VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q43274418  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241221010717.0
008     241221nneanz||abbn n and d
035 ‎‡a  (WKP)Q43274418‏
024 ‎‡a  0000-0002-6244-0891‏ ‎‡2  orcid‏
024 ‎‡a  7006682748‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q43274418‏
043 ‎‡c  PT‏
100 0 ‎‡a  Ana Maria Oliveira-Brett‏ ‎‡c  researcher, Portuguese chemist‏ ‎‡9  en‏
375 ‎‡a  2‏ ‎‡2  iso5218‏
400 0 ‎‡a  Ana Maria Oliveira-Brett‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
400 0 ‎‡a  Ana Maria Oliveira-Brett‏ ‎‡c  investigadora, química portuguesa‏ ‎‡9  pt‏
400 0 ‎‡a  Ana Maria Oliveira-Brett‏ ‎‡c  investigadora‏ ‎‡9  ast‏
400 0 ‎‡a  Ana Maria Oliveira-Brett‏ ‎‡c  investigadora‏ ‎‡9  es‏
670 ‎‡a  Author's A DNA-electrochemical biosensor for screening environmental damage caused by s-triazine derivatives‏
670 ‎‡a  Author's Adsorption of synthetic homo- and hetero-oligodeoxynucleotides onto highly oriented pyrolytic graphite: Atomic force microscopy characterization‏
670 ‎‡a  Author's AFM and electroanalytical studies of synthetic oligonucleotide hybridization.‏
670 ‎‡a  Author's AFM nanometer surface morphological study of in situ electropolymerized neutral red redox mediator oxysilane sol-gel encapsulated glucose oxidase electrochemical biosensors‏
670 ‎‡a  Author's Alzheimer's disease amyloid beta peptides in vitro electrochemical oxidation.‏
670 ‎‡a  Author's Amyloid Beta Peptide VHHQ, KLVFF, and IIGLMVGGVV Domains Involved in Fibrilization: AFM and Electrochemical Characterization.‏
670 ‎‡a  Author's Amyloid-β peptides time-dependent structural modifications: AFM and voltammetric characterization.‏
670 ‎‡a  Author's An impedance study of the adsorption of nucleic acid bases at glassy carbon electrodes‏
670 ‎‡a  Author's Anodic behavior of clioquinol at a glassy carbon electrode‏
670 ‎‡a  Author's Atomic force microscopy and anodic voltammetry characterization of a 49-mer diels-alderase ribozyme.‏
670 ‎‡a  Author's Atomic force microscopy characterization of an electrochemical DNA-biosensor‏
670 ‎‡a  Author's Boron doped diamond and glassy carbon electrodes comparative study of the oxidation behaviour of cysteine and methionine‏
670 ‎‡a  Author's Calcium-induced calmodulin conformational change. Electrochemical evaluation.‏
670 ‎‡a  Author's Caveolin proteins electrochemical oxidation and interaction with cholesterol‏
670 ‎‡a  Author's Development of an HPLC method with electrochemical detection of femtomoles of 8-oxo-7,8-dihydroguanine and 8-oxo-7,8-dihydro-2'-deoxyguanosine in the presence of uric acid‏
670 ‎‡a  Author's DNA imaged on a HOPG electrode surface by AFM with controlled potential.‏
670 ‎‡a  Author's DNA interaction with palladium chelates of biogenic polyamines using atomic force microscopy and voltammetric characterization.‏
670 ‎‡a  Author's Editorial‏
670 ‎‡a  Author's Electrochemical and AFM Characterization of G-Quadruplex Electrochemical Biosensors and Applications.‏
670 ‎‡a  Author's Electrochemical and spectroscopic studies of the oxidation mechanism of the herbicide propanil‏
