VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q44227553  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000214.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q44227553‏
024 ‎‡a  0000-0003-2668-4992‏ ‎‡2  orcid‏
024 ‎‡a  7402929540‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q44227553‏
100 0 ‎‡a  Morten Agertoug Nielsen‏ ‎‡9  ast‏ ‎‡9  es‏ ‎‡9  sl‏
375 ‎‡a  1‏ ‎‡2  iso5218‏
400 0 ‎‡a  Morten Agertoug Nielsen‏ ‎‡c  researcher‏ ‎‡9  en‏
400 0 ‎‡a  Morten Agertoug Nielsen‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's 4-Aminoquinoline derivatives: Synthesis, in vitro and in vivo antiplasmodial activity against chloroquine-resistant parasites‏
670 ‎‡a  Author's A Novel Virus-Like Particle Based Vaccine Platform Displaying the Placental Malaria Antigen VAR2CSA.‏
670 ‎‡a  Author's A proof-of-concept study for the design of a VLP-based combinatorial HPV and placental malaria vaccine‏
670 ‎‡a  Author's A sub-family of common and highly conserved Plasmodium falciparum var genes.‏
670 ‎‡a  Author's A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice‏
670 ‎‡a  Author's Adhesion of Plasmodium falciparum infected erythrocytes in ex vivo perfused placental tissue: a novel model of placental malaria‏
670 ‎‡a  Author's An upstream open reading frame controls translation of var2csa, a gene implicated in placental malaria‏
670 ‎‡a  Author's Bacterial superglue enables easy development of efficient virus-like particle based vaccines‏
670 ‎‡a  Author's Bacterial superglue generates a full-length circumsporozoite protein virus-like particle vaccine capable of inducing high and durable antibody responses‏
670 ‎‡a  Author's Baculovirus-expressed constructs induce immunoglobulin G that recognizes VAR2CSA on Plasmodium falciparum-infected erythrocytes‏
670 ‎‡a  Author's Burkitt lymphoma expresses oncofetal chondroitin sulfate without being a reservoir for placental malaria sequestration‏
670 ‎‡a  Author's Can any lessons be learned from the ambiguous glycan binding of PfEMP1 domains?‏
670 ‎‡a  Author's Capsid-like particles decorated with the SARS-CoV-2 receptor-binding domain elicit strong virus neutralization activity‏
670 ‎‡a  Author's Changes in var gene mRNA levels during erythrocytic development in two phenotypically distinct Plasmodium falciparum parasites‏
670 ‎‡a  Author's Chondroitin sulphate A‏
670 ‎‡a  Author's Chondroitin sulphate A (CSA)-binding of single recombinant Duffy-binding-like domains is not restricted to Plasmodium falciparum Erythrocyte Membrane Protein 1 expressed by CSA-binding parasites‏
670 ‎‡a  Author's Clinical development of a VAR2CSA-based placental malaria vaccine PAMVAC: Quantifying vaccine antigen-specific memory B & T cell activity in Beninese primigravidae‏
670 ‎‡a  Author's Clinical development of placental malaria vaccines and immunoassays harmonization: a workshop report‏
670 ‎‡a  Author's Comparison of functional assays used in the clinical development of a placental malaria vaccine‏
670 ‎‡a  Author's Cross-Species Immune Recognition Between Plasmodium vivax Duffy Binding Protein Antibodies and the Plasmodium falciparum Surface Antigen VAR2CSA‏
670 ‎‡a  Author's Cryo-EM reveals the architecture of placental malaria VAR2CSA and provides molecular insight into chondroitin sulfate binding‏
670 ‎‡a  Author's Cytoadhesion of Plasmodium falciparum-infected erythrocytes to chondroitin-4-sulfate is cooperative and shear enhanced‏
670 ‎‡a  Author's Determinants of variant surface antigen antibody response in severe Plasmodium falciparum malaria in an area of low and unstable malaria transmission‏
670 ‎‡a  Author's Development of a Drosophila S2 insect-cell based placental malaria vaccine production process.‏
670 ‎‡a  Author's Differences in human antibody reactivity to Plasmodium falciparum variant surface antigens are dependent on age and malaria transmission intensity in northeastern Tanzania‏
670 ‎‡a  Author's Differential adhesion-inhibitory patterns of antibodies raised against two major variants of the NTS-DBL2X region of VAR2CSA.‏
670 ‎‡a  Author's Differential induction of functional IgG using the Plasmodium falciparum placental malaria vaccine candidate VAR2CSA‏
670 ‎‡a  Author's Differential induction of immunoglobulin G to Plasmodium falciparum variant surface antigens during the transmission season in Daraweesh, Sudan‏
