Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q56261583 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241120235818.0 | ||
| 008 | 241120nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q56261583 | ||
| 024 | ‡a 0000-0002-1951-3215 ‡2 orcid | ||
| 035 | ‡a (OCoLC)Q56261583 | ||
| 100 | 0 | ‡a George C Russell ‡9 es ‡9 sl ‡9 ast | |
| 375 | ‡a 1 ‡2 iso5218 | ||
| 400 | 0 | ‡a জর্জ সি রাসেল ‡9 bn | |
| 400 | 0 | ‡a George C Russell ‡c researcher ‡9 en | |
| 400 | 0 | ‡a George C Russell ‡c wetenschapper ‡9 nl | |
| 670 | ‡a Author's A captured viral interleukin 10 gene with cellular exon structure | ||
| 670 | ‡a Author's A model for the control of differentiation in Rhodomicrobium vannielii swarmer cells | ||
| 670 | ‡a Author's A novel expression vector for transfection of bovine MHC class I genes | ||
| 670 | ‡a Author's A novel spliced gene in alcelaphine herpesvirus 1 encodes a glycoprotein which is secreted in vitro | ||
| 670 | ‡a Author's A randomised vaccine field trial in Kenya demonstrates protection against wildebeest-associated malignant catarrhal fever in cattle | ||
| 670 | ‡a Author's Adaptive evolution of Toll-like receptor 5 in domesticated mammals | ||
| 670 | ‡a Author's Alcelaphine herpesvirus 1 glycoprotein B: recombinant expression and antibody recognition | ||
| 670 | ‡a Author's Alcelaphine Herpesvirus-1 (Malignant Catarrhal Fever Virus) in Wildebeest Placenta: Genetic Variation of ORF50 and A9.5 Alleles | ||
| 670 | ‡a Author's Amplification and sequencing of expressed DRB second exons from Bos indicus. | ||
| 670 | ‡a Author's An immunisation strategy for the protection of cattle against alcelaphine herpesvirus-1-induced malignant catarrhal fever. | ||
| 670 | ‡a Author's Analysis of bovine viral diarrhoea virus: Biobank and sequence database to support eradication in Scotland. | ||
| 670 | ‡a Author's Analysis of inverted repeat DNA in the genome of Rhodomicrobium vannielii | ||
| 670 | ‡a Author's Analysis of the genetic diversity of ovine herpesvirus 2 in samples from livestock with malignant catarrhal fever. | ||
| 670 | ‡a Author's Assessment of the rabbit as a wildlife reservoir of bovine viral diarrhea virus: serological analysis and generation of trans-placentally infected offspring | ||
| 670 | ‡a Author's Association of bovine DRB3 alleles with immune response to FMDV peptides and protection against viral challenge | ||
| 670 | ‡a Author's Characterisation of antibodies to bovine Toll-like receptor | ||
| 670 | ‡a Author's Characterisation of antibodies to bovine Toll-like receptor (TLR)-2 and cross-reactivity with ovine TLR2. | ||
| 670 | ‡a Author's Characterization of cattle cDNA sequences from two DQA loci. | ||
| 670 | ‡a Author's Clonal T cell responses reflect the expression of multiple DQ genes in cattle. | ||
| 670 | ‡a Author's Complete sequence and analysis of the ovine herpesvirus 2 genome | ||
| 670 | ‡a Author's Complexes and complexities of the citric acid cycle in Escherichia coli | ||
| 670 | ‡a Author's Development of an enzyme-linked immunosorbent assay for the detection of antibodies against malignant catarrhal fever viruses in cattle serum. | ||
| 670 | ‡a Author's Differential transcription of ovine herpesvirus 2 genes in lymphocytes from reservoir and susceptible species | ||
| 670 | ‡a Author's Direct RT-PCR from serum enables fast and cost-effective phylogenetic analysis of bovine viral diarrhoea virus | ||
