors‏ ‎‡A  The molecular diversity of Luminal A breast tumors‏ ‎‡9  1‏
919 ‎‡a  mutationallandscapeofadenoidcysticcarcinoma‏ ‎‡A  The mutational landscape of adenoid cystic carcinoma‏ ‎‡9  1‏
919 ‎‡a  prevalenceandcooccurrenceofactionablegenomicalterationsinhighgradebladdercancer‏ ‎‡A  Prevalence and co-occurrence of actionable genomic alterations in high-grade bladder cancer‏ ‎‡9  1‏
919 ‎‡a  performanceofbrca1immunohistochemistryfordetectinggermlinesomaticandepigeneticbrca1lossinhighgradeserousovariancancer‏ ‎‡A  The performance of BRCA1 immunohistochemistry for detecting germline, somatic, and epigenetic BRCA1 loss in high-grade serous ovarian cancer‏ ‎‡9  1‏
919 ‎‡a  predictionofindividualizedtherapeuticvulnerabilitiesincancerfromgenomicprofiles‏ ‎‡A  Prediction of individualized therapeutic vulnerabilities in cancer from genomic profiles‏ ‎‡9  1‏
919 ‎‡a  molecularsubtypesofuterineleiomyosarcomaandcorrelationwithclinicaloutcome‏ ‎‡A  Molecular subtypes of uterine leiomyosarcoma and correlation with clinical outcome‏ ‎‡9  1‏
919 ‎‡a  systematicidentificationofcancerdrivingsignalingpathwaysbasedonmutualexclusivityofgenomicalterations‏ ‎‡A  Systematic identification of cancer driving signaling pathways based on mutual exclusivity of genomic alterations‏ ‎‡9  1‏
919 ‎‡a  syntheticlethalityinatmdeficientrad50mutanttumorsunderliesoutlierresponsetocancertherapy‏ ‎‡A  Synthetic lethality in ATM-deficient RAD50-mutant tumors underlies outlier response to cancer therapy‏ ‎‡9  1‏
919 ‎‡a  substantialinterindividualandlimitedintraindividualgenomicdiversityamongtumorsfrommenwithmetastaticprostatecancer‏ ‎‡A  Substantial interindividual and limited intraindividual genomic diversity among tumors from men with metastatic prostate cancer‏ ‎‡9  1‏
919 ‎‡a  timetorecurrenceandsurvivalinserousovariantumorspredictedfromintegratedgenomicprofiles‏ ‎‡A  Time to recurrence and survival in serous ovarian tumors predicted from integrated genomic profiles‏ ‎‡9  1‏
919 ‎‡a  mitochondrialrespiratorygeneexpressionissuppressedinmanycancers‏ ‎‡A  Mitochondrial respiratory gene expression is suppressed in many cancers‏ ‎‡9  1‏
919 ‎‡a  sqstm1isapathogenictargetof5qcopynumbergainsinkidneycancer‏ ‎‡A  SQSTM1 is a pathogenic target of 5q copy number gains in kidney cancer‏ ‎‡9  1‏
919 ‎‡a  lossofthetyrosinephosphataseptprdleadstoaberrantstat3activationandpromotesgliomagenesis‏ ‎‡A  Loss of the tyrosine phosphatase PTPRD leads to aberrant STAT3 activation and promotes gliomagenesis‏ ‎‡9  1‏
919 ‎‡a  somaticmutationsoftheparkinsonsdiseaseassociatedgenepark2inglioblastomaandotherhumanmalignancies‏ ‎‡A  Somatic mutations of the Parkinson's disease-associated gene PARK2 in glioblastoma and other human malignancies‏ ‎‡9  1‏
919 ‎‡a  pik3camutationsareassociatedwithdecreasedbenefittoneoadjuvanthumanepidermalgrowthfactorreceptor2targetedtherapiesinbreastcancer‏ ‎‡A  PIK3CA mutations are associated with decreased benefit to neoadjuvant human epidermal growth factor receptor 2-targeted therapies in breast cancer‏ ‎‡9  1‏
919 ‎‡a  smallcellcarcinomasofthebladderandlungarecharacterizedbyaconvergentbutdistinctpathogenesis‏ ‎‡A  Small cell carcinomas of the bladder and lung are characterized by a convergent but distinct pathogenesis‏ ‎‡9  1‏
