Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q56986347 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241120235919.0 | ||
| 008 | 241120nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q56986347 | ||
| 024 | ‡a 0000-0002-4045-4467 ‡2 orcid | ||
| 024 | ‡a 7402043175 ‡2 scopus | ||
| 035 | ‡a (OCoLC)Q56986347 | ||
| 100 | 0 | ‡a I-Wei Chen ‡c researcher ‡9 en | |
| 400 | 0 | ‡a I-Wei Chen ‡c onderzoeker ‡9 nl | |
| 670 | ‡a Author's A new tubular graphene form of a tetrahedrally connected cellular structure. | ||
| 670 | ‡a Author's A Robust and Conductive Black Tin Oxide Nanostructure Makes Efficient Lithium-Ion Batteries Possible. | ||
| 670 | ‡a Author's A study of the relationship of metabolic MR parameters to estrogen dependence in breast cancer xenografts | ||
| 670 | ‡a Author's Biodegradable resistive switching memory based on magnesium difluoride. | ||
| 670 | ‡a Author's Bisphosphonate-mediated gene vector delivery from the metal surfaces of stents. | ||
| 670 | ‡a Author's Cholesterol-derivatized polyurethane: characterization and endothelial cell adhesion. | ||
| 670 | ‡a Author's Distinguishing uniform switching from filamentary switching in resistance memory using a fracture test | ||
| 670 | ‡a Author's Dynamic Kerr effect and the spectral weight transfer of the manganites | ||
| 670 | ‡a Author's Dynamic-load-enabled ultra-low power multiple-state RRAM devices. | ||
| 670 | ‡a Author's Electrodes with Electrodeposited Water-excluding Polymer Coating Enable High-Voltage Aqueous Supercapacitors | ||
| 670 | ‡a Author's Electron localization and magnetism in SrRuO3 with non-magnetic cation substitution | ||
| 670 | ‡a Author's Nanofilament Dynamics in Resistance Memory: Model and Validation | ||
| 670 | ‡a Author's Nitrogen-doped mesoporous carbon of extraordinary capacitance for electrochemical energy storage. | ||
| 670 | ‡a Author's Nucleation and growth mechanism of ferroelectric domain-wall motion. | ||
| 670 | ‡a Author's Observing Oxygen Vacancy Driven Electroforming in Pt-TiO2-Pt Device via Strong Metal Support Interaction | ||
| 670 | ‡a Author's Quantitative evaluation of the reticuloendothelial system function with dynamic MRI | ||
| 670 | ‡a Author's Sintering dense nanocrystalline ceramics without final-stage grain growth | ||
| 670 | ‡a Author's Surface-modified silica colloid for diagnostic imaging | ||
| 670 | ‡a Author's X-ray-absorption studies of zirconia polymorphs. I. Characteristic local structures | ||
| 670 | ‡a Author's X-ray-absorption studies of zirconia polymorphs. II. Effect of Y2O3 dopant on ZrO2 structure | ||