670 ‎‡a  Author's Electrochemical behaviour of dimethyl-2-oxoglutarate on glassy carbon electrode‏
670 ‎‡a  Author's Electrochemical behaviour of isatin at a glassy carbon electrode‏
670 ‎‡a  Author's Electrochemical detection of in situ adriamycin oxidative damage to DNA.‏
670 ‎‡a  Author's Electrochemical determination of 8-oxoguanine in the presence of uric acid‏
670 ‎‡a  Author's Electrochemical evaluation of glutathione S-transferase kinetic parameters‏
670 ‎‡a  Author's Electrochemical oxidation mechanism of guanine and adenine using a glassy carbon microelectrode‏
670 ‎‡a  Author's Electrochemical oxidation of ochratoxin A at a glassy carbon electrode and in situ evaluation of the interaction with deoxyribonucleic acid using an electrochemical deoxyribonucleic acid-biosensor.‏
670 ‎‡a  Author's Electrochemical reduction mechanism of camptothecin at glassy carbon electrode.‏
670 ‎‡a  Author's Electrochemical sensing of DNA-adriamycin interactions‏
670 ‎‡a  Author's Electrochemical sensing of the behaviour of oligonucleotide lipoplexes at charged interfaces‏
670 ‎‡a  Author's Electrochemical study of quercetin-DNA interactions: part I. Analysis in incubated solutions‏
670 ‎‡a  Author's Electrochemical study of quercetin-DNA interactions: part II. In situ sensing with DNA biosensors‏
670 ‎‡a  Author's Electrochemistry of Alzheimer disease amyloid beta peptides‏
670 ‎‡a  Author's Electrochemistry of nanoscale DNA surface films on carbon‏
670 ‎‡a  Author's Evaluation of a glassy carbon electrode modified by a bilayer lipid membrane with incorporated DNA‏
670 ‎‡a  Author's Flavonoids electrochemical detection in fruit extracts and total antioxidant capacity evaluation‏
670 ‎‡a  Author's Flow Injection Electrochemical Determination of Apomorphine‏
670 ‎‡a  Author's In situ DNA oxidative damage by electrochemically generated hydroxyl free radicals on a boron-doped diamond electrode‏
670 ‎‡a  Author's In situ dsDNA-bevacizumab anticancer monoclonal antibody interaction electrochemical evaluation.‏
670 ‎‡a  Author's In situ electrochemical and AFM study of thalidomide-DNA interaction.‏
670 ‎‡a  Author's In situ electrochemical evaluation of anticancer drug temozolomide and its metabolites-DNA interaction.‏
670 ‎‡a  Author's In situ electrochemical evaluation of dsDNA interaction with the anticancer drug danusertib nitrenium radical product using the DNA-electrochemical biosensor‏
670 ‎‡a  Author's In situ evaluation of anticancer drug methotrexate–DNA interaction using a DNA-electrochemical biosensor and AFM characterization‏
670 ‎‡a  Author's In situ evaluation of chromium-DNA damage using a DNA-electrochemical biosensor.‏
670 ‎‡a  Author's In situ evaluation of gemcitabine-DNA interaction using a DNA-electrochemical biosensor‏
670 ‎‡a  Author's In situ evaluation of heavy metal-DNA interactions using an electrochemical DNA biosensor.‏
670 ‎‡a  Author's Interaction of imatinib with liposomes: voltammetric and AFM characterization.‏
670 ‎‡a  Author's Lipoic acid-palladium complex interaction with DNA, voltammetric and AFM characterization.‏
670 ‎‡a  Author's Microcystin-LR and chemically degraded microcystin-LR electrochemical oxidation‏