| 670 | ‡a Author's Distribution of BoLA-DRB3 allelic frequencies and identification of two new alleles in Iranian buffalo breed. | ||
| 670 | ‡a Author's Duration of protective immunity and antibody responses in cattle immunised against alcelaphine herpesvirus-1-induced malignant catarrhal fever. | ||
| 670 | ‡a Author's Experimental infection of rabbits with bovine viral diarrhoea virus by a natural route of exposure | ||
| 670 | ‡a Author's Functional expression of a bovine major histocompatibility complex class I gene in transgenic mice | ||
| 670 | ‡a Author's Functional expression of a cattle MHC class II DR-like antigen on mouse L cells. | ||
| 670 | ‡a Author's Haplotype characterization of transcribed ovine major histocompatibility complex | ||
| 670 | ‡a Author's Haplotype characterization of transcribed ovine major histocompatibility complex (MHC) class I genes. | ||
| 670 | ‡a Author's Host gene expression changes in cattle infected with Alcelaphine herpesvirus 1 | ||
| 670 | ‡a Author's Identification of immune traits correlated with dairy cow health, reproduction and productivity | ||
| 670 | ‡a Author's Identification of immuno-reactive capsid proteins of malignant catarrhal fever viruses | ||
| 670 | ‡a Author's Immunohistochemical study of experimental malignant catarrhal fever in rabbits. | ||
| 670 | ‡a Author's Improved single-strand conformation polymorphism analysis by asymmetric polymerase chain reaction with end-labeled primers | ||
| 670 | ‡a Author's Malignant catarrhal fever: a review | ||
| 670 | ‡a Author's Malignant catarrhal fever in cattle in the UK. | ||
| 670 | ‡a Author's Modulation of the oxidation-reduction potential of the flavin in lipoamide dehydrogenase from Escherichia coli by alteration of a nearby charged residue, K53R. | ||
| 670 | ‡a Author's Molecular cloning and characterization of Toll-like receptors 1-10 in sheep | ||
| 670 | ‡a Author's Molecular cloning and sequencing of a cattle DRA cDNA. | ||
| 670 | ‡a Author's Novel virus-encoded microRNA molecules expressed by ovine herpesvirus 2-immortalized bovine T-cells. | ||
| 670 | ‡a Author's Pestivirus infection of sheep - testing times? | ||
| 670 | ‡a Author's Polymorphism of bovine major histocompatibility complex | ||
| 670 | ‡a Author's Polymorphism of bovine major histocompatibility complex (MHC) class I genes revealed by polymerase chain reaction (PCR) and restriction enzyme analysis | ||
| 670 | ‡a Author's Production and utilization of interleukin-15 in malignant catarrhal fever. | ||
| 670 | ‡a Author's Properties of lipoamide dehydrogenase altered by site-directed mutagenesis at a key residue | ||
| 670 | ‡a Author's Properties of lipoamide dehydrogenase altered by site-directed mutagenesis at a key residue (Il84Y) in the pyridine nucleotide binding domain | ||
| 670 | ‡a Author's Properties of lipoamide dehydrogenase and thioredoxin reductase from Escherichia coli altered by site-directed mutagenesis | ||
| 670 | ‡a Author's Proteomic analysis of pathogenic and attenuated alcelaphine herpesvirus 1 | ||
| 670 | ‡a Author's Restructuring an interdomain linker in the dihydrolipoamide acetyltransferase component of the pyruvate dehydrogenase complex of Escherichia coli | ||
| 670 | ‡a Author's Site-directed mutagenesis of the lipoate acetyltransferase of Escherichia coli | ||
| 670 | ‡a Author's The A5 gene of alcelaphine herpesvirus 1 encodes a constitutively active G-protein-coupled receptor that is non-essential for the induction of malignant catarrhal fever in rabbits. | ||