| 670 | ‡a Author's X-ray-absorption studies of zirconia polymorphs. III. Static distortion and thermal distortion | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/processed/DNB|1158180985 | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/processed/NUKAT|n 2019024538 | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/viaf/9048152637793020220003 | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/processed/LC|n 2018188574 | ||
| 670 | ‡a wikidata authority control ‡u https://viaf.org/processed/SUDOC|21997036X | ||
| 909 | ‡a (scopus) 7402043175 ‡9 1 | ||
| 909 | ‡a (orcid) 0000000240454467 ‡9 1 | ||
| 919 | ‡a distinguishinguniformswitchingfromfilamentaryswitchinginresistancememoryusingafracturetest ‡A Distinguishing uniform switching from filamentary switching in resistance memory using a fracture test ‡9 1 | ||
| 919 | ‡a cholesterolderivatizedpolyurethanecharacterizationandendothelialcelladhesion ‡A Cholesterol-derivatized polyurethane: characterization and endothelial cell adhesion. ‡9 1 | ||
| 919 | ‡a bisphosphonatemediatedgenevectordeliveryfromthemetalsurfacesofstents ‡A Bisphosphonate-mediated gene vector delivery from the metal surfaces of stents. ‡9 1 | ||
| 919 | ‡a biodegradableresistiveswitchingmemorybasedonmagnesiumdifluoride ‡A Biodegradable resistive switching memory based on magnesium difluoride. ‡9 1 | ||
| 919 | ‡a studyoftherelationshipofmetabolicmrparameterstoestrogendependenceinbreastcancerxenografts ‡A A study of the relationship of metabolic MR parameters to estrogen dependence in breast cancer xenografts ‡9 1 | ||
| 919 | ‡a robustandconductiveblacktinoxidenanostructuremakesefficientlithiumionbatteriespossible ‡A A Robust and Conductive Black Tin Oxide Nanostructure Makes Efficient Lithium-Ion Batteries Possible. ‡9 1 | ||
| 919 | ‡a newtubulargrapheneformofatetrahedrallyconnectedcellularstructure ‡A A new tubular graphene form of a tetrahedrally connected cellular structure. ‡9 1 | ||
| 919 | ‡a 10rayabsorptionstudiesofzirconiapolymorphs3staticdistortionandthermaldistortion ‡A X-ray-absorption studies of zirconia polymorphs. III. Static distortion and thermal distortion ‡9 1 | ||
| 919 | ‡a 10rayabsorptionstudiesofzirconiapolymorphs2effectofy2o3dopantonzro2structure ‡A X-ray-absorption studies of zirconia polymorphs. II. Effect of Y2O3 dopant on ZrO2 structure ‡9 1 | ||
| 919 | ‡a 10rayabsorptionstudiesofzirconiapolymorphs1characteristiclocalstructures ‡A X-ray-absorption studies of zirconia polymorphs. I. Characteristic local structures ‡9 1 | ||
| 919 | ‡a surfacemodifiedsilicacolloidfordiagnosticimaging ‡A Surface-modified silica colloid for diagnostic imaging ‡9 1 | ||