670 ‎‡a  Author's Natural phenolic antioxidants electrochemistry: Towards a new food science methodology‏
670 ‎‡a  Author's Nucleoside analogue electrochemical behaviour and in situ evaluation of DNA-clofarabine interaction‏
670 ‎‡a  Author's Oxidative behaviour of apomorphine and its metabolites.‏
670 ‎‡a  Author's Peptide methionine sulfoxide reductase A (MsrA): direct electrochemical oxidation on carbon electrodes‏
670 ‎‡a  Author's Pharmaceuticals released from senior residences: occurrence and risk evaluation.‏
670 ‎‡a  Author's Quadruplex Nanostructures of d‏
670 ‎‡a  Author's Quadruplex Nanostructures of d(TGGGGT): Influence of Sodium and Potassium Ions‏
670 ‎‡a  Author's Reduction of lapachones and their reaction with L-cysteine and mercaptoethanol on glassy carbon electrodes‏
670 ‎‡a  Author's Scanning probe microscopic imaging of guanine on a highly oriented pyrolytic graphite electrode‏
670 ‎‡a  Author's Self-assembled G-quadruplex nanostructures: AFM and voltammetric characterization.‏
670 ‎‡a  Author's Solid State Electrochemical Behavior of Usnic Acid at a Glassy Carbon Electrode‏
670 ‎‡a  Author's Spectroscopic and electrochemical studies of cocaine-opioid interactions‏
670 ‎‡a  Author's Synthetic oligonucleotides: AFM characterisation and electroanalytical studies‏
670 ‎‡a  Author's Thrombin-Binding Aptamer Quadruplex Formation: AFM and Voltammetric Characterization.‏
670 ‎‡a  Author's Triazole-acridine conjugates: redox mechanisms and in situ electrochemical evaluation of interaction with double-stranded DNA‏
670 ‎‡a  Author's Triazole-linked phenyl derivatives: redox mechanisms and in situ electrochemical evaluation of interaction with dsDNA‏
670 ‎‡a  Author's Ultrasound extracted flavonoids from four varieties of Portuguese red grape skins determined by reverse-phase high-performance liquid chromatography with electrochemical detection‏
670 ‎‡a  Author's Virgin olive oil ortho-phenols--electroanalytical quantification.‏
670 ‎‡a  Author's Voltammetric and impedance studies of inosine-5'-monophosphate and hypoxanthine.‏
670 ‎‡a  Author's Voltammetric determination of all DNA nucleotides‏
670 ‎‡a  Author's Voltammetric determination of gamma radiation-induced DNA damage‏
670 ‎‡a  Author's সম্পাদকীয়‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/DNB|1157350720‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/NUKAT|n 98098411‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/ISNI|0000000032512319‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/NTA|175871167‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/viaf/9921299‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/LC|n 92079880‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/SUDOC|03233494X‏
909 ‎‡a  (scopus) 7006682748‏ ‎‡9  1‏
909 ‎‡a  (orcid) 0000000262440891‏ ‎‡9  1‏
912 ‎‡a  সমপদকয‏ ‎‡A  সম্পাদকীয়‏ ‎‡9  1‏
912 ‎‡a  editorial‏ ‎‡A  Editorial‏ ‎‡9  1‏
919 ‎‡a  insituevaluationofanticancerdrugmethotrexatednainteractionusingadnaelectrochemicalbiosensorandafmcharacterization‏ ‎‡A  In situ evaluation of anticancer drug methotrexate–DNA interaction using a DNA-electrochemical biosensor and AFM characterization‏ ‎‡9  1‏