| 670 | ‡a Author's The effect of the TLR9 ligand CpG-oligodeoxynucleotide on the protective immune response to alcelaphine herpesvirus-1-mediated malignant catarrhal fever in cattle. | ||
| 670 | ‡a Author's The use of denaturing gradient gel electrophoresis in mapping the bovine tumor necrosis factor alpha gene locus. | ||
| 670 | ‡a Author's Theileria annulata "superantigen" activity--TCB usage by responding bovine CD4+ cells from uninfected donors | ||
| 670 | ‡a Author's Transfection, expression, and DNA sequence of a gene encoding a BoLA-A11 antigen. | ||
| 909 | ‡a (orcid) 0000000219513215 ‡9 1 | ||
| 919 | ‡a capturedviralinterleukin10genewithcellularexonstructure ‡A A captured viral interleukin 10 gene with cellular exon structure ‡9 1 | ||
| 919 | ‡a modelforthecontrolofdifferentiationinrhodomicrobiumvannieliiswarmercells ‡A A model for the control of differentiation in Rhodomicrobium vannielii swarmer cells ‡9 1 | ||
| 919 | ‡a novelexpressionvectorfortransfectionofbovinemhcclass1genes ‡A A novel expression vector for transfection of bovine MHC class I genes ‡9 1 | ||
| 919 | ‡a novelsplicedgeneinalcelaphineherpesvirus1encodesaglycoproteinwhichissecretedinvitro ‡A A novel spliced gene in alcelaphine herpesvirus 1 encodes a glycoprotein which is secreted in vitro ‡9 1 | ||
| 919 | ‡a randomisedvaccinefieldtrialinkenyademonstratesprotectionagainstwildebeestassociatedmalignantcatarrhalfeverincattle ‡A A randomised vaccine field trial in Kenya demonstrates protection against wildebeest-associated malignant catarrhal fever in cattle ‡9 1 | ||
| 919 | ‡a adaptiveevolutionoftolllikereceptor5indomesticatedmammals ‡A Adaptive evolution of Toll-like receptor 5 in domesticated mammals ‡9 1 | ||
| 919 | ‡a alcelaphineherpesvirus1glycoproteinbrecombinantexpressionandantibodyrecognition ‡A Alcelaphine herpesvirus 1 glycoprotein B: recombinant expression and antibody recognition ‡9 1 | ||
| 919 | ‡a alcelaphineherpesvirus1malignantcatarrhalfevervirusinwildebeestplacentageneticvariationoforf50anda95alleles ‡A Alcelaphine Herpesvirus-1 (Malignant Catarrhal Fever Virus) in Wildebeest Placenta: Genetic Variation of ORF50 and A9.5 Alleles ‡9 1 | ||
| 919 | ‡a amplificationandsequencingofexpresseddrb2exonsfrombosindicus ‡A Amplification and sequencing of expressed DRB second exons from Bos indicus. ‡9 1 | ||
| 919 | ‡a immunisationstrategyfortheprotectionofcattleagainstalcelaphineherpesvirus1inducedmalignantcatarrhalfever ‡A An immunisation strategy for the protection of cattle against alcelaphine herpesvirus-1-induced malignant catarrhal fever. ‡9 1 | ||
| 919 | ‡a analysisofbovineviraldiarrhoeavirusbiobankandsequencedatabasetosupporteradicationinscotland ‡A Analysis of bovine viral diarrhoea virus: Biobank and sequence database to support eradication in Scotland. ‡9 1 | ||
| 919 | ‡a analysisofinvertedrepeatdnainthegenomeofrhodomicrobiumvannielii ‡A Analysis of inverted repeat DNA in the genome of Rhodomicrobium vannielii ‡9 1 | ||
| 919 | ‡a analysisofthegeneticdiversityofovineherpesvirus2insamplesfromlivestockwithmalignantcatarrhalfever ‡A Analysis of the genetic diversity of ovine herpesvirus 2 in samples from livestock with malignant catarrhal fever. ‡9 1 | ||
| 919 | ‡a assessmentoftherabbitasawildlifereservoirofbovineviraldiarrheavirusserologicalanalysisandgenerationoftransplacentallyinfectedoffspring ‡A Assessment of the rabbit as a wildlife reservoir of bovine viral diarrhea virus: serological analysis and generation of trans-placentally infected offspring ‡9 1 | ||