| 919 | ‡a sinteringdensenanocrystallineceramicswithoutfinalstagegraingrowth ‡A Sintering dense nanocrystalline ceramics without final-stage grain growth ‡9 1 | ||
| 919 | ‡a quantitativeevaluationofthereticuloendothelialsystemfunctionwithdynamicmri ‡A Quantitative evaluation of the reticuloendothelial system function with dynamic MRI ‡9 1 | ||
| 919 | ‡a observingoxygenvacancydrivenelectroforminginpttio2ptdeviceviastrongmetalsupportinteraction ‡A Observing Oxygen Vacancy Driven Electroforming in Pt-TiO2-Pt Device via Strong Metal Support Interaction ‡9 1 | ||
| 919 | ‡a nucleationandgrowthmechanismofferroelectricdomainwallmotion ‡A Nucleation and growth mechanism of ferroelectric domain-wall motion. ‡9 1 | ||
| 919 | ‡a nitrogendopedmesoporouscarbonofextraordinarycapacitanceforelectrochemicalenergystorage ‡A Nitrogen-doped mesoporous carbon of extraordinary capacitance for electrochemical energy storage. ‡9 1 | ||
| 919 | ‡a nanofilamentdynamicsinresistancememorymodelandvalidation ‡A Nanofilament Dynamics in Resistance Memory: Model and Validation ‡9 1 | ||
| 919 | ‡a electronlocalizationandmagnetisminsrruo3withnonmagneticcationsubstitution ‡A Electron localization and magnetism in SrRuO3 with non-magnetic cation substitution ‡9 1 | ||
| 919 | ‡a electrodeswithelectrodepositedwaterexcludingpolymercoatingenablehighvoltageaqueoussupercapacitors ‡A Electrodes with Electrodeposited Water-excluding Polymer Coating Enable High-Voltage Aqueous Supercapacitors ‡9 1 | ||
| 919 | ‡a dynamicloadenabledultralowpowermultiplestaterramdevices ‡A Dynamic-load-enabled ultra-low power multiple-state RRAM devices. ‡9 1 | ||
| 919 | ‡a dynamickerreffectandthespectralweighttransferofthemanganites ‡A Dynamic Kerr effect and the spectral weight transfer of the manganites ‡9 1 | ||
| 996 | ‡2 J9U|987007276539705171 | ||
| 996 | ‡2 J9U|987007596984605171 | ||
| 996 | ‡2 CYT|AC000232390 | ||
| 996 | ‡2 CYT|AC000261604 | ||
| 996 | ‡2 NUKAT|n 2008093944 | ||
| 996 | ‡2 DBC|87097969420257 | ||
| 996 | ‡2 ISNI|0000000043296519 | ||
| 996 | ‡2 DNB|1312237244 | ||
| 996 | ‡2 LC|nr 91003485 | ||
| 996 | ‡2 RERO|A003099808 | ||
| 996 | ‡2 RERO|A003099809 | ||
| 996 | ‡2 CYT|AC000250801 | ||
| 996 | ‡2 SUDOC|260777994 | ||
| 996 | ‡2 J9U|987010679501705171 | ||
| 996 | ‡2 LC|n 2019187391 | ||
| 996 | ‡2 CYT|AC000249928 | ||
| 996 | ‡2 LC|n 86854579 | ||
| 996 | ‡2 ISNI|0000000040404860 | ||
| 996 | ‡2 NII|DA08840832 | ||
| 996 | ‡2 SUDOC|129340405 | ||
| 996 | ‡2 CYT|AC000236845 | ||
| 996 | ‡2 CYT|AC000272560 | ||
| 996 | ‡2 LC|n 2012208617 | ||
| 996 | ‡2 RERO|A023378445 | ||
| 996 | ‡2 LC|nr 94005942 | ||
| 996 | ‡2 PLWABN|9812422950905606 | ||