919 ‎‡a  insituevaluationofchromiumdnadamageusingadnaelectrochemicalbiosensor‏ ‎‡A  In situ evaluation of chromium-DNA damage using a DNA-electrochemical biosensor.‏ ‎‡9  1‏
919 ‎‡a  insituevaluationofgemcitabinednainteractionusingadnaelectrochemicalbiosensor‏ ‎‡A  In situ evaluation of gemcitabine-DNA interaction using a DNA-electrochemical biosensor‏ ‎‡9  1‏
919 ‎‡a  insituevaluationofheavymetaldnainteractionsusinganelectrochemicaldnabiosensor‏ ‎‡A  In situ evaluation of heavy metal-DNA interactions using an electrochemical DNA biosensor.‏ ‎‡9  1‏
919 ‎‡a  interactionofimatinibwithliposomesvoltammetricandafmcharacterization‏ ‎‡A  Interaction of imatinib with liposomes: voltammetric and AFM characterization.‏ ‎‡9  1‏
919 ‎‡a  lipoicacidpalladiumcomplexinteractionwithdnavoltammetricandafmcharacterization‏ ‎‡A  Lipoic acid-palladium complex interaction with DNA, voltammetric and AFM characterization.‏ ‎‡9  1‏
919 ‎‡a  microcystinlrandchemicallydegradedmicrocystinlrelectrochemicaloxidation‏ ‎‡A  Microcystin-LR and chemically degraded microcystin-LR electrochemical oxidation‏ ‎‡9  1‏
919 ‎‡a  naturalphenolicantioxidantselectrochemistrytowardsanewfoodsciencemethodology‏ ‎‡A  Natural phenolic antioxidants electrochemistry: Towards a new food science methodology‏ ‎‡9  1‏
919 ‎‡a  nucleosideanalogueelectrochemicalbehaviourandinsituevaluationofdnaclofarabineinteraction‏ ‎‡A  Nucleoside analogue electrochemical behaviour and in situ evaluation of DNA-clofarabine interaction‏ ‎‡9  1‏
919 ‎‡a  oxidativebehaviourofapomorphineanditsmetabolites‏ ‎‡A  Oxidative behaviour of apomorphine and its metabolites.‏ ‎‡9  1‏
919 ‎‡a  peptidemethioninesulfoxidereductaseamsradirectelectrochemicaloxidationoncarbonelectrodes‏ ‎‡A  Peptide methionine sulfoxide reductase A (MsrA): direct electrochemical oxidation on carbon electrodes‏ ‎‡9  1‏
919 ‎‡a  pharmaceuticalsreleasedfromseniorresidencesoccurrenceandriskevaluation‏ ‎‡A  Pharmaceuticals released from senior residences: occurrence and risk evaluation.‏ ‎‡9  1‏
919 ‎‡a  quadruplexnanostructuresof500‏ ‎‡A  Quadruplex Nanostructures of d‏ ‎‡9  1‏
919 ‎‡a  quadruplexnanostructuresof500tggggtinfluenceofsodiumandpotassiumions‏ ‎‡A  Quadruplex Nanostructures of d(TGGGGT): Influence of Sodium and Potassium Ions‏ ‎‡9  1‏
919 ‎‡a  reductionoflapachonesandtheirreactionwith50cysteineandmercaptoethanolonglassycarbonelectrodes‏ ‎‡A  Reduction of lapachones and their reaction with L-cysteine and mercaptoethanol on glassy carbon electrodes‏ ‎‡9  1‏
919 ‎‡a  scanningprobemicroscopicimagingofguanineonahighlyorientedpyrolyticgraphiteelectrode‏ ‎‡A  Scanning probe microscopic imaging of guanine on a highly oriented pyrolytic graphite electrode‏ ‎‡9  1‏
919 ‎‡a  selfassembledgquadruplexnanostructuresafmandvoltammetriccharacterization‏ ‎‡A  Self-assembled G-quadruplex nanostructures: AFM and voltammetric characterization.‏ ‎‡9  1‏
919 ‎‡a  solidstateelectrochemicalbehaviorofusnicacidataglassycarbonelectrode‏ ‎‡A  Solid State Electrochemical Behavior of Usnic Acid at a Glassy Carbon Electrode‏ ‎‡9  1‏