670 ‎‡a  Author's Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration‏
670 ‎‡a  Author's Ethnomedicinal survey and in vitro anti-plasmodial activity of the palm Borassus aethiopum Mart‏
670 ‎‡a  Author's Evidence for the involvement of VAR2CSA in pregnancy-associated malaria‏
670 ‎‡a  Author's First-in-human, Randomized, Double-blind Clinical Trial of Differentially Adjuvanted PAMVAC, A Vaccine Candidate to Prevent Pregnancy-associated Malaria‏
670 ‎‡a  Author's Full-length recombinant Plasmodium falciparum VAR2CSA binds specifically to CSPG and induces potent parasite adhesion-blocking antibodies‏
670 ‎‡a  Author's Geographical and temporal conservation of antibody recognition of Plasmodium falciparum variant surface antigens‏
670 ‎‡a  Author's High efficacy of anti DBL4ɛ-VAR2CSA antibodies in inhibition of CSA-binding Plasmodium falciparum-infected erythrocytes from pregnant women‏
670 ‎‡a  Author's High-Throughput Testing of Antibody-Dependent Binding Inhibition of Placental Malaria Parasites‏
670 ‎‡a  Author's Human pregnancy-associated malaria-specific B cells target polymorphic, conformational epitopes in VAR2CSA‏
670 ‎‡a  Author's Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA‏
670 ‎‡a  Author's Identification of a Major Dimorphic Region in the Functionally Critical N-Terminal ID1 Domain of VAR2CSA.‏
670 ‎‡a  Author's Identification of glycosaminoglycan binding regions in the Plasmodium falciparum encoded placental sequestration ligand, VAR2CSA‏
670 ‎‡a  Author's Improving the malaria transmission-blocking activity of a Plasmodium falciparum 48/45 based vaccine antigen by SpyTag/SpyCatcher mediated virus-like display‏
670 ‎‡a  Author's In vitro selection of Plasmodium falciparum 3D7 for expression of variant surface antigens associated with severe malaria in African children‏
670 ‎‡a  Author's Induction of adhesion-inhibitory antibodies against placental Plasmodium falciparum parasites by using single domains of VAR2CSA.‏
670 ‎‡a  Author's Mannose-Binding Lectin Is a Disease Modifier in Clinical Malaria and May Function as Opsonin for Plasmodium falciparum- Infected Erythrocytes‏
670 ‎‡a  Author's Marchantin A, a macrocyclic bisbibenzyl ether, isolated from the liverwort Marchantia polymorpha, inhibits protozoal growth in vitro‏
670 ‎‡a  Author's Multilaboratory approach to preclinical evaluation of vaccine immunogens for placental malaria‏
670 ‎‡a  Author's Multiple var2csa-type PfEMP1 genes located at different chromosomal loci occur in many Plasmodium falciparum isolates‏
670 ‎‡a  Author's Novel adenovirus encoded virus-like particles displaying the placental malaria associated VAR2CSA antigen‏
670 ‎‡a  Author's Persistent Plasmodium falciparum Infection in Women With an Intent to Become Pregnant as a Risk Factor for Pregnancy-associated Malaria‏
670 ‎‡a  Author's Persistent Plasmodium falciparum infection in women with an intent to become pregnant is a risk factor for pregnancy-associated malaria.‏
670 ‎‡a  Author's Pfs230 and Pfs48/45 Fusion Proteins Elicit Strong Transmission-Blocking Antibody Responses Against Plasmodium falciparum.‏
670 ‎‡a  Author's Placental Sequestration of Plasmodium falciparum Malaria Parasites Is Mediated by the Interaction Between VAR2CSA and Chondroitin Sulfate A on Syndecan-1‏
670 ‎‡a  Author's Plasmodium falciparum associated with severe childhood malaria preferentially expresses PfEMP1 encoded by group A var genes‏
670 ‎‡a  Author's Plasmodium falciparum expressing domain cassette 5 type PfEMP1‏
670 ‎‡a  Author's Plasmodium falciparum expressing domain cassette 5 type PfEMP1 (DC5-PfEMP1) bind PECAM1.‏
670 ‎‡a  Author's Plasmodium falciparum infection early in pregnancy has profound consequences for foetal growth‏
670 ‎‡a  Author's Plasmodium falciparum transcriptome analysis reveals pregnancy malaria associated gene expression‏
670 ‎‡a  Author's Plasmodium falciparum: VAR2CSA expressed during pregnancy-associated malaria is partially resistant to proteolytic cleavage by trypsin‏
670 ‎‡a  Author's Plasmodium falciparum variant surface antigen expression varies between isolates causing severe and nonsevere malaria and is modified by acquired immunity‏
670 ‎‡a  Author's Positive selection of Plasmodium falciparum parasites with multiple var2csa-type PfEMP1 genes during the course of infection in pregnant women‏
670 ‎‡a  Author's Pre-clinical and clinical development of the first placental malaria vaccine‏