| 996 | ‡2 ISNI|0000000064135191 | ||
| 996 | ‡2 ISNI|0000000063317663 | ||
| 996 | ‡2 ISNI|0000000127030355 | ||
| 996 | ‡2 NSK|000157703 | ||
| 996 | ‡2 CYT|AC000524403 | ||
| 996 | ‡2 CYT|AC000235500 | ||
| 996 | ‡2 KRNLK|KAC200712952 | ||
| 996 | ‡2 SIMACOB|117215587 | ||
| 996 | ‡2 CYT|AC000618522 | ||
| 996 | ‡2 CYT|AC660543 | ||
| 996 | ‡2 ISNI|0000000064364103 | ||
| 996 | ‡2 J9U|987007369521705171 | ||
| 996 | ‡2 NUKAT|n 2016052014 | ||
| 996 | ‡2 LC|n 2021066626 | ||
| 996 | ‡2 CAOONL|ncf12140874 | ||
| 996 | ‡2 ISNI|0000000107878682 | ||
| 996 | ‡2 ISNI|0000000063503773 | ||
| 996 | ‡2 LC|nr 96031257 | ||
| 996 | ‡2 LC|no 97000054 | ||
| 996 | ‡2 LC|no2016059959 | ||
| 996 | ‡2 DNB|1181385563 | ||
| 996 | ‡2 ISNI|0000000063386343 | ||
| 996 | ‡2 ISNI|0000000072937223 | ||
| 996 | ‡2 ISNI|000000011436740X | ||
| 996 | ‡2 LC|no2003062748 | ||
| 996 | ‡2 DNB|1172903107 | ||
| 996 | ‡2 DNB|1159293716 | ||
| 996 | ‡2 J9U|987007341773605171 | ||
| 996 | ‡2 LC|n 86852639 | ||
| 996 | ‡2 SUDOC|273770462 | ||
| 996 | ‡2 CYT|AC000614890 | ||
| 996 | ‡2 CYT|AC000008703 | ||
| 996 | ‡2 LC|no 91012934 | ||
| 996 | ‡2 LC|n 2010181396 | ||
| 996 | ‡2 BNF|16681730 | ||
| 996 | ‡2 LC|no2016160145 | ||
| 996 | ‡2 CYT|AC000366752 | ||
| 996 | ‡2 DNB|1281680540 | ||
| 996 | ‡2 SUDOC|15851372X | ||
| 996 | ‡2 NKC|stk2008477238 | ||
| 996 | ‡2 LC|no2012044625 | ||
| 996 | ‡2 CYT|AC000611120 | ||
| 996 | ‡2 NUKAT|n 2009114495 | ||
| 996 | ‡2 SUDOC|249305070 | ||
| 996 | ‡2 LC|n 78072137 | ||
| 996 | ‡2 ISNI|0000000064287953 | ||
| 996 | ‡2 CYT|AC000250546 | ||
| 996 | ‡2 ISNI|0000000063885134 | ||
| 996 | ‡2 ISNI|0000000119070306 | ||
| 996 | ‡2 ISNI|0000000063651602 | ||
| 996 | ‡2 SUDOC|086271369 | ||
| 996 | ‡2 BNF|13492783 | ||
| 996 | ‡2 LC|no2016044203 | ||
| 996 | ‡2 ISNI|0000000081423654 | ||
| 996 | ‡2 ISNI|0000000114534167 | ||
| 996 | ‡2 ISNI|0000000049297563 | ||
| 996 | ‡2 CAOONL|ncf11066274 | ||
| 996 | ‡2 NSK|000197919 | ||
| 996 | ‡2 SUDOC|087099977 | ||
| 996 | ‡2 BNF|11896513 | ||
| 996 | ‡2 LC|n 86141083 | ||
| 996 | ‡2 NKC|ntk2018980807 | ||
| 996 | ‡2 LC|nr 93052206 | ||
| 996 | ‡2 LC|n 2012061997 | ||
| 996 | ‡2 LC|no2012005683 | ||
| 996 | ‡2 SUDOC|234689471 | ||
| 996 | ‡2 J9U|987007260329805171 | ||
| 996 | ‡2 DNB|136664679 | ||
| 996 | ‡2 J9U|987008729885605171 | ||
| 996 | ‡2 NTA|26798443X | ||
| 996 | ‡2 SUDOC|050277243 | ||
| 996 | ‡2 SZ|171528735 | ||
| 996 | ‡2 ISNI|0000000446436125 | ||
| 996 | ‡2 ISNI|000000002870510X | ||
| 996 | ‡2 SUDOC|116743468 | ||
| 996 | ‡2 J9U|987007427136005171 | ||
| 996 | ‡2 ISNI|0000000498449016 | ||
| 996 | ‡2 LC|n 2021010237 | ||