919 ‎‡a  spectroscopicandelectrochemicalstudiesofcocaineopioidinteractions‏ ‎‡A  Spectroscopic and electrochemical studies of cocaine-opioid interactions‏ ‎‡9  1‏
919 ‎‡a  syntheticoligonucleotidesafmcharacterisationandelectroanalyticalstudies‏ ‎‡A  Synthetic oligonucleotides: AFM characterisation and electroanalytical studies‏ ‎‡9  1‏
919 ‎‡a  thrombinbindingaptamerquadruplexformationafmandvoltammetriccharacterization‏ ‎‡A  Thrombin-Binding Aptamer Quadruplex Formation: AFM and Voltammetric Characterization.‏ ‎‡9  1‏
919 ‎‡a  triazoleacridineconjugatesredoxmechanismsandinsituelectrochemicalevaluationofinteractionwithdoublestrandeddna‏ ‎‡A  Triazole-acridine conjugates: redox mechanisms and in situ electrochemical evaluation of interaction with double-stranded DNA‏ ‎‡9  1‏
919 ‎‡a  triazolelinkedphenylderivativesredoxmechanismsandinsituelectrochemicalevaluationofinteractionwithdsdna‏ ‎‡A  Triazole-linked phenyl derivatives: redox mechanisms and in situ electrochemical evaluation of interaction with dsDNA‏ ‎‡9  1‏
919 ‎‡a  ultrasoundextractedflavonoidsfrom4varietiesofportugueseredgrapeskinsdeterminedbyreversephasehighperformanceliquidchromatographywithelectrochemicaldetection‏ ‎‡A  Ultrasound extracted flavonoids from four varieties of Portuguese red grape skins determined by reverse-phase high-performance liquid chromatography with electrochemical detection‏ ‎‡9  1‏
919 ‎‡a  virginoliveoilorthophenolselectroanalyticalquantification‏ ‎‡A  Virgin olive oil ortho-phenols--electroanalytical quantification.‏ ‎‡9  1‏
919 ‎‡a  voltammetricandimpedancestudiesofinosine5monophosphateandhypoxanthine‏ ‎‡A  Voltammetric and impedance studies of inosine-5'-monophosphate and hypoxanthine.‏ ‎‡9  1‏
919 ‎‡a  voltammetricdeterminationofalldnanucleotides‏ ‎‡A  Voltammetric determination of all DNA nucleotides‏ ‎‡9  1‏
919 ‎‡a  voltammetricdeterminationofgammaradiationinduceddnadamage‏ ‎‡A  Voltammetric determination of gamma radiation-induced DNA damage‏ ‎‡9  1‏
919 ‎‡a  electrochemicalstudyofquercetindnainteractionspart1analysisinincubatedsolutions‏ ‎‡A  Electrochemical study of quercetin-DNA interactions: part I. Analysis in incubated solutions‏ ‎‡9  1‏
919 ‎‡a  electrochemicalsensingofthebehaviourofoligonucleotidelipoplexesatchargedinterfaces‏ ‎‡A  Electrochemical sensing of the behaviour of oligonucleotide lipoplexes at charged interfaces‏ ‎‡9  1‏
919 ‎‡a  electrochemicalsensingofdnaadriamycininteractions‏ ‎‡A  Electrochemical sensing of DNA-adriamycin interactions‏ ‎‡9  1‏
919 ‎‡a  electrochemicalreductionmechanismofcamptothecinatglassycarbonelectrode‏ ‎‡A  Electrochemical reduction mechanism of camptothecin at glassy carbon electrode.‏ ‎‡9  1‏
919 ‎‡a  electrochemicaloxidationofochratoxinaataglassycarbonelectrodeandinsituevaluationoftheinteractionwithdeoxyribonucleicacidusinganelectrochemicaldeoxyribonucleicacidbiosensor‏ ‎‡A  Electrochemical oxidation of ochratoxin A at a glassy carbon electrode and in situ evaluation of the interaction with deoxyribonucleic acid using an electrochemical deoxyribonucleic acid-biosensor.‏ ‎‡9  1‏
919 ‎‡a  electrochemicaloxidationmechanismofguanineandadenineusingaglassycarbonmicroelectrode‏ ‎‡A  Electrochemical oxidation mechanism of guanine and adenine using a glassy carbon microelectrode‏ ‎‡9  1‏