670 ‎‡a  Author's Preferential transcription of conserved rif genes in two phenotypically distinct Plasmodium falciparum parasite lines‏
670 ‎‡a  Author's Protective Antibodies against Placental Malaria and Poor Outcomes during Pregnancy, Benin‏
670 ‎‡a  Author's Several domains from VAR2CSA can induce Plasmodium falciparum adhesion-blocking antibodies‏
670 ‎‡a  Author's Severe malaria is associated with parasite binding to endothelial protein C receptor‏
670 ‎‡a  Author's Specificity and cross-reactivity of Plasmodium falciparum variant surface antigen-specific antibody responses‏
670 ‎‡a  Author's Structural and functional insight into how the Plasmodium falciparum VAR2CSA protein mediates binding to chondroitin sulfate A in placental malaria.‏
670 ‎‡a  Author's Structural insight into epitopes in the pregnancy-associated malaria protein VAR2CSA‏
670 ‎‡a  Author's Structure function analysis of P. falciparum VAR2CSA.‏
670 ‎‡a  Author's Targeting Human Cancer by a Glycosaminoglycan Binding Malaria Protein‏
670 ‎‡a  Author's The chondroitin sulfate A-binding site of the VAR2CSA protein involves multiple N-terminal domains‏
670 ‎‡a  Author's The effect of adjuvants on the immune response induced by a DBL4ɛ-ID4 VAR2CSA based Plasmodium falciparum vaccine against placental malaria.‏
670 ‎‡a  Author's The Influence of Sub-Unit Composition and Expression System on the Functional Antibody Response in the Development of a VAR2CSA Based Plasmodium falciparum Placental Malaria Vaccine‏
670 ‎‡a  Author's The NTS-DBL2X region of VAR2CSA induces cross-reactive antibodies that inhibit adhesion of several Plasmodium falciparum isolates to chondroitin sulfate A.‏
670 ‎‡a  Author's The VAR2CSA malaria protein efficiently retrieves circulating tumor cells in an EpCAM-independent manner‏
670 ‎‡a  Author's Utilizing nanobody technology to target non-immunodominant domains of VAR2CSA.‏
670 ‎‡a  Author's VAR2CSA expression on the surface of placenta-derived Plasmodium falciparum-infected erythrocytes‏
670 ‎‡a  Author's Virus-like particle display of HER2 induces potent anti-cancer responses.‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/DNB|1122674295‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/viaf/5412148390881710830009‏
909 ‎‡a  (scopus) 7402929540‏ ‎‡9  1‏
909 ‎‡a  (orcid) 0000000326684992‏ ‎‡9  1‏
919 ‎‡a  persistentplasmodiumfalciparuminfectioninwomenwithanintenttobecomepregnantisariskfactorforpregnancyassociatedmalaria‏ ‎‡A  Persistent Plasmodium falciparum infection in women with an intent to become pregnant is a risk factor for pregnancy-associated malaria.‏ ‎‡9  1‏
919 ‎‡a  viruslikeparticledisplayofher2inducespotentanticancerresponses‏ ‎‡A  Virus-like particle display of HER2 induces potent anti-cancer responses.‏ ‎‡9  1‏
919 ‎‡a  var2csaexpressiononthesurfaceofplacentaderivedplasmodiumfalciparuminfectederythrocytes‏ ‎‡A  VAR2CSA expression on the surface of placenta-derived Plasmodium falciparum-infected erythrocytes‏ ‎‡9  1‏
919 ‎‡a  utilizingnanobodytechnologytotargetnonimmunodominantdomainsofvar2csa‏ ‎‡A  Utilizing nanobody technology to target non-immunodominant domains of VAR2CSA.‏ ‎‡9  1‏
919 ‎‡a  var2csamalariaproteinefficientlyretrievescirculatingtumorcellsinanepcamindependentmanner‏ ‎‡A  The VAR2CSA malaria protein efficiently retrieves circulating tumor cells in an EpCAM-independent manner‏ ‎‡9  1‏
919 ‎‡a  ntsdbl2xregionofvar2csainducescrossreactiveantibodiesthatinhibitadhesionofseveralplasmodiumfalciparumisolatestochondroitinsulfatea‏ ‎‡A  The NTS-DBL2X region of VAR2CSA induces cross-reactive antibodies that inhibit adhesion of several Plasmodium falciparum isolates to chondroitin sulfate A.‏ ‎‡9  1‏
919 ‎‡a  influenceofsubunitcompositionandexpressionsystemonthefunctionalantibodyresponseinthedevelopmentofavar2csabasedplasmodiumfalciparumplacentalmalariavaccine‏ ‎‡A  The Influence of Sub-Unit Composition and Expression System on the Functional Antibody Response in the Development of a VAR2CSA Based Plasmodium falciparum Placental Malaria Vaccine‏ ‎‡9  1‏
919 ‎‡a  effectofadjuvantsontheimmuneresponseinducedbyadbl4ɛid4var2csabasedplasmodiumfalciparumvaccineagainstplacentalmalaria‏ ‎‡A  The effect of adjuvants on the immune response induced by a DBL4ɛ-ID4 VAR2CSA based Plasmodium falciparum vaccine against placental malaria.‏ ‎‡9  1‏