| 996 | ‡2 ISNI|0000000063636090 | ||
| 996 | ‡2 LC|no2017054335 | ||
| 996 | ‡2 SUDOC|060592567 | ||
| 996 | ‡2 SUDOC|271277734 | ||
| 996 | ‡2 LC|nb 98091142 | ||
| 996 | ‡2 LC|nr 91002346 | ||
| 996 | ‡2 NTA|306152223 | ||
| 996 | ‡2 SUDOC|254479375 | ||
| 996 | ‡2 ISNI|0000000108016486 | ||
| 996 | ‡2 CYT|AC000232058 | ||
| 996 | ‡2 KRNLK|KAC200708735 | ||
| 996 | ‡2 CYT|AC000251213 | ||
| 996 | ‡2 NDL|001303886 | ||
| 996 | ‡2 CYT|AC000236522 | ||
| 996 | ‡2 ISNI|0000000064209605 | ||
| 996 | ‡2 ISNI|0000000500484778 | ||
| 996 | ‡2 CYT|AC000591112 | ||
| 996 | ‡2 LC|nr 90006928 | ||
| 996 | ‡2 CYT|AC000251361 | ||
| 996 | ‡2 LC|n 81144980 | ||
| 996 | ‡2 SUDOC|197434703 | ||
| 996 | ‡2 CYT|AC000236318 | ||
| 996 | ‡2 J9U|987007461014805171 | ||
| 996 | ‡2 CYT|AC000650295 | ||
| 996 | ‡2 CAOONL|ncf11573530 | ||
| 996 | ‡2 CYT|AC000206170 | ||
| 996 | ‡2 NII|DA06105373 | ||
| 996 | ‡2 NII|DA17675497 | ||
| 996 | ‡2 DNB|1269435434 | ||
| 996 | ‡2 PLWABN|9812801000305606 | ||
| 996 | ‡2 DNB|1255791160 | ||
| 996 | ‡2 BIBSYS|1653056312077 | ||
| 996 | ‡2 NTA|18114171X | ||
| 996 | ‡2 SUDOC|21997036X | ||
| 996 | ‡2 DNB|1192692306 | ||
| 996 | ‡2 CYT|AC000253357 | ||
| 996 | ‡2 LC|nr 89004881 | ||
| 996 | ‡2 LC|n 2018009048 | ||
| 996 | ‡2 NUKAT|n 2015174066 | ||
| 996 | ‡2 ISNI|0000000063557771 | ||
| 996 | ‡2 ISNI|0000000463631002 | ||
| 996 | ‡2 PLWABN|9810819787805606 | ||
| 996 | ‡2 ISNI|0000000447456160 | ||
| 996 | ‡2 CYT|AC000597621 | ||
| 996 | ‡2 LC|no2023132608 | ||
| 996 | ‡2 LC|nb2023012315 | ||
| 996 | ‡2 CYT|AC000232552 | ||
| 996 | ‡2 LC|no2004091208 | ||
| 996 | ‡2 ISNI|0000000477345760 | ||
| 996 | ‡2 ISNI|0000000066457215 | ||
| 996 | ‡2 CYT|AC000250551 | ||
| 996 | ‡2 ISNI|0000000449336218 | ||
| 996 | ‡2 CYT|AC000232550 | ||
| 996 | ‡2 LC|no2023122813 | ||
| 996 | ‡2 LC|n 90665103 | ||
| 996 | ‡2 NII|DA11042487 | ||
| 996 | ‡2 BIBSYS|90361289 | ||
| 996 | ‡2 LC|n 97004972 | ||
| 996 | ‡2 CAOONL|ncf11907922 | ||
| 996 | ‡2 CYT|AC000236151 | ||
| 996 | ‡2 BIBSYS|10071685 | ||
| 996 | ‡2 SUDOC|255879342 | ||
| 996 | ‡2 SUDOC|267993587 | ||
| 996 | ‡2 ISNI|0000000063660672 | ||
| 996 | ‡2 NTA|125183933 | ||
| 996 | ‡2 ISNI|0000000437155022 | ||
| 996 | ‡2 J9U|987012794969205171 | ||
| 996 | ‡2 LC|no2012106193 | ||
| 996 | ‡2 LC|n 89604220 | ||
| 996 | ‡2 CYT|AC000250397 | ||
| 996 | ‡2 LC|n 81090563 | ||
| 996 | ‡2 ISNI|0000000064216530 | ||
| 996 | ‡2 LC|no 97049771 | ||
| 996 | ‡2 LC|n 80092621 | ||
| 996 | ‡2 J9U|987007313874905171 | ||
| 996 | ‡2 ISNI|0000000364892872 | ||
| 996 | ‡2 ISNI|0000000084592453 | ||
| 996 | ‡2 BNF|15069135 | ||
| 996 | ‡2 ISNI|0000000496387085 | ||