919 ‎‡a  electrochemicalevaluationofglutathionestransferasekineticparameters‏ ‎‡A  Electrochemical evaluation of glutathione S-transferase kinetic parameters‏ ‎‡9  1‏
919 ‎‡a  electrochemicaldeterminationof8oxoguanineinthepresenceofuricacid‏ ‎‡A  Electrochemical determination of 8-oxoguanine in the presence of uric acid‏ ‎‡9  1‏
919 ‎‡a  electrochemicaldetectionofinsituadriamycinoxidativedamagetodna‏ ‎‡A  Electrochemical detection of in situ adriamycin oxidative damage to DNA.‏ ‎‡9  1‏
919 ‎‡a  electrochemicalbehaviourofisatinataglassycarbonelectrode‏ ‎‡A  Electrochemical behaviour of isatin at a glassy carbon electrode‏ ‎‡9  1‏
919 ‎‡a  electrochemicalbehaviourofdimethyl2oxoglutarateonglassycarbonelectrode‏ ‎‡A  Electrochemical behaviour of dimethyl-2-oxoglutarate on glassy carbon electrode‏ ‎‡9  1‏
919 ‎‡a  electrochemicalandspectroscopicstudiesoftheoxidationmechanismoftheherbicidepropanil‏ ‎‡A  Electrochemical and spectroscopic studies of the oxidation mechanism of the herbicide propanil‏ ‎‡9  1‏
919 ‎‡a  electrochemicalandafmcharacterizationofgquadruplexelectrochemicalbiosensorsandapplications‏ ‎‡A  Electrochemical and AFM Characterization of G-Quadruplex Electrochemical Biosensors and Applications.‏ ‎‡9  1‏
919 ‎‡a  dnainteractionwithpalladiumchelatesofbiogenicpolyaminesusingatomicforcemicroscopyandvoltammetriccharacterization‏ ‎‡A  DNA interaction with palladium chelates of biogenic polyamines using atomic force microscopy and voltammetric characterization.‏ ‎‡9  1‏
919 ‎‡a  dnaimagedonahopgelectrodesurfacebyafmwithcontrolledpotential‏ ‎‡A  DNA imaged on a HOPG electrode surface by AFM with controlled potential.‏ ‎‡9  1‏
919 ‎‡a  developmentofanhplcmethodwithelectrochemicaldetectionoffemtomolesof8oxo78dihydroguanineand8oxo78dihydro2deoxyguanosineinthepresenceofuricacid‏ ‎‡A  Development of an HPLC method with electrochemical detection of femtomoles of 8-oxo-7,8-dihydroguanine and 8-oxo-7,8-dihydro-2'-deoxyguanosine in the presence of uric acid‏ ‎‡9  1‏
919 ‎‡a  caveolinproteinselectrochemicaloxidationandinteractionwithcholesterol‏ ‎‡A  Caveolin proteins electrochemical oxidation and interaction with cholesterol‏ ‎‡9  1‏
919 ‎‡a  calciuminducedcalmodulinconformationalchangeelectrochemicalevaluation‏ ‎‡A  Calcium-induced calmodulin conformational change. Electrochemical evaluation.‏ ‎‡9  1‏
919 ‎‡a  borondopeddiamondandglassycarbonelectrodescomparativestudyoftheoxidationbehaviourofcysteineandmethionine‏ ‎‡A  Boron doped diamond and glassy carbon electrodes comparative study of the oxidation behaviour of cysteine and methionine‏ ‎‡9  1‏
919 ‎‡a  atomicforcemicroscopycharacterizationofanelectrochemicaldnabiosensor‏ ‎‡A  Atomic force microscopy characterization of an electrochemical DNA-biosensor‏ ‎‡9  1‏
919 ‎‡a  atomicforcemicroscopyandanodicvoltammetrycharacterizationofa49merdielsalderaseribozyme‏ ‎‡A  Atomic force microscopy and anodic voltammetry characterization of a 49-mer diels-alderase ribozyme.‏ ‎‡9  1‏
919 ‎‡a  anodicbehaviorofclioquinolataglassycarbonelectrode‏ ‎‡A  Anodic behavior of clioquinol at a glassy carbon electrode‏ ‎‡9  1‏