919 ‎‡a  chondroitinsulfateabindingsiteofthevar2csaproteininvolvesmultiplenterminaldomains‏ ‎‡A  The chondroitin sulfate A-binding site of the VAR2CSA protein involves multiple N-terminal domains‏ ‎‡9  1‏
919 ‎‡a  targetinghumancancerbyaglycosaminoglycanbindingmalariaprotein‏ ‎‡A  Targeting Human Cancer by a Glycosaminoglycan Binding Malaria Protein‏ ‎‡9  1‏
919 ‎‡a  structurefunctionanalysisofpfalciparumvar2csa‏ ‎‡A  Structure function analysis of P. falciparum VAR2CSA.‏ ‎‡9  1‏
919 ‎‡a  structuralinsightintoepitopesinthepregnancyassociatedmalariaproteinvar2csa‏ ‎‡A  Structural insight into epitopes in the pregnancy-associated malaria protein VAR2CSA‏ ‎‡9  1‏
919 ‎‡a  structuralandfunctionalinsightintohowtheplasmodiumfalciparumvar2csaproteinmediatesbindingtochondroitinsulfateainplacentalmalaria‏ ‎‡A  Structural and functional insight into how the Plasmodium falciparum VAR2CSA protein mediates binding to chondroitin sulfate A in placental malaria.‏ ‎‡9  1‏
919 ‎‡a  specificityandcrossreactivityofplasmodiumfalciparumvariantsurfaceantigenspecificantibodyresponses‏ ‎‡A  Specificity and cross-reactivity of Plasmodium falciparum variant surface antigen-specific antibody responses‏ ‎‡9  1‏
919 ‎‡a  severemalariaisassociatedwithparasitebindingtoendothelialprotein100receptor‏ ‎‡A  Severe malaria is associated with parasite binding to endothelial protein C receptor‏ ‎‡9  1‏
919 ‎‡a  severaldomainsfromvar2csacaninduceplasmodiumfalciparumadhesionblockingantibodies‏ ‎‡A  Several domains from VAR2CSA can induce Plasmodium falciparum adhesion-blocking antibodies‏ ‎‡9  1‏
919 ‎‡a  protectiveantibodiesagainstplacentalmalariaandpooroutcomesduringpregnancybenin‏ ‎‡A  Protective Antibodies against Placental Malaria and Poor Outcomes during Pregnancy, Benin‏ ‎‡9  1‏
919 ‎‡a  preferentialtranscriptionofconservedrifgenesin2phenotypicallydistinctplasmodiumfalciparumparasitelines‏ ‎‡A  Preferential transcription of conserved rif genes in two phenotypically distinct Plasmodium falciparum parasite lines‏ ‎‡9  1‏
919 ‎‡a  preclinicalandclinicaldevelopmentofthe1placentalmalariavaccine‏ ‎‡A  Pre-clinical and clinical development of the first placental malaria vaccine‏ ‎‡9  1‏
919 ‎‡a  positiveselectionofplasmodiumfalciparumparasiteswithmultiplevar2csatypepfemp1genesduringthecourseofinfectioninpregnantwomen‏ ‎‡A  Positive selection of Plasmodium falciparum parasites with multiple var2csa-type PfEMP1 genes during the course of infection in pregnant women‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparumvariantsurfaceantigenexpressionvariesbetweenisolatescausingsevereandnonseveremalariaandismodifiedbyacquiredimmunity‏ ‎‡A  Plasmodium falciparum variant surface antigen expression varies between isolates causing severe and nonsevere malaria and is modified by acquired immunity‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparumvar2csaexpressedduringpregnancyassociatedmalariaispartiallyresistanttoproteolyticcleavagebytrypsin‏ ‎‡A  Plasmodium falciparum: VAR2CSA expressed during pregnancy-associated malaria is partially resistant to proteolytic cleavage by trypsin‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparumtranscriptomeanalysisrevealspregnancymalariaassociatedgeneexpression‏ ‎‡A  Plasmodium falciparum transcriptome analysis reveals pregnancy malaria associated gene expression‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparuminfectionearlyinpregnancyhasprofoundconsequencesforfoetalgrowth‏ ‎‡A  Plasmodium falciparum infection early in pregnancy has profound consequences for foetal growth‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparumexpressingdomaincassette5typepfemp1dc5pfemp1bindpecam1‏ ‎‡A  Plasmodium falciparum expressing domain cassette 5 type PfEMP1 (DC5-PfEMP1) bind PECAM1.‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparumexpressingdomaincassette5typepfemp1‏ ‎‡A  Plasmodium falciparum expressing domain cassette 5 type PfEMP1‏ ‎‡9  1‏
919 ‎‡a  plasmodiumfalciparumassociatedwithseverechildhoodmalariapreferentiallyexpressespfemp1encodedbygroupavargenes‏ ‎‡A  Plasmodium falciparum associated with severe childhood malaria preferentially expresses PfEMP1 encoded by group A var genes‏ ‎‡9  1‏
919 ‎‡a  placentalsequestrationofplasmodiumfalciparummalariaparasitesismediatedbytheinteractionbetweenvar2csaandchondroitinsulfateaonsyndecan1‏ ‎‡A  Placental Sequestration of Plasmodium falciparum Malaria Parasites Is Mediated by the Interaction Between VAR2CSA and Chondroitin Sulfate A on Syndecan-1‏ ‎‡9  1‏