919 ‎‡a  mll3isahaploinsufficient7qtumorsuppressorinacutemyeloidleukemia‏ ‎‡A  MLL3 is a haploinsufficient 7q tumor suppressor in acute myeloid leukemia‏ ‎‡9  1‏
919 ‎‡a  patterndiscoveryandcancergeneidentificationinintegratedcancergenomicdata‏ ‎‡A  Pattern discovery and cancer gene identification in integrated cancer genomic data‏ ‎‡9  1‏
919 ‎‡a  identifyingrecurrentmutationsincancerrevealswidespreadlineagediversityandmutationalspecificity‏ ‎‡A  Identifying recurrent mutations in cancer reveals widespread lineage diversity and mutational specificity‏ ‎‡9  1‏
919 ‎‡a  pathwaymapperacollaborativevisualwebeditorforcancerpathwaysandgenomicdata‏ ‎‡A  PathwayMapper: a collaborative visual web editor for cancer pathways and genomic data‏ ‎‡9  1‏
919 ‎‡a  pathwaycommonsawebresourceforbiologicalpathwaydata‏ ‎‡A  Pathway Commons, a web resource for biological pathway data‏ ‎‡9  1‏
919 ‎‡a  pancanceranalysisofmutationhotspotsinproteindomains‏ ‎‡A  Pan-Cancer Analysis of Mutation Hotspots in Protein Domains‏ ‎‡9  1‏
919 ‎‡a  bridgedbappunifyingidentifiermappingservicesforcytoscape‏ ‎‡A  BridgeDb app: unifying identifier mapping services for Cytoscape‏ ‎‡9  1‏
919 ‎‡a  brca1immunohistochemistryinamolecularlycharacterizedcohortofovarianhighgradeserouscarcinomas‏ ‎‡A  BRCA1 immunohistochemistry in a molecularly characterized cohort of ovarian high-grade serous carcinomas‏ ‎‡9  1‏
919 ‎‡a  automatednetworkanalysisidentifiescorepathwaysinglioblastoma‏ ‎‡A  Automated network analysis identifies core pathways in glioblastoma‏ ‎‡9  1‏
919 ‎‡a  arfconfersacontextdependentresponsetochemotherapyinmuscleinvasivebladdercancer‏ ‎‡A  ARF Confers a Context-Dependent Response to Chemotherapy in Muscle-Invasive Bladder Cancer‏ ‎‡9  1‏
919 ‎‡a  oncologistuseandperceptionoflargepanelnextgenerationtumorsequencing‏ ‎‡A  Oncologist use and perception of large panel next-generation tumor sequencing‏ ‎‡9  1‏
919 ‎‡a  oncogenicsignalingpathwaysinthecancergenomeatlas‏ ‎‡A  Oncogenic Signaling Pathways in The Cancer Genome Atlas.‏ ‎‡9  1‏
919 ‎‡a  offtargeteffectsdominatealargescalernaiscreenformodulatorsofthetgfβpathwayandrevealmicrornaregulationoftgfbr2‏ ‎‡A  Off-target effects dominate a large-scale RNAi screen for modulators of the TGF-β pathway and reveal microRNA regulation of TGFBR2‏ ‎‡9  1‏
919 ‎‡a  analyticandclinicalvalidationofaprostatecancerenhancedmessengerrnadetectionassayinwholebloodasaprognosticbiomarkerforsurvival‏ ‎‡A  Analytic and clinical validation of a prostate cancer-enhanced messenger RNA detection assay in whole blood as a prognostic biomarker for survival‏ ‎‡9  1‏
919 ‎‡a  analysisofmicrornatargetinteractionsacrossdiversecancertypes‏ ‎‡A  Analysis of microRNA-target interactions across diverse cancer types‏ ‎‡9  1‏
919 ‎‡a  epidemiologicandgenomicinvestigationintotheobesityparadoxinrenalcellcarcinoma‏ ‎‡A  An epidemiologic and genomic investigation into the obesity paradox in renal cell carcinoma‏ ‎‡9  1‏
919 ‎‡a  nextgenerationsequencingofnonmuscleinvasivebladdercancerrevealspotentialbiomarkersandrationaltherapeutictargets‏ ‎‡A  Next-generation Sequencing of Nonmuscle Invasive Bladder Cancer Reveals Potential Biomarkers and Rational Therapeutic Targets‏ ‎‡9  1‏