919 ‎‡a  impedancestudyoftheadsorptionofnucleicacidbasesatglassycarbonelectrodes‏ ‎‡A  An impedance study of the adsorption of nucleic acid bases at glassy carbon electrodes‏ ‎‡9  1‏
919 ‎‡a  amyloidβpeptidestimedependentstructuralmodificationsafmandvoltammetriccharacterization‏ ‎‡A  Amyloid-β peptides time-dependent structural modifications: AFM and voltammetric characterization.‏ ‎‡9  1‏
919 ‎‡a  amyloidbetapeptidevhhqklvffandiiglmvggvvdomainsinvolvedinfibrilizationafmandelectrochemicalcharacterization‏ ‎‡A  Amyloid Beta Peptide VHHQ, KLVFF, and IIGLMVGGVV Domains Involved in Fibrilization: AFM and Electrochemical Characterization.‏ ‎‡9  1‏
919 ‎‡a  alzheimersdiseaseamyloidbetapeptidesinvitroelectrochemicaloxidation‏ ‎‡A  Alzheimer's disease amyloid beta peptides in vitro electrochemical oxidation.‏ ‎‡9  1‏
919 ‎‡a  afmnanometersurfacemorphologicalstudyofinsituelectropolymerizedneutralredredoxmediatoroxysilanesolgelencapsulatedglucoseoxidaseelectrochemicalbiosensors‏ ‎‡A  AFM nanometer surface morphological study of in situ electropolymerized neutral red redox mediator oxysilane sol-gel encapsulated glucose oxidase electrochemical biosensors‏ ‎‡9  1‏
919 ‎‡a  afmandelectroanalyticalstudiesofsyntheticoligonucleotidehybridization‏ ‎‡A  AFM and electroanalytical studies of synthetic oligonucleotide hybridization.‏ ‎‡9  1‏
919 ‎‡a  adsorptionofsynthetichomoandheterooligodeoxynucleotidesontohighlyorientedpyrolyticgraphiteatomicforcemicroscopycharacterization‏ ‎‡A  Adsorption of synthetic homo- and hetero-oligodeoxynucleotides onto highly oriented pyrolytic graphite: Atomic force microscopy characterization‏ ‎‡9  1‏
919 ‎‡a  dnaelectrochemicalbiosensorforscreeningenvironmentaldamagecausedbystriazinederivatives‏ ‎‡A  A DNA-electrochemical biosensor for screening environmental damage caused by s-triazine derivatives‏ ‎‡9  1‏
919 ‎‡a  electrochemicalstudyofquercetindnainteractionspart2insitusensingwithdnabiosensors‏ ‎‡A  Electrochemical study of quercetin-DNA interactions: part II. In situ sensing with DNA biosensors‏ ‎‡9  1‏
919 ‎‡a  electrochemistryofalzheimerdiseaseamyloidbetapeptides‏ ‎‡A  Electrochemistry of Alzheimer disease amyloid beta peptides‏ ‎‡9  1‏
919 ‎‡a  electrochemistryofnanoscalednasurfacefilmsoncarbon‏ ‎‡A  Electrochemistry of nanoscale DNA surface films on carbon‏ ‎‡9  1‏
919 ‎‡a  evaluationofaglassycarbonelectrodemodifiedbyabilayerlipidmembranewithincorporateddna‏ ‎‡A  Evaluation of a glassy carbon electrode modified by a bilayer lipid membrane with incorporated DNA‏ ‎‡9  1‏
919 ‎‡a  flavonoidselectrochemicaldetectioninfruitextractsandtotalantioxidantcapacityevaluation‏ ‎‡A  Flavonoids electrochemical detection in fruit extracts and total antioxidant capacity evaluation‏ ‎‡9  1‏
919 ‎‡a  flowinjectionelectrochemicaldeterminationofapomorphine‏ ‎‡A  Flow Injection Electrochemical Determination of Apomorphine‏ ‎‡9  1‏
919 ‎‡a  insitudnaoxidativedamagebyelectrochemicallygeneratedhydroxylfreeradicalsonaborondopeddiamondelectrode‏ ‎‡A  In situ DNA oxidative damage by electrochemically generated hydroxyl free radicals on a boron-doped diamond electrode‏ ‎‡9  1‏