919 ‎‡a  pfs230andpfs4845fusionproteinselicitstrongtransmissionblockingantibodyresponsesagainstplasmodiumfalciparum‏ ‎‡A  Pfs230 and Pfs48/45 Fusion Proteins Elicit Strong Transmission-Blocking Antibody Responses Against Plasmodium falciparum.‏ ‎‡9  1‏
919 ‎‡a  persistentplasmodiumfalciparuminfectioninwomenwithanintenttobecomepregnantasariskfactorforpregnancyassociatedmalaria‏ ‎‡A  Persistent Plasmodium falciparum Infection in Women With an Intent to Become Pregnant as a Risk Factor for Pregnancy-associated Malaria‏ ‎‡9  1‏
919 ‎‡a  noveladenovirusencodedviruslikeparticlesdisplayingtheplacentalmalariaassociatedvar2csaantigen‏ ‎‡A  Novel adenovirus encoded virus-like particles displaying the placental malaria associated VAR2CSA antigen‏ ‎‡9  1‏
919 ‎‡a  multiplevar2csatypepfemp1geneslocatedatdifferentchromosomallocioccurinmanyplasmodiumfalciparumisolates‏ ‎‡A  Multiple var2csa-type PfEMP1 genes located at different chromosomal loci occur in many Plasmodium falciparum isolates‏ ‎‡9  1‏
919 ‎‡a  multilaboratoryapproachtopreclinicalevaluationofvaccineimmunogensforplacentalmalaria‏ ‎‡A  Multilaboratory approach to preclinical evaluation of vaccine immunogens for placental malaria‏ ‎‡9  1‏
919 ‎‡a  marchantinaamacrocyclicbisbibenzyletherisolatedfromtheliverwortmarchantiapolymorphainhibitsprotozoalgrowthinvitro‏ ‎‡A  Marchantin A, a macrocyclic bisbibenzyl ether, isolated from the liverwort Marchantia polymorpha, inhibits protozoal growth in vitro‏ ‎‡9  1‏
919 ‎‡a  mannosebindinglectinisadiseasemodifierinclinicalmalariaandmayfunctionasopsoninforplasmodiumfalciparuminfectederythrocytes‏ ‎‡A  Mannose-Binding Lectin Is a Disease Modifier in Clinical Malaria and May Function as Opsonin for Plasmodium falciparum- Infected Erythrocytes‏ ‎‡9  1‏
919 ‎‡a  inductionofadhesioninhibitoryantibodiesagainstplacentalplasmodiumfalciparumparasitesbyusingsingledomainsofvar2csa‏ ‎‡A  Induction of adhesion-inhibitory antibodies against placental Plasmodium falciparum parasites by using single domains of VAR2CSA.‏ ‎‡9  1‏
919 ‎‡a  invitroselectionofplasmodiumfalciparum3d7forexpressionofvariantsurfaceantigensassociatedwithseveremalariainafricanchildren‏ ‎‡A  In vitro selection of Plasmodium falciparum 3D7 for expression of variant surface antigens associated with severe malaria in African children‏ ‎‡9  1‏
919 ‎‡a  improvingthemalariatransmissionblockingactivityofaplasmodiumfalciparum4845basedvaccineantigenbyspytagspycatchermediatedviruslikedisplay‏ ‎‡A  Improving the malaria transmission-blocking activity of a Plasmodium falciparum 48/45 based vaccine antigen by SpyTag/SpyCatcher mediated virus-like display‏ ‎‡9  1‏
919 ‎‡a  identificationofglycosaminoglycanbindingregionsintheplasmodiumfalciparumencodedplacentalsequestrationligandvar2csa‏ ‎‡A  Identification of glycosaminoglycan binding regions in the Plasmodium falciparum encoded placental sequestration ligand, VAR2CSA‏ ‎‡9  1‏
919 ‎‡a  identificationofamajordimorphicregioninthefunctionallycriticalnterminalid1domainofvar2csa‏ ‎‡A  Identification of a Major Dimorphic Region in the Functionally Critical N-Terminal ID1 Domain of VAR2CSA.‏ ‎‡9  1‏
919 ‎‡a  identificationandcharacterizationofbcellepitopesinthedbl4εdomainofvar2csa‏ ‎‡A  Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA‏ ‎‡9  1‏
919 ‎‡a  humanpregnancyassociatedmalariaspecificbcellstargetpolymorphicconformationalepitopesinvar2csa‏ ‎‡A  Human pregnancy-associated malaria-specific B cells target polymorphic, conformational epitopes in VAR2CSA‏ ‎‡9  1‏
919 ‎‡a  highthroughputtestingofantibodydependentbindinginhibitionofplacentalmalariaparasites‏ ‎‡A  High-Throughput Testing of Antibody-Dependent Binding Inhibition of Placental Malaria Parasites‏ ‎‡9  1‏
919 ‎‡a  highefficacyofantidbl4ɛvar2csaantibodiesininhibitionofcsabindingplasmodiumfalciparuminfectederythrocytesfrompregnantwomen‏ ‎‡A  High efficacy of anti DBL4ɛ-VAR2CSA antibodies in inhibition of CSA-binding Plasmodium falciparum-infected erythrocytes from pregnant women‏ ‎‡9  1‏
919 ‎‡a  geographicalandtemporalconservationofantibodyrecognitionofplasmodiumfalciparumvariantsurfaceantigens‏ ‎‡A  Geographical and temporal conservation of antibody recognition of Plasmodium falciparum variant surface antigens‏ ‎‡9  1‏