| 919 | ‡a associationofbovinedrb3alleleswithimmuneresponsetofmdvpeptidesandprotectionagainstviralchallenge ‡A Association of bovine DRB3 alleles with immune response to FMDV peptides and protection against viral challenge ‡9 1 | ||
| 919 | ‡a characterisationofantibodiestobovinetolllikereceptor ‡A Characterisation of antibodies to bovine Toll-like receptor ‡9 1 | ||
| 919 | ‡a characterisationofantibodiestobovinetolllikereceptortlr2andcrossreactivitywithovinetlr2 ‡A Characterisation of antibodies to bovine Toll-like receptor (TLR)-2 and cross-reactivity with ovine TLR2. ‡9 1 | ||
| 919 | ‡a characterizationofcattlecdnasequencesfrom2dqaloci ‡A Characterization of cattle cDNA sequences from two DQA loci. ‡9 1 | ||
| 919 | ‡a clonaltcellresponsesreflecttheexpressionofmultipledqgenesincattle ‡A Clonal T cell responses reflect the expression of multiple DQ genes in cattle. ‡9 1 | ||
| 919 | ‡a completesequenceandanalysisoftheovineherpesvirus2genome ‡A Complete sequence and analysis of the ovine herpesvirus 2 genome ‡9 1 | ||
| 919 | ‡a complexesandcomplexitiesofthecitricacidcycleinescherichiacoli ‡A Complexes and complexities of the citric acid cycle in Escherichia coli ‡9 1 | ||
| 919 | ‡a developmentofanenzymelinkedimmunosorbentassayforthedetectionofantibodiesagainstmalignantcatarrhalfevervirusesincattleserum ‡A Development of an enzyme-linked immunosorbent assay for the detection of antibodies against malignant catarrhal fever viruses in cattle serum. ‡9 1 | ||
| 919 | ‡a differentialtranscriptionofovineherpesvirus2genesinlymphocytesfromreservoirandsusceptiblespecies ‡A Differential transcription of ovine herpesvirus 2 genes in lymphocytes from reservoir and susceptible species ‡9 1 | ||
| 919 | ‡a directrtpcrfromserumenablesfastandcosteffectivephylogeneticanalysisofbovineviraldiarrhoeavirus ‡A Direct RT-PCR from serum enables fast and cost-effective phylogenetic analysis of bovine viral diarrhoea virus ‡9 1 | ||
| 919 | ‡a distributionofboladrb3allelicfrequenciesandidentificationof2newallelesiniranianbuffalobreed ‡A Distribution of BoLA-DRB3 allelic frequencies and identification of two new alleles in Iranian buffalo breed. ‡9 1 | ||
| 919 | ‡a durationofprotectiveimmunityandantibodyresponsesincattleimmunisedagainstalcelaphineherpesvirus1inducedmalignantcatarrhalfever ‡A Duration of protective immunity and antibody responses in cattle immunised against alcelaphine herpesvirus-1-induced malignant catarrhal fever. ‡9 1 | ||
| 919 | ‡a experimentalinfectionofrabbitswithbovineviraldiarrhoeavirusbyanaturalrouteofexposure ‡A Experimental infection of rabbits with bovine viral diarrhoea virus by a natural route of exposure ‡9 1 | ||
| 919 | ‡a functionalexpressionofabovinemajorhistocompatibilitycomplexclass1geneintransgenicmice ‡A Functional expression of a bovine major histocompatibility complex class I gene in transgenic mice ‡9 1 | ||
| 919 | ‡a functionalexpressionofacattlemhcclass2drlikeantigenonmouse50cells ‡A Functional expression of a cattle MHC class II DR-like antigen on mouse L cells. ‡9 1 | ||
| 919 | ‡a haplotypecharacterizationoftranscribedovinemajorhistocompatibilitycomplex ‡A Haplotype characterization of transcribed ovine major histocompatibility complex ‡9 1 | ||
| 919 | ‡a haplotypecharacterizationoftranscribedovinemajorhistocompatibilitycomplexmhcclass1genes ‡A Haplotype characterization of transcribed ovine major histocompatibility complex (MHC) class I genes. ‡9 1 | ||