919 ‎‡a  cancercellspreferentiallylosesmallchromosomes‏ ‎‡A  Cancer cells preferentially lose small chromosomes‏ ‎‡9  1‏
919 ‎‡a  chemotherapyresistanceindiffusetypegastricadenocarcinomaismediatedbyrhoaactivationincancerstemlikecells‏ ‎‡A  Chemotherapy Resistance in Diffuse-Type Gastric Adenocarcinoma Is Mediated by RhoA Activation in Cancer Stem-Like Cells‏ ‎‡9  1‏
919 ‎‡a  clinicalandmolecularcharacterizationofpatientswithcancerofunknownprimaryinthemodernera‏ ‎‡A  Clinical and molecular characterization of patients with cancer of unknown primary in the modern era.‏ ‎‡9  1‏
919 ‎‡a  clinicalimplementationofintegratedwholegenomecopynumberandmutationprofilingforglioblastoma‏ ‎‡A  Clinical implementation of integrated whole-genome copy number and mutation profiling for glioblastoma‏ ‎‡9  1‏
919 ‎‡a  clinicalmultiplexedexomesequencingdistinguishesadultoligodendroglialneoplasmsfromastrocyticandmixedlineagegliomas‏ ‎‡A  Clinical multiplexed exome sequencing distinguishes adult oligodendroglial neoplasms from astrocytic and mixed lineage gliomas‏ ‎‡9  1‏
919 ‎‡a  clinicalsequencingdefinesthegenomiclandscapeofmetastaticcolorectalcancer‏ ‎‡A  Clinical Sequencing Defines the Genomic Landscape of Metastatic Colorectal Cancer‏ ‎‡9  1‏
919 ‎‡a  collectionintegrationandanalysisofcancergenomicprofilesfromdatatoinsight‏ ‎‡A  Collection, integration and analysis of cancer genomic profiles: from data to insight‏ ‎‡9  1‏
919 ‎‡a  comparativeanalysisofsv4017ktandltfunctioninvivodemonstratesthatlts100terminusreprogramshepaticgeneexpressionandisnecessaryfortumorigenesisintheliver‏ ‎‡A  Comparative analysis of SV40 17kT and LT function in vivo demonstrates that LT's C-terminus re-programs hepatic gene expression and is necessary for tumorigenesis in the liver.‏ ‎‡9  1‏
919 ‎‡a  mlh1silencedandnonsilencedsubgroupsofhypermutatedcolorectalcarcinomashavedistinctmutationallandscapes‏ ‎‡A  MLH1-silenced and non-silenced subgroups of hypermutated colorectal carcinomas have distinct mutational landscapes‏ ‎‡9  1‏
919 ‎‡a  moleculardeterminantsofresponsetoantiprogrammedcelldeathpd1andantiprogrammeddeathligandpd50ligand1blockadeinpatientswithnonsmallcelllungcancerprofiledwithtargetednextgenerationsequencing‏ ‎‡A  Molecular Determinants of Response to Anti-Programmed Cell Death (PD)-1 and Anti-Programmed Death-Ligand (PD-L)-Ligand 1 Blockade in Patients With Non-Small-Cell Lung Cancer Profiled With Targeted Next-Generation Sequencing‏ ‎‡9  1‏
919 ‎‡a  adverseoutcomesinclearcellrenalcellcarcinomawithmutationsof3p21epigeneticregulatorsbap1andsetd2areportbymskccandthekirctcgaresearchnetwork‏ ‎‡A  Adverse outcomes in clear cell renal cell carcinoma with mutations of 3p21 epigenetic regulators BAP1 and SETD2: a report by MSKCC and the KIRC TCGA research network‏ ‎‡9  1‏
919 ‎‡a  comprehensiveanalysisoflongnoncodingrnasinovariancancerrevealsglobalpatternsandtargeteddnaamplification‏ ‎‡A  Comprehensive analysis of long non-coding RNAs in ovarian cancer reveals global patterns and targeted DNA amplification‏ ‎‡9  1‏
919 ‎‡a  acceleratingdiscoveryoffunctionalmutantallelesincancer‏ ‎‡A  Accelerating Discovery of Functional Mutant Alleles in Cancer‏ ‎‡9  1‏