919 ‎‡a  fulllengthrecombinantplasmodiumfalciparumvar2csabindsspecificallytocspgandinducespotentparasiteadhesionblockingantibodies‏ ‎‡A  Full-length recombinant Plasmodium falciparum VAR2CSA binds specifically to CSPG and induces potent parasite adhesion-blocking antibodies‏ ‎‡9  1‏
919 ‎‡a  1inhumanrandomizeddoubleblindclinicaltrialofdifferentiallyadjuvantedpamvacavaccinecandidatetopreventpregnancyassociatedmalaria‏ ‎‡A  First-in-human, Randomized, Double-blind Clinical Trial of Differentially Adjuvanted PAMVAC, A Vaccine Candidate to Prevent Pregnancy-associated Malaria‏ ‎‡9  1‏
919 ‎‡a  evidencefortheinvolvementofvar2csainpregnancyassociatedmalaria‏ ‎‡A  Evidence for the involvement of VAR2CSA in pregnancy-associated malaria‏ ‎‡9  1‏
919 ‎‡a  ethnomedicinalsurveyandinvitroantiplasmodialactivityofthepalmborassusaethiopummart‏ ‎‡A  Ethnomedicinal survey and in vitro anti-plasmodial activity of the palm Borassus aethiopum Mart‏ ‎‡9  1‏
919 ‎‡a  epitopemappingandtopographicanalysisofvar2csadbl3xinvolvedinpfalciparumplacentalsequestration‏ ‎‡A  Epitope mapping and topographic analysis of VAR2CSA DBL3X involved in P. falciparum placental sequestration‏ ‎‡9  1‏
919 ‎‡a  differentialinductionofimmunoglobulingtoplasmodiumfalciparumvariantsurfaceantigensduringthetransmissionseasonindaraweeshsudan‏ ‎‡A  Differential induction of immunoglobulin G to Plasmodium falciparum variant surface antigens during the transmission season in Daraweesh, Sudan‏ ‎‡9  1‏
919 ‎‡a  differentialinductionoffunctionaliggusingtheplasmodiumfalciparumplacentalmalariavaccinecandidatevar2csa‏ ‎‡A  Differential induction of functional IgG using the Plasmodium falciparum placental malaria vaccine candidate VAR2CSA‏ ‎‡9  1‏
919 ‎‡a  differentialadhesioninhibitorypatternsofantibodiesraisedagainst2majorvariantsofthentsdbl2xregionofvar2csa‏ ‎‡A  Differential adhesion-inhibitory patterns of antibodies raised against two major variants of the NTS-DBL2X region of VAR2CSA.‏ ‎‡9  1‏
919 ‎‡a  differencesinhumanantibodyreactivitytoplasmodiumfalciparumvariantsurfaceantigensaredependentonageandmalariatransmissionintensityinnortheasterntanzania‏ ‎‡A  Differences in human antibody reactivity to Plasmodium falciparum variant surface antigens are dependent on age and malaria transmission intensity in northeastern Tanzania‏ ‎‡9  1‏
919 ‎‡a  developmentofadrosophilas2insectcellbasedplacentalmalariavaccineproductionprocess‏ ‎‡A  Development of a Drosophila S2 insect-cell based placental malaria vaccine production process.‏ ‎‡9  1‏
919 ‎‡a  determinantsofvariantsurfaceantigenantibodyresponseinsevereplasmodiumfalciparummalariainanareaoflowandunstablemalariatransmission‏ ‎‡A  Determinants of variant surface antigen antibody response in severe Plasmodium falciparum malaria in an area of low and unstable malaria transmission‏ ‎‡9  1‏
919 ‎‡a  cytoadhesionofplasmodiumfalciparuminfectederythrocytestochondroitin4sulfateiscooperativeandshearenhanced‏ ‎‡A  Cytoadhesion of Plasmodium falciparum-infected erythrocytes to chondroitin-4-sulfate is cooperative and shear enhanced‏ ‎‡9  1‏
919 ‎‡a  cryoemrevealsthearchitectureofplacentalmalariavar2csaandprovidesmolecularinsightintochondroitinsulfatebinding‏ ‎‡A  Cryo-EM reveals the architecture of placental malaria VAR2CSA and provides molecular insight into chondroitin sulfate binding‏ ‎‡9  1‏
919 ‎‡a  crossspeciesimmunerecognitionbetweenplasmodiumvivaxduffybindingproteinantibodiesandtheplasmodiumfalciparumsurfaceantigenvar2csa‏ ‎‡A  Cross-Species Immune Recognition Between Plasmodium vivax Duffy Binding Protein Antibodies and the Plasmodium falciparum Surface Antigen VAR2CSA‏ ‎‡9  1‏
919 ‎‡a  comparisonoffunctionalassaysusedintheclinicaldevelopmentofaplacentalmalariavaccine‏ ‎‡A  Comparison of functional assays used in the clinical development of a placental malaria vaccine‏ ‎‡9  1‏
919 ‎‡a  clinicaldevelopmentofplacentalmalariavaccinesandimmunoassaysharmonizationaworkshopreport‏ ‎‡A  Clinical development of placental malaria vaccines and immunoassays harmonization: a workshop report‏ ‎‡9  1‏
919 ‎‡a  clinicaldevelopmentofavar2csabasedplacentalmalariavaccinepamvacquantifyingvaccineantigenspecificmemorybandtcellactivityinbenineseprimigravidae‏ ‎‡A  Clinical development of a VAR2CSA-based placental malaria vaccine PAMVAC: Quantifying vaccine antigen-specific memory B & T cell activity in Beninese primigravidae‏ ‎‡9  1‏