| 919 | ‡a hostgeneexpressionchangesincattleinfectedwithalcelaphineherpesvirus1 ‡A Host gene expression changes in cattle infected with Alcelaphine herpesvirus 1 ‡9 1 | ||
| 919 | ‡a identificationofimmunetraitscorrelatedwithdairycowhealthreproductionandproductivity ‡A Identification of immune traits correlated with dairy cow health, reproduction and productivity ‡9 1 | ||
| 919 | ‡a identificationofimmunoreactivecapsidproteinsofmalignantcatarrhalfeverviruses ‡A Identification of immuno-reactive capsid proteins of malignant catarrhal fever viruses ‡9 1 | ||
| 919 | ‡a immunohistochemicalstudyofexperimentalmalignantcatarrhalfeverinrabbits ‡A Immunohistochemical study of experimental malignant catarrhal fever in rabbits. ‡9 1 | ||
| 919 | ‡a improvedsinglestrandconformationpolymorphismanalysisbyasymmetricpolymerasechainreactionwithendlabeledprimers ‡A Improved single-strand conformation polymorphism analysis by asymmetric polymerase chain reaction with end-labeled primers ‡9 1 | ||
| 919 | ‡a malignantcatarrhalfeverareview ‡A Malignant catarrhal fever: a review ‡9 1 | ||
| 919 | ‡a malignantcatarrhalfeverincattleintheuk ‡A Malignant catarrhal fever in cattle in the UK. ‡9 1 | ||
| 919 | ‡a modulationoftheoxidationreductionpotentialoftheflavininlipoamidedehydrogenasefromescherichiacolibyalterationofanearbychargedresiduek53r ‡A Modulation of the oxidation-reduction potential of the flavin in lipoamide dehydrogenase from Escherichia coli by alteration of a nearby charged residue, K53R. ‡9 1 | ||
| 919 | ‡a molecularcloningandcharacterizationoftolllikereceptors110insheep ‡A Molecular cloning and characterization of Toll-like receptors 1-10 in sheep ‡9 1 | ||
| 919 | ‡a molecularcloningandsequencingofacattledracdna ‡A Molecular cloning and sequencing of a cattle DRA cDNA. ‡9 1 | ||
| 919 | ‡a novelvirusencodedmicrornamoleculesexpressedbyovineherpesvirus2immortalizedbovinetcells ‡A Novel virus-encoded microRNA molecules expressed by ovine herpesvirus 2-immortalized bovine T-cells. ‡9 1 | ||
| 919 | ‡a pestivirusinfectionofsheeptestingtimes ‡A Pestivirus infection of sheep - testing times? ‡9 1 | ||
| 919 | ‡a polymorphismofbovinemajorhistocompatibilitycomplex ‡A Polymorphism of bovine major histocompatibility complex ‡9 1 | ||
| 919 | ‡a polymorphismofbovinemajorhistocompatibilitycomplexmhcclass1genesrevealedbypolymerasechainreactionpcrandrestrictionenzymeanalysis ‡A Polymorphism of bovine major histocompatibility complex (MHC) class I genes revealed by polymerase chain reaction (PCR) and restriction enzyme analysis ‡9 1 | ||
| 919 | ‡a productionandutilizationofinterleukin15inmalignantcatarrhalfever ‡A Production and utilization of interleukin-15 in malignant catarrhal fever. ‡9 1 | ||
| 919 | ‡a propertiesoflipoamidedehydrogenasealteredbysitedirectedmutagenesisatakeyresidue ‡A Properties of lipoamide dehydrogenase altered by site-directed mutagenesis at a key residue ‡9 1 | ||
| 919 | ‡a propertiesoflipoamidedehydrogenasealteredbysitedirectedmutagenesisatakeyresidueil84yinthepyridinenucleotidebindingdomain ‡A Properties of lipoamide dehydrogenase altered by site-directed mutagenesis at a key residue (Il84Y) in the pyridine nucleotide binding domain ‡9 1 | ||
| 919 | ‡a propertiesoflipoamidedehydrogenaseandthioredoxinreductasefromescherichiacolialteredbysitedirectedmutagenesis ‡A Properties of lipoamide dehydrogenase and thioredoxin reductase from Escherichia coli altered by site-directed mutagenesis ‡9 1 | ||