919 ‎‡a  abstract2608globalintegrationofknowledgebasesforclinicalinterpretationofcancervariants‏ ‎‡A  Abstract 2608: Global integration of knowledgebases for clinical interpretation of cancer variants‏ ‎‡9  1‏
919 ‎‡a  mutualexclusivityanalysisidentifiesoncogenicnetworkmodules‏ ‎‡A  Mutual exclusivity analysis identifies oncogenic network modules‏ ‎‡9  1‏
919 ‎‡a  conditionalselectionofgenomicalterationsdictatescancerevolutionandoncogenicdependencies‏ ‎‡A  Conditional Selection of Genomic Alterations Dictates Cancer Evolution and Oncogenic Dependencies‏ ‎‡9  1‏
919 ‎‡a  copynumberalterationburdenpredictsprostatecancerrelapse‏ ‎‡A  Copy number alteration burden predicts prostate cancer relapse‏ ‎‡9  1‏
919 ‎‡a  distinctpatternsofdysregulatedexpressionofenzymesinvolvedinandrogensynthesisandmetabolisminmetastaticprostatecancertumors‏ ‎‡A  Distinct patterns of dysregulated expression of enzymes involved in androgen synthesis and metabolism in metastatic prostate cancer tumors‏ ‎‡9  1‏
919 ‎‡a  multimethodapproachforproteomicnetworkinferencein11humancancers‏ ‎‡A  A Multi-Method Approach for Proteomic Network Inference in 11 Human Cancers‏ ‎‡9  1‏
919 ‎‡a  clusterofcooperatingtumorsuppressorgenecandidatesinchromosomaldeletions‏ ‎‡A  A cluster of cooperating tumor-suppressor gene candidates in chromosomal deletions‏ ‎‡9  1‏
919 ‎‡a  emerginglandscapeofoncogenicsignaturesacrosshumancancers‏ ‎‡A  Emerging landscape of oncogenic signatures across human cancers‏ ‎‡9  1‏
946 ‎‡a  b‏ ‎‡9  1‏
996 ‎‡2  J9U|987007460991805171‏
996 ‎‡2  ISNI|0000000382340887‏
996 ‎‡2  LC|n 95095810‏
996 ‎‡2  BIBSYS|90294310‏
996 ‎‡2  ISNI|0000000017353532‏
996 ‎‡2  NKC|mzk2006368056‏
996 ‎‡2  BNF|12681382‏
996 ‎‡2  DNB|121995267‏
996 ‎‡2  DNB|135298032‏
996 ‎‡2  LC|n 99042832‏
996 ‎‡2  LC|no 00079355‏
996 ‎‡2  RERO|A014088702‏
996 ‎‡2  ISNI|0000000094509916‏
996 ‎‡2  PLWABN|9810542315405606‏
996 ‎‡2  DNB|142023736‏
996 ‎‡2  RERO|A003809305‏
996 ‎‡2  RERO|A003809306‏
996 ‎‡2  RERO|A003809307‏
996 ‎‡2  DNB|172400503‏
996 ‎‡2  NII|DA0655545X‏
996 ‎‡2  B2Q|0000463422‏
996 ‎‡2  RERO|A006331305‏
996 ‎‡2  DBC|870979139792505‏
996 ‎‡2  ISNI|0000000489222733‏
996 ‎‡2  BIBSYS|90748705‏
996 ‎‡2  CAOONL|ncf10501979‏
996 ‎‡2  DNB|120852837‏
996 ‎‡2  DNB|121054993‏
996 ‎‡2  DNB|12318181X‏
996 ‎‡2  ISNI|0000000011974805‏
996 ‎‡2  BIBSYS|1005734‏
996 ‎‡2  SUDOC|096421908‏
996 ‎‡2  DNB|115887278X‏
996 ‎‡2  LC|no2019144161‏
996 ‎‡2  BIBSYS|90176102‏
996 ‎‡2  NUKAT|n 97059327‏
996 ‎‡2  NUKAT|n 2011105227‏
996 ‎‡2  ISNI|0000000016195886‏
996 ‎‡2  BIBSYS|97020965‏
996 ‎‡2  NUKAT|n 2019070869‏
996 ‎‡2  ISNI|0000000076722588‏
996 ‎‡2  DNB|122134214‏
996 ‎‡2  LC|no2004084550‏
996 ‎‡2  DNB|1052461670‏
996 ‎‡2  DNB|1052474128‏
996 ‎‡2  NUKAT|n 2020207721‏
996 ‎‡2  ISNI|0000000072903592‏
996 ‎‡2  DNB|115688389X‏
996 ‎‡2  NUKAT|n 2009702939‏
996 ‎‡2  PLWABN|9811799726705606‏
996 ‎‡2  NTA|069932271‏
996 ‎‡2  LC|n 82064575‏
996 ‎‡2  BNC|981058511992706706‏
996 ‎‡2  LC|no2010008626‏
996 ‎‡2  DNB|133320723‏
996 ‎‡2  ISNI|0000000114471602‏
996 ‎‡2  NSK|000483850‏
996 ‎‡2  DNB|129211982‏
996 ‎‡2  DNB|133164497‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