919 ‎‡a  chondroitinsulphateacsabindingofsinglerecombinantduffybindinglikedomainsisnotrestrictedtoplasmodiumfalciparumerythrocytemembraneprotein1expressedbycsabindingparasites‏ ‎‡A  Chondroitin sulphate A (CSA)-binding of single recombinant Duffy-binding-like domains is not restricted to Plasmodium falciparum Erythrocyte Membrane Protein 1 expressed by CSA-binding parasites‏ ‎‡9  1‏
919 ‎‡a  chondroitinsulphatea‏ ‎‡A  Chondroitin sulphate A‏ ‎‡9  1‏
919 ‎‡a  changesinvargenemrnalevelsduringerythrocyticdevelopmentin2phenotypicallydistinctplasmodiumfalciparumparasites‏ ‎‡A  Changes in var gene mRNA levels during erythrocytic development in two phenotypically distinct Plasmodium falciparum parasites‏ ‎‡9  1‏
919 ‎‡a  capsidlikeparticlesdecoratedwiththesarscov2receptorbindingdomainelicitstrongvirusneutralizationactivity‏ ‎‡A  Capsid-like particles decorated with the SARS-CoV-2 receptor-binding domain elicit strong virus neutralization activity‏ ‎‡9  1‏
919 ‎‡a  cananylessonsbelearnedfromtheambiguousglycanbindingofpfemp1domains‏ ‎‡A  Can any lessons be learned from the ambiguous glycan binding of PfEMP1 domains?‏ ‎‡9  1‏
919 ‎‡a  burkittlymphomaexpressesoncofetalchondroitinsulfatewithoutbeingareservoirforplacentalmalariasequestration‏ ‎‡A  Burkitt lymphoma expresses oncofetal chondroitin sulfate without being a reservoir for placental malaria sequestration‏ ‎‡9  1‏
919 ‎‡a  baculovirusexpressedconstructsinduceimmunoglobulingthatrecognizesvar2csaonplasmodiumfalciparuminfectederythrocytes‏ ‎‡A  Baculovirus-expressed constructs induce immunoglobulin G that recognizes VAR2CSA on Plasmodium falciparum-infected erythrocytes‏ ‎‡9  1‏
919 ‎‡a  bacterialsupergluegeneratesafulllengthcircumsporozoiteproteinviruslikeparticlevaccinecapableofinducinghighanddurableantibodyresponses‏ ‎‡A  Bacterial superglue generates a full-length circumsporozoite protein virus-like particle vaccine capable of inducing high and durable antibody responses‏ ‎‡9  1‏
919 ‎‡a  bacterialsuperglueenableseasydevelopmentofefficientviruslikeparticlebasedvaccines‏ ‎‡A  Bacterial superglue enables easy development of efficient virus-like particle based vaccines‏ ‎‡9  1‏
919 ‎‡a  upstreamopenreadingframecontrolstranslationofvar2csaageneimplicatedinplacentalmalaria‏ ‎‡A  An upstream open reading frame controls translation of var2csa, a gene implicated in placental malaria‏ ‎‡9  1‏
919 ‎‡a  adhesionofplasmodiumfalciparuminfectederythrocytesinexvivoperfusedplacentaltissueanovelmodelofplacentalmalaria‏ ‎‡A  Adhesion of Plasmodium falciparum infected erythrocytes in ex vivo perfused placental tissue: a novel model of placental malaria‏ ‎‡9  1‏
919 ‎‡a  vaccinedisplayingatrimericinfluenzaahastemproteinoncapsidlikeparticleselicitspotentandlonglastingprotectioninmice‏ ‎‡A  A Vaccine Displaying a Trimeric Influenza-A HA Stem Protein on Capsid-Like Particles Elicits Potent and Long-Lasting Protection in Mice‏ ‎‡9  1‏
919 ‎‡a  subfamilyofcommonandhighlyconservedplasmodiumfalciparumvargenes‏ ‎‡A  A sub-family of common and highly conserved Plasmodium falciparum var genes.‏ ‎‡9  1‏
919 ‎‡a  proofofconceptstudyforthedesignofavlpbasedcombinatorialhpvandplacentalmalariavaccine‏ ‎‡A  A proof-of-concept study for the design of a VLP-based combinatorial HPV and placental malaria vaccine‏ ‎‡9  1‏
919 ‎‡a  novelviruslikeparticlebasedvaccineplatformdisplayingtheplacentalmalariaantigenvar2csa‏ ‎‡A  A Novel Virus-Like Particle Based Vaccine Platform Displaying the Placental Malaria Antigen VAR2CSA.‏ ‎‡9  1‏
919 ‎‡a  4aminoquinolinederivativessynthesisinvitroandinvivoantiplasmodialactivityagainstchloroquineresistantparasites‏ ‎‡A  4-Aminoquinoline derivatives: Synthesis, in vitro and in vivo antiplasmodial activity against chloroquine-resistant parasites‏ ‎‡9  1‏
946 ‎‡a  b‏ ‎‡9  1‏
996 ‎‡2  LNB|LNC10-000000932‏
996 ‎‡2  DBC|87097992515796‏
996 ‎‡2  DBC|87097968753813‏
996 ‎‡2  DBC|87097919457818‏
996 ‎‡2  DBC|87097991601990‏
996 ‎‡2  ISNI|0000000043894674‏
996 ‎‡2  DBC|87097938448641‏
996 ‎‡2  ISNI|0000000047018487‏
996 ‎‡2  DBC|87097991764318‏
996 ‎‡2  ISNI|0000000422066895‏
996 ‎‡2  BIBSYS|1034761‏
996 ‎‡2  DBC|87097969263844‏
996 ‎‡2  SUDOC|18185726X‏
996 ‎‡2  DNB|1104148951‏
996 ‎‡2  DNB|1081959169‏
996 ‎‡2  BIBSYS|3091710‏
996 ‎‡2  LC|no2006133278‏
996 ‎‡2  DBC|87097968753767‏
996 ‎‡2  DBC|87097968996775‏
996 ‎‡2  ISNI|0000000446026580‏
996 ‎‡2  DBC|87097991693305‏
996 ‎‡2  NII|DA12440656‏
996 ‎‡2  LC|nb2006024464‏
996 ‎‡2  SUDOC|055278809‏
996 ‎‡2  ISNI|0000000026974445‏