| 919 | ‡a proteomicanalysisofpathogenicandattenuatedalcelaphineherpesvirus1 ‡A Proteomic analysis of pathogenic and attenuated alcelaphine herpesvirus 1 ‡9 1 | ||
| 919 | ‡a restructuringaninterdomainlinkerinthedihydrolipoamideacetyltransferasecomponentofthepyruvatedehydrogenasecomplexofescherichiacoli ‡A Restructuring an interdomain linker in the dihydrolipoamide acetyltransferase component of the pyruvate dehydrogenase complex of Escherichia coli ‡9 1 | ||
| 919 | ‡a sitedirectedmutagenesisofthelipoateacetyltransferaseofescherichiacoli ‡A Site-directed mutagenesis of the lipoate acetyltransferase of Escherichia coli ‡9 1 | ||
| 919 | ‡a effectofthetlr9ligandcpgoligodeoxynucleotideontheprotectiveimmuneresponsetoalcelaphineherpesvirus1mediatedmalignantcatarrhalfeverincattle ‡A The effect of the TLR9 ligand CpG-oligodeoxynucleotide on the protective immune response to alcelaphine herpesvirus-1-mediated malignant catarrhal fever in cattle. ‡9 1 | ||
| 919 | ‡a useofdenaturinggradientgelelectrophoresisinmappingthebovinetumornecrosisfactoralphagenelocus ‡A The use of denaturing gradient gel electrophoresis in mapping the bovine tumor necrosis factor alpha gene locus. ‡9 1 | ||
| 919 | ‡a theileriaannulatasuperantigenactivitytcbusagebyrespondingbovinecd4+cellsfromuninfecteddonors ‡A Theileria annulata "superantigen" activity--TCB usage by responding bovine CD4+ cells from uninfected donors ‡9 1 | ||
| 919 | ‡a transfectionexpressionanddnasequenceofageneencodingabolaa11antigen ‡A Transfection, expression, and DNA sequence of a gene encoding a BoLA-A11 antigen. ‡9 1 | ||
| 919 | ‡a a5geneofalcelaphineherpesvirus1encodesaconstitutivelyactivegproteincoupledreceptorthatisnonessentialfortheinductionofmalignantcatarrhalfeverinrabbits ‡A The A5 gene of alcelaphine herpesvirus 1 encodes a constitutively active G-protein-coupled receptor that is non-essential for the induction of malignant catarrhal fever in rabbits. ‡9 1 | ||
| 946 | ‡a b ‡9 1 | ||
| 996 | ‡2 ISNI|0000000030479412 | ||
| 996 | ‡2 SUDOC|034150056 | ||
| 996 | ‡2 SELIBR|307277 | ||
| 996 | ‡2 LC|no2020032181 | ||
| 996 | ‡2 SZ|118642073 | ||
| 996 | ‡2 ICCU|RAVV424961 | ||
| 996 | ‡2 ISNI|0000000045973907 | ||
| 996 | ‡2 NII|DA08805004 | ||
| 996 | ‡2 PLWABN|9812831733205606 | ||
| 996 | ‡2 SELIBR|307279 | ||
| 996 | ‡2 ISNI|0000000022157181 | ||
| 996 | ‡2 LC|n 90604512 | ||
| 996 | ‡2 SUDOC|074493221 | ||
| 996 | ‡2 LC|n 85173334 | ||
| 996 | ‡2 ISNI|0000000067177362 | ||
| 996 | ‡2 N6I|vtls000068878 | ||
| 996 | ‡2 PTBNP|1492022 | ||
| 996 | ‡2 ISNI|0000000021898455 | ||
| 996 | ‡2 CAOONL|ncf10926518 | ||
| 996 | ‡2 J9U|987007342873805171 | ||
| 996 | ‡2 J9U|987007396934405171 | ||
| 996 | ‡2 BIBSYS|90291774 | ||
| 996 | ‡2 CAOONL|ncf11289827 | ||
| 996 | ‡2 J9U|987007434151305171 | ||
| 996 | ‡2 NTA|072857145 | ||
| 996 | ‡2 ERRR|12321175 | ||
| 996 | ‡2 LC|no2019123000 | ||
| 996 | ‡2 LC|n 82049946 | ||
| 996 | ‡2 BNF|12209580 | ||
| 996 | ‡2 NII|DA10102277 | ||
| 996 | ‡2 ISNI|0000000076605007 | ||
| 996 | ‡2 N6I|vtls000755171 | ||
| 996 | ‡2 LC|nr 89010550 | ||
| 996 | ‡2 BIBSYS|90209044 | ||
| 996 | ‡2 LC|n 00113422 | ||
| 996 | ‡2 CAOONL|ncf10784424 | ||
| 996 | ‡2 LC|no2010187744 | ||
| 996 | ‡2 LC|nr 98021958 | ||
| 996 | ‡2 NTA|079395058 | ||
| 996 | ‡2 NTA|153387599 | ||
| 996 | ‡2 SUDOC|144736349 | ||
| 996 | ‡2 LC|nb2018010092 | ||
| 996 | ‡2 LC|n 87100751 | ||