| 996 | ‡2 ISNI|0000000064215888 | ||
| 996 | ‡2 LC|n 80118778 | ||
| 996 | ‡2 LC|n 78065518 | ||
| 996 | ‡2 LC|n 88682185 | ||
| 996 | ‡2 J9U|987007444920805171 | ||
| 996 | ‡2 DNB|143231243 | ||
| 996 | ‡2 NUKAT|n 2007101180 | ||
| 996 | ‡2 B2Q|0000085547 | ||
| 996 | ‡2 LC|n 2021012700 | ||
| 996 | ‡2 SUDOC|152255966 | ||
| 996 | ‡2 NLA|000035088173 | ||
| 996 | ‡2 DNB|1326618938 | ||
| 996 | ‡2 ISNI|0000000029497904 | ||
| 996 | ‡2 NII|DA18039287 | ||
| 996 | ‡2 LC|n 2005184506 | ||
| 996 | ‡2 ISNI|000000006418601X | ||
| 996 | ‡2 LC|nr 94003249 | ||
| 996 | ‡2 DNB|171316991 | ||
| 996 | ‡2 ISNI|0000000049610345 | ||
| 996 | ‡2 ISNI|0000000064157198 | ||
| 996 | ‡2 DNB|173274374 | ||
| 996 | ‡2 CYT|AC000251180 | ||
| 996 | ‡2 SUDOC|190127031 | ||
| 996 | ‡2 NKC|xx0257728 | ||
| 996 | ‡2 NTA|070867283 | ||
| 996 | ‡2 ISNI|0000000001091582 | ||
| 996 | ‡2 J9U|987007393018605171 | ||
| 996 | ‡2 ISNI|0000000041290981 | ||
| 996 | ‡2 ISNI|000000008255252X | ||
| 996 | ‡2 LC|no 00045270 | ||
| 996 | ‡2 CYT|AC000236120 | ||
| 996 | ‡2 LIH|LNB:B7KH;=_v_N | ||
| 996 | ‡2 NUKAT|n 2011042949 | ||
| 996 | ‡2 LC|nr 92007203 | ||
| 996 | ‡2 CYT|AC000231041 | ||
| 996 | ‡2 CAOONL|ncf12129229 | ||
| 996 | ‡2 LC|no2010059562 | ||
| 996 | ‡2 J9U|987010024240105171 | ||
| 996 | ‡2 LC|nr 94016477 | ||
| 996 | ‡2 ISNI|0000000064123158 | ||
| 996 | ‡2 DNB|1162313323 | ||
| 996 | ‡2 LC|n 2009005511 | ||
| 996 | ‡2 NLA|000035531589 | ||
| 996 | ‡2 CAOONL|ncf10990230 | ||
| 996 | ‡2 ISNI|0000000110850816 | ||
| 996 | ‡2 DNB|1036688186 | ||
| 996 | ‡2 PLWABN|9812854148805606 | ||
| 996 | ‡2 CYT|AC000640953 | ||
| 996 | ‡2 LC|n 2012000995 | ||
| 996 | ‡2 LC|no2020097226 | ||
| 996 | ‡2 DNB|1250948347 | ||
| 996 | ‡2 SUDOC|122886852 | ||
| 996 | ‡2 PLWABN|9810607817705606 | ||
| 996 | ‡2 LC|no2011102078 | ||
| 996 | ‡2 LC|n 2018188574 | ||
| 996 | ‡2 NDL|01135898 | ||
| 996 | ‡2 ISNI|0000000054031161 | ||
| 996 | ‡2 LC|n 2010035090 | ||
| 996 | ‡2 ISNI|0000000078127264 | ||
| 996 | ‡2 LC|n 85204264 | ||
| 996 | ‡2 NYNYRILM|35118 | ||
| 996 | ‡2 ISNI|0000000064311351 | ||
| 996 | ‡2 PLWABN|9813260887305606 | ||
| 996 | ‡2 ISNI|0000000383542771 | ||
| 996 | ‡2 LC|n 2021009876 | ||
| 996 | ‡2 SUDOC|034022406 | ||
| 996 | ‡2 DNB|173309461 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 | ||
| 998 | ‡a Chen, John W. ‡2 SUDOC|21997036X ‡3 suggested | ||
| 998 | ‡a Chen, John W. ‡2 BIBSYS|1634281498141 ‡3 viafid | ||
| 998 | ‡a Chen, I-wei ‡2 DNB|1158180985 ‡3 suggested ‡3 standard number | ||
| 998 | ‡a Chen, John W. ‡2 LC|n 2018188574 ‡3 suggested | ||
| 998 | ‡a Chen, John W. ‡2 NUKAT|n 2019024538 ‡3 suggested ‡3 viafid |