996 ‎‡2  LC|n 2015046932‏
996 ‎‡2  DBC|87097969322395‏
996 ‎‡2  BIBSYS|99035326‏
996 ‎‡2  DBC|87097968753805‏
996 ‎‡2  BIBSYS|90532856‏
996 ‎‡2  DBC|87097991693283‏
996 ‎‡2  DNB|1338447939‏
996 ‎‡2  DBC|87097961582851‏
996 ‎‡2  LC|nr 99004110‏
996 ‎‡2  DBC|87097969854907‏
996 ‎‡2  LC|n 78077251‏
996 ‎‡2  ISNI|0000000451083918‏
996 ‎‡2  NLR|RU NLR AUTH 770236023‏
996 ‎‡2  ISNI|0000000392598398‏
996 ‎‡2  DBC|87097990341464‏
996 ‎‡2  DBC|87097991646951‏
996 ‎‡2  DBC|87097991693275‏
996 ‎‡2  DBC|870979138859797‏
996 ‎‡2  DBC|87097968992664‏
996 ‎‡2  DBC|87097990753975‏
996 ‎‡2  NII|DA18967465‏
996 ‎‡2  DBC|87097968921961‏
996 ‎‡2  LC|n 2012024955‏
996 ‎‡2  DBC|87097968728517‏
996 ‎‡2  DBC|87097991735776‏
996 ‎‡2  SZ|14223656X‏
996 ‎‡2  DBC|87097991693291‏
996 ‎‡2  ISNI|0000000021434992‏
996 ‎‡2  LC|n 98046094‏
996 ‎‡2  BIBSYS|14029460‏
996 ‎‡2  ISNI|0000000363118375‏
996 ‎‡2  DBC|87097969341942‏
996 ‎‡2  NDL|00825162‏
996 ‎‡2  NSK|000402556‏
996 ‎‡2  BIBSYS|21624‏
996 ‎‡2  DBC|87097919324079‏
996 ‎‡2  DBC|87097991529440‏
996 ‎‡2  BIBSYS|90197147‏
996 ‎‡2  DBC|87097968753775‏
996 ‎‡2  DNB|127546383‏
996 ‎‡2  SUDOC|260294624‏
996 ‎‡2  SUDOC|113181949‏
996 ‎‡2  LC|no2009142147‏
996 ‎‡2  DBC|87097968753740‏
996 ‎‡2  DBC|87097961884688‏
996 ‎‡2  W2Z|3091710‏
996 ‎‡2  ERRR|12146481‏
996 ‎‡2  DBC|87097991693240‏
996 ‎‡2  PLWABN|9810564543805606‏
996 ‎‡2  NUKAT|n 2018086596‏
996 ‎‡2  BIBSYS|8053888‏
996 ‎‡2  DBC|87097947881978‏
996 ‎‡2  BIBSYS|90362730‏
996 ‎‡2  LC|no2007074420‏
996 ‎‡2  DBC|87097991018942‏
996 ‎‡2  SUDOC|190870923‏
996 ‎‡2  DBC|87097991160862‏
996 ‎‡2  ISNI|0000000487309544‏
996 ‎‡2  LC|n 84174962‏
996 ‎‡2  DBC|87097969054501‏
996 ‎‡2  DBC|87097990592718‏
996 ‎‡2  DBC|87097968104602‏
996 ‎‡2  NKC|nlk20040153513‏
996 ‎‡2  DNB|119469529‏
996 ‎‡2  DNB|105325332X‏
996 ‎‡2  NKC|xx0241515‏
996 ‎‡2  LC|n 88681297‏
996 ‎‡2  BIBSYS|9016813‏
996 ‎‡2  DBC|87097968950988‏
996 ‎‡2  DBC|87097968753759‏
996 ‎‡2  CAOONL|ncf11886571‏
996 ‎‡2  ISNI|0000000038211816‏
996 ‎‡2  DBC|87097968987555‏
996 ‎‡2  BIBSYS|3119679‏
996 ‎‡2  BNF|17057247‏
996 ‎‡2  DBC|87097968753856‏
996 ‎‡2  DBC|87097991869527‏
996 ‎‡2  BIBSYS|1483107586920‏
996 ‎‡2  NLR|RU NLR AUTH 7716518‏
996 ‎‡2  LC|no2015043130‏
996 ‎‡2  DBC|87097968753791‏
996 ‎‡2  DBC|87097968362156‏
996 ‎‡2  DBC|87097969241409‏
996 ‎‡2  DBC|87097991693348‏
996 ‎‡2  ISNI|0000000029734228‏
996 ‎‡2  ISNI|0000000112644813‏
996 ‎‡2  LC|n 2024006203‏
996 ‎‡2  DBC|87097991192926‏
996 ‎‡2  DBC|87097968776244‏
996 ‎‡2  UIY|000033007‏
996 ‎‡2  BIBSYS|2065563‏
996 ‎‡2  DBC|87097969625053‏
996 ‎‡2  DBC|87097992161587‏
996 ‎‡2  ISNI|000000039232694X‏
996 ‎‡2  ISNI|0000000052986175‏
996 ‎‡2  ISNI|0000000390398472‏
996 ‎‡2  BIBSYS|6015450‏
996 ‎‡2  DBC|87097968753848‏
996 ‎‡2  DBC|87097919207749‏
996 ‎‡2  DNB|1210430134‏
996 ‎‡2  SUDOC|159759889‏
996 ‎‡2  DBC|87097968730546‏
996 ‎‡2  DBC|87097938202014‏
996 ‎‡2  NTA|418077010‏
996 ‎‡2  BIBSYS|90307528‏
996 ‎‡2  DBC|87097968796881‏
996 ‎‡2  BIBSYS|98069700‏
996 ‎‡2  W2Z|1483107586920‏
996 ‎‡2  BIBSYS|15016304‏
996 ‎‡2  DBC|87097991693232‏
996 ‎‡2  DBC|87097991420120‏
996 ‎‡2  DBC|87097991229285‏
996 ‎‡2  BIBSYS|1602157055108‏
996 ‎‡2  DBC|87097991693313‏
996 ‎‡2  ISNI|0000000084585149‏
996 ‎‡2  NUKAT|n 2021127246‏
996 ‎‡2  DNB|14223656X‏
996 ‎‡2  DBC|87097968457580‏
996 ‎‡2  DBC|87097947988845‏
996 ‎‡2  PLWABN|9810555883905606‏
996 ‎‡2  W2Z|14029460‏
996 ‎‡2  DBC|87097968788625‏
996 ‎‡2  NTA|142641030‏
996 ‎‡2  LC|n 78059321‏
996 ‎‡2  NUKAT|n 99026532‏
996 ‎‡2  DBC|87097991693321‏
996 ‎‡2  DBC|87097969853803‏
996 ‎‡2  ISNI|0000000369467808‏
996 ‎‡2  BIBSYS|3075725‏
996 ‎‡2  DBC|87097990130110‏
996 ‎‡2  DBC|87097968589762‏
996 ‎‡2  DBC|87097968753783‏
996 ‎‡2  DBC|87097968753821‏
996 ‎‡2  DBC|87097991693259‏
996 ‎‡2  DBC|87097991420317‏
996 ‎‡2  DNB|171921208‏
996 ‎‡2  DBC|87097968529115‏
996 ‎‡2  ISNI|0000000394033147‏
996 ‎‡2  NTA|311463487‏
996 ‎‡2  DBC|870979138036502‏
996 ‎‡2  DBC|87097991693143‏
996 ‎‡2  BNF|12027192‏
996 ‎‡2  ISNI|0000000351581303‏
996 ‎‡2  DNB|1067603328‏
996 ‎‡2  BIBSYS|90372719‏
996 ‎‡2  DBC|87097969547915‏
996 ‎‡2  SUDOC|172688345‏
996 ‎‡2  DBC|87097991227320‏
996 ‎‡2  ISNI|0000000024647387‏
996 ‎‡2  PLWABN|9811781063405606‏
996 ‎‡2  LNB|LNC10-000348352‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏
998 ‎‡a  Nielsen, Morten Agertoug‏ ‎‡2  DNB|1122674295‏ ‎‡3  suggested‏ ‎‡3  standard number‏