| 996 | ‡2 NUKAT|n 2016197426 | ||
| 996 | ‡2 BNE|XX5231298 | ||
| 996 | ‡2 DNB|143339621 | ||
| 996 | ‡2 ISNI|0000000501320361 | ||
| 996 | ‡2 DNB|13880320X | ||
| 996 | ‡2 B2Q|0001054626 | ||
| 996 | ‡2 JPG|500065884 | ||
| 996 | ‡2 PLWABN|9810712533105606 | ||
| 996 | ‡2 NTA|130727555 | ||
| 996 | ‡2 ISNI|0000000428253114 | ||
| 996 | ‡2 SUDOC|027115666 | ||
| 996 | ‡2 ISNI|0000000495648781 | ||
| 996 | ‡2 LC|nr 93034197 | ||
| 996 | ‡2 SUDOC|104641711 | ||
| 996 | ‡2 NUKAT|n 98026280 | ||
| 996 | ‡2 NUKAT|n 2009086923 | ||
| 996 | ‡2 ISNI|0000000041463168 | ||
| 996 | ‡2 LC|n 80027420 | ||
| 996 | ‡2 ISNI|0000000081122974 | ||
| 996 | ‡2 ISNI|0000000500597107 | ||
| 996 | ‡2 ISNI|0000000113044158 | ||
| 996 | ‡2 ISNI|0000000409104316 | ||
| 996 | ‡2 LC|n 50022302 | ||
| 996 | ‡2 LC|nr2001017689 | ||
| 996 | ‡2 ISNI|0000000382643650 | ||
| 996 | ‡2 RERO|A018849508 | ||
| 996 | ‡2 J9U|987007449466005171 | ||
| 996 | ‡2 BIBSYS|14024395 | ||
| 996 | ‡2 LC|n 80139802 | ||
| 996 | ‡2 LC|nb 99127377 | ||
| 996 | ‡2 ISNI|0000000043438492 | ||
| 996 | ‡2 LC|n 87932841 | ||
| 996 | ‡2 BIBSYS|90257884 | ||
| 996 | ‡2 DNB|1254080163 | ||
| 996 | ‡2 NYNYRILM|20157 | ||
| 996 | ‡2 NLA|000035434291 | ||
| 996 | ‡2 LC|n 80090245 | ||
| 996 | ‡2 J9U|987007435590505171 | ||
| 996 | ‡2 ISNI|0000000410280122 | ||
| 996 | ‡2 LC|n 96104534 | ||
| 996 | ‡2 BNF|10373206 | ||
| 996 | ‡2 NUKAT|n 01015647 | ||
| 996 | ‡2 DNB|124925847 | ||
| 996 | ‡2 BNF|12493691 | ||
| 996 | ‡2 BIBSYS|90611675 | ||
| 996 | ‡2 PTBNP|70704 | ||
| 996 | ‡2 LC|no2012021210 | ||
| 996 | ‡2 ISNI|000000040155200X | ||
| 996 | ‡2 ISNI|0000000030716545 | ||
| 996 | ‡2 DNB|173321771 | ||
| 996 | ‡2 ISNI|0000000041714406 | ||
| 996 | ‡2 NLA|000035036363 | ||
| 996 | ‡2 DNB|1159152373 | ||
| 996 | ‡2 BNCHL|10000000000000000168661 | ||
| 996 | ‡2 LNB|LNC10-000117422 | ||
| 996 | ‡2 DBC|87097919140245 | ||
| 996 | ‡2 LNB|LNC10-000117421 | ||
| 996 | ‡2 ISNI|0000000049597814 | ||
| 996 | ‡2 NSK|000603582 | ||
| 996 | ‡2 W2Z|97035273 | ||
| 996 | ‡2 NUKAT|n 2012256232 | ||
| 996 | ‡2 LC|nr 93034422 | ||
| 996 | ‡2 J9U|987007460939905171 | ||
| 996 | ‡2 RERO|A003771972 | ||
| 996 | ‡2 ISNI|000000005017056X | ||
| 996 | ‡2 N6I|vtls000258932 | ||
| 996 | ‡2 NTA|250617145 | ||
| 996 | ‡2 LC|n 91037900 | ||
| 996 | ‡2 ISNI|000000005444066X | ||
| 996 | ‡2 ISNI|0000000082488417 | ||
| 996 | ‡2 ISNI|0000000073756221 | ||
| 996 | ‡2 DNB|138802963 | ||
| 996 | ‡2 LC|n 90660202 | ||
| 996 | ‡2 ISNI|0000000042789979 | ||
| 996 | ‡2 SELIBR|205349 | ||
| 996 | ‡2 B2Q|0000936261 | ||
| 996 | ‡2 LC|n 82019436 | ||
| 996 | ‡2 LIH|LNB:B_q__z_P;=CN | ||
| 996 | ‡2 NII|DA01013835 | ||
| 996 | ‡2 J9U|987007324818505171 | ||
| 996 | ‡2 LC|n 91075452 | ||
| 996 | ‡2 CAOONL|ncf10481026 | ||
| 996 | ‡2 PLWABN|9810555119905606 | ||
| 996 | ‡2 NTA|307928101 | ||
| 996 | ‡2 LC|no2020017649 | ||
| 996 | ‡2 DNB|134504720 | ||
| 996 | ‡2 LC|no 00078912 | ||
| 996 | ‡2 LC|no2016054908 | ||
| 996 | ‡2 LC|nb2022014990 | ||
| 996 | ‡2 SUDOC|069319995 | ||
| 996 | ‡2 ISNI|0000000018065778 | ||
| 996 | ‡2 DNB|102619085 | ||
| 996 | ‡2 N6I|vtls001102867 | ||
| 996 | ‡2 NII|DA00964354 | ||
| 996 | ‡2 CAOONL|ncf10423193 | ||
| 996 | ‡2 DNB|109018141 | ||
| 996 | ‡2 LC|n 2009037814 | ||
| 996 | ‡2 NLA|000035887586 | ||
| 996 | ‡2 DNB|1221383671 | ||
| 996 | ‡2 ISNI|0000000041004340 | ||
| 996 | ‡2 ISNI|0000000081062086 | ||
| 996 | ‡2 LC|no2023044217 | ||
| 996 | ‡2 LC|no 00043922 | ||
| 996 | ‡2 BNE|XX1057521 | ||