919 ‎‡a  insitudsdnabevacizumabanticancermonoclonalantibodyinteractionelectrochemicalevaluation‏ ‎‡A  In situ dsDNA-bevacizumab anticancer monoclonal antibody interaction electrochemical evaluation.‏ ‎‡9  1‏
919 ‎‡a  insituelectrochemicalandafmstudyofthalidomidednainteraction‏ ‎‡A  In situ electrochemical and AFM study of thalidomide-DNA interaction.‏ ‎‡9  1‏
919 ‎‡a  insituelectrochemicalevaluationofanticancerdrugtemozolomideanditsmetabolitesdnainteraction‏ ‎‡A  In situ electrochemical evaluation of anticancer drug temozolomide and its metabolites-DNA interaction.‏ ‎‡9  1‏
919 ‎‡a  insituelectrochemicalevaluationofdsdnainteractionwiththeanticancerdrugdanusertibnitreniumradicalproductusingthednaelectrochemicalbiosensor‏ ‎‡A  In situ electrochemical evaluation of dsDNA interaction with the anticancer drug danusertib nitrenium radical product using the DNA-electrochemical biosensor‏ ‎‡9  1‏
946 ‎‡a  a‏ ‎‡9  1‏
947 ‎‡a  PT‏ ‎‡9  1‏
996 ‎‡2  BNF|17700494‏
996 ‎‡2  BNC|981061199766906706‏
996 ‎‡2  CAOONL|ncf12071071‏
996 ‎‡2  DNB|1284001970‏
996 ‎‡2  NTA|317149318‏
996 ‎‡2  LIH|LNB:BI_h_L;=BV‏
996 ‎‡2  SUDOC|03233494X‏
996 ‎‡2  SIMACOB|299727715‏
996 ‎‡2  ISNI|0000000456528111‏
996 ‎‡2  LC|no2005009027‏
996 ‎‡2  DBC|87097939329662‏
996 ‎‡2  SELIBR|389671‏
996 ‎‡2  DNB|1035211440‏
996 ‎‡2  NDL|001252033‏
996 ‎‡2  BNF|14082717‏
996 ‎‡2  ISNI|0000000032512319‏
996 ‎‡2  LC|no2014134493‏
996 ‎‡2  SUDOC|251588971‏
996 ‎‡2  DNB|1158185642‏
996 ‎‡2  PTBNP|1658967‏
996 ‎‡2  RERO|A027324653‏
996 ‎‡2  BNF|12338456‏
996 ‎‡2  NSK|000681042‏
996 ‎‡2  NUKAT|n 2017077226‏
996 ‎‡2  B2Q|0001304448‏
996 ‎‡2  ISNI|0000000068101335‏
996 ‎‡2  PTBNP|221389‏
996 ‎‡2  ISNI|0000000368893530‏
996 ‎‡2  PLWABN|9810555493305606‏
996 ‎‡2  NKC|hka2017937986‏
996 ‎‡2  LC|no2005103246‏
996 ‎‡2  LIH|LNB:C_i_4_i_;=B_p_‏
996 ‎‡2  J9U|987007361254305171‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏
998 ‎‡a  برت، أنا ماريا أوليفيرا‏ ‎‡2  EGAXA|Balis1820693‏ ‎‡3  viafid‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  SUDOC|03233494X‏ ‎‡3  suggested‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  CAOONL|ncf12099341‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  LC|n 92079880‏ ‎‡3  suggested‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  DNB|1157350720‏ ‎‡3  suggested‏ ‎‡3  standard number‏
998 ‎‡a  Brett, Ana Maria Oliveira.‏ ‎‡2  NUKAT|n 98098411‏ ‎‡3  suggested‏ ‎‡3  viafid‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  J9U|987007425818905171‏ ‎‡3  suggested‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  برت، أنا ماريا أوليفيرا‏ ‎‡2  J9U|987007425818905171‏ ‎‡3  suggested‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  ISNI|0000000032512319‏ ‎‡3  suggested‏
998 ‎‡a  Oliveira Brett, Ana Maria‏ ‎‡2  ISNI|0000000032512319‏ ‎‡3  suggested‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  BIBSYS|90734245‏ ‎‡3  viafid‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Brett, Ana Maria Oliveira‏ ‎‡2  RERO|A003041999‏ ‎‡3  title: (0.68, 'electrochemistry', 'electrochemistryofnanoscalednasurfacefilmsoncarbon')‏
998 ‎‡a  Oliveira Brett, Ana Maria‏ ‎‡2  NTA|175871167‏ ‎‡3  suggested‏