| 996 | ‡2 BIBSYS|90117340 | ||
| 996 | ‡2 LC|no 98007799 | ||
| 996 | ‡2 DNB|138803242 | ||
| 996 | ‡2 LC|n 93046609 | ||
| 996 | ‡2 ISNI|0000000050743532 | ||
| 996 | ‡2 LIH|LNB:WV7;=BQ | ||
| 996 | ‡2 ISNI|0000000511034369 | ||
| 996 | ‡2 ISNI|0000000120929819 | ||
| 996 | ‡2 N6I|vtls000335273 | ||
| 996 | ‡2 DNB|118642073 | ||
| 996 | ‡2 BIBSYS|8008522 | ||
| 996 | ‡2 LC|n 79124616 | ||
| 996 | ‡2 JPG|500020793 | ||
| 996 | ‡2 LC|n 91108863 | ||
| 996 | ‡2 N6I|vtls001209980 | ||
| 996 | ‡2 LC|n 82153142 | ||
| 996 | ‡2 J9U|987007327002705171 | ||
| 996 | ‡2 SUDOC|104641231 | ||
| 996 | ‡2 JPG|500168852 | ||
| 996 | ‡2 ISNI|0000000121491927 | ||
| 996 | ‡2 LC|n 85091661 | ||
| 996 | ‡2 LC|n 2011005889 | ||
| 996 | ‡2 J9U|987007431941105171 | ||
| 996 | ‡2 LC|n 2007006782 | ||
| 996 | ‡2 BIBSYS|97035273 | ||
| 996 | ‡2 NUKAT|n 2019216869 | ||
| 996 | ‡2 LNB|LNC10-000334569 | ||
| 996 | ‡2 ISNI|0000000033477332 | ||
| 996 | ‡2 LC|n 87944919 | ||
| 996 | ‡2 CAOONL|ncf10242095 | ||
| 996 | ‡2 RERO|A006117440 | ||
| 996 | ‡2 J9U|987007274506905171 | ||
| 996 | ‡2 ISNI|0000000496910331 | ||
| 996 | ‡2 J9U|987007418470205171 | ||
| 996 | ‡2 RERO|A016633948 | ||
| 996 | ‡2 J9U|987007463428105171 | ||
| 996 | ‡2 ISNI|0000000052712924 | ||
| 996 | ‡2 ERRR|12321199 | ||
| 996 | ‡2 ISNI|0000000467944540 | ||
| 996 | ‡2 BIBSYS|90853066 | ||
| 996 | ‡2 NTA|115044000 | ||
| 996 | ‡2 LC|no2002015836 | ||
| 996 | ‡2 LC|no 96061881 | ||
| 996 | ‡2 ISNI|0000000038838248 | ||
| 996 | ‡2 BAV|495_260467 | ||
| 996 | ‡2 J9U|987007323606105171 | ||
| 996 | ‡2 PLWABN|9810614166105606 | ||
| 996 | ‡2 ISNI|0000000039709085 | ||
| 996 | ‡2 LC|no 96039700 | ||
| 996 | ‡2 NTA|071078150 | ||
| 996 | ‡2 BNF|17748293 | ||
| 996 | ‡2 LC|no2021031659 | ||
| 996 | ‡2 DNB|125734875 | ||
| 996 | ‡2 LC|no2018079838 | ||
| 996 | ‡2 DNB|1157542980 | ||
| 996 | ‡2 BNE|XX1611232 | ||
| 996 | ‡2 N6I|vtls000282228 | ||
| 996 | ‡2 NKC|mub20191033790 | ||
| 996 | ‡2 PLWABN|9810554834405606 | ||
| 996 | ‡2 DNB|138803315 | ||
| 996 | ‡2 NII|DA10962038 | ||
| 996 | ‡2 LC|n 80152058 | ||
| 996 | ‡2 BIBSYS|90524378 | ||
| 996 | ‡2 BNF|13899284 | ||
| 996 | ‡2 RERO|A000140587 | ||
| 996 | ‡2 LC|no 97003209 | ||
| 996 | ‡2 ISNI|0000000066873745 | ||
| 996 | ‡2 CAOONL|ncf11333450 | ||
| 996 | ‡2 BIBSYS|90409528 | ||
| 996 | ‡2 CAOONL|ncf10034367 | ||
| 996 | ‡2 BNF|13562425 | ||
| 996 | ‡2 ISNI|0000000066855010 | ||
| 996 | ‡2 ISNI|000000011071518X | ||
| 996 | ‡2 NTA|158909712 | ||
| 996 | ‡2 SUDOC|243743157 | ||
| 996 | ‡2 LC|no2004095585 | ||
| 996 | ‡2 LC|n 83005296 | ||
| 996 | ‡2 CAOONL|ncf11955034 | ||
| 996 | ‡2 N6I|vtls002110154 | ||
| 996 | ‡2 BAV|495_260466 | ||
| 996 | ‡2 BAV|495_260465 | ||
| 996 | ‡2 LC|n 90726142 | ||
| 996 | ‡2 DNB|111476812X | ||
| 996 | ‡2 NUKAT|n 2017033657 | ||
| 996 | ‡2 LC|n 94019860 | ||
| 996 | ‡2 BNE|XX1714329 | ||
| 996 | ‡2 ISNI|0000000026591225 | ||
| 996 | ‡2 LC|no2013022104 | ||
| 996 | ‡2 LC|no2007002221 | ||
| 996 | ‡2 LC|no2015002883 | ||
| 996 | ‡2 SELIBR|280445 | ||
| 996 | ‡2 J9U|987007276060305171 | ||
| 996 | ‡2 ISNI|0000000383303033 | ||
| 996 | ‡2 LC|no2001101276 | ||
| 996 | ‡2 NLA|000035130511 | ||
| 996 | ‡2 LC|n 2020029977 | ||
| 996 | ‡2 ISNI|0000000117212120 | ||
| 996 | ‡2 RERO|A022969444 | ||
| 996 | ‡2 DNB|129089842 | ||
| 996 | ‡2 LC|nb 97058767 | ||
| 996 | ‡2 DNB|112406920 | ||
| 996 | ‡2 NTA|068856172 | ||
| 996 | ‡2 LC|n 88657691 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 |
