VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q56996857  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000335.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q56996857‏
024 ‎‡a  0000-0002-5100-973X‏ ‎‡2  orcid‏
024 ‎‡a  0000-0002-2041-4038‏ ‎‡2  orcid‏
035 ‎‡a  (OCoLC)Q56996857‏
100 0 ‎‡a  خوان ساندوفال‏ ‎‡9  ar‏
375 ‎‡a  1‏ ‎‡2  iso5218‏
400 0 ‎‡a  Juan Sandoval‏ ‎‡9  ast‏
400 0 ‎‡a  Juan Sandoval‏ ‎‡c  researcher (ORCID 0000-0002-5100-973X)‏ ‎‡9  en‏
400 0 ‎‡a  Juan Sandoval‏ ‎‡c  investigador‏ ‎‡9  es‏
400 0 ‎‡a  Juan Sandoval‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's 31st Annual Meeting and Associated Programs of the Society for Immunotherapy of Cancer (SITC 2016): part one‏
670 ‎‡a  Author's A DERL3-associated defect in the degradation of SLC2A1 mediates the Warburg effect‏
670 ‎‡a  Author's A DNA methylation-based definition of biologically distinct breast cancer subtypes‏
670 ‎‡a  Author's A Novel Epigenetic Signature for Early Diagnosis in Lung Cancer.‏
670 ‎‡a  Author's A Prognostic DNA Methylation Signature for Stage I Non–Small-Cell Lung Cancer‏
670 ‎‡a  Author's Age-dependent epigenetic control of differentiation inhibitors is critical for remyelination efficiency‏
670 ‎‡a  Author's An Epigenetic Signature in Adipose Tissue Is Linked to Nicotinamide N-Methyltransferase Gene Expression‏
670 ‎‡a  Author's ASB1 differential methylation in ischaemic cardiomyopathy: relationship with left ventricular performance in end-stage heart failure patients.‏
670 ‎‡a  Author's Cancer epigenomics: beyond genomics‏
670 ‎‡a  Author's CD137 (4-1BB) Costimulation Modifies DNA Methylation in CD8+ T Cell-Relevant Genes.‏
670 ‎‡a  Author's Corrigendum: A DERL3-associated defect in the degradation of SLC2A1 mediates the Warburg effect‏
670 ‎‡a  Author's Cross-talk between oxidative stress and pro-inflammatory cytokines in acute pancreatitis: a key role for protein phosphatases.‏
670 ‎‡a  Author's Disruption of NIPBL/Scc2 in Cornelia de Lange Syndrome provokes cohesin genome-wide redistribution with an impact in the transcriptome‏
670 ‎‡a  Author's DNA methylation contributes to natural human variation‏
670 ‎‡a  Author's DNA methylation map in circulating leukocytes mirrors subcutaneous adipose tissue methylation pattern: a genome-wide analysis from non-obese and obese patients.‏
670 ‎‡a  Author's DNA methylation profiling in breast cancer discordant identical twins identifies DOK7 as novel epigenetic biomarker‏
670 ‎‡a  Author's Early radiological response as predictor of overall survival in non-small cell lung cancer‏
670 ‎‡a  Author's Early radiological response as predictor of overall survival in non-small cell lung cancer (NSCLC) patients with epidermal growth factor receptor mutations.‏
670 ‎‡a  Author's Epigenetic alterations leading to TMPRSS4 promoter hypomethylation and protein overexpression predict poor prognosis in squamous lung cancer patients‏
670 ‎‡a  Author's Epigenetic control of influenza virus: role of H3K79 methylation in interferon-induced antiviral response.‏
670 ‎‡a  Author's Epigenetic crosstalk: a molecular language in human metabolic disorders‏
670 ‎‡a  Author's Epigenetic disruption of the PIWI pathway in human spermatogenic disorders‏
670 ‎‡a  Author's Epigenetic inactivation of the p53-induced long noncoding RNA TP53 target 1 in human cancer‏
670 ‎‡a  Author's Epigenetic modifiers are necessary but not sufficient for reprogramming non-myelinating cells into myelin gene-expressing cells‏
670 ‎‡a  Author's Epigenetic Regulation of Early- and Late-Response Genes in Acute Pancreatitis‏
670 ‎‡a  Author's Epigenetic regulation of vitamin D metabolism in human lung adenocarcinoma‏
670 ‎‡a  Author's Epigenetics and Oxidative Stress in Aging‏
670 ‎‡a  Author's Epigenomic signature of adrenoleukodystrophy predicts compromised oligodendrocyte differentiation.‏
670 ‎‡a  Author's Generation and characterization of rat and mouse monoclonal antibodies specific for MeCP2 and their use in X-inactivation studies‏
670 ‎‡a  Author's Genome-Wide DNA Methylation Analysis Identifies Novel Hypomethylated Non-Pericentromeric Genes with Potential Clinical Implications in ICF Syndrome‏
670 ‎‡a  Author's Genome-wide DNA methylation pattern in visceral adipose tissue differentiates insulin-resistant from insulin-sensitive obese subjects.‏
670 ‎‡a  Author's Genome-wide DNA methylation profiling predicts relapse in childhood B-cell acute lymphoblastic leukaemia‏
670 ‎‡a  Author's Glutamate cysteine ligase up-regulation fails in necrotizing pancreatitis.‏
670 ‎‡a  Author's Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels.‏
670 ‎‡a  Author's Identification of a gene-pathway associated with non-alcoholic steatohepatitis‏
670 ‎‡a  Author's Identification of an episignature of human colorectal cancer associated with obesity by genome-wide DNA methylation analysis.‏
670 ‎‡a  Author's Identification of HERC5 and its potential role in NSCLC progression‏
670 ‎‡a  Author's In vivo GSH depletion induces c-myc expression by modulation of chromatin protein complexes‏
670 ‎‡a  Author's Inhibition of p53 transcriptional activity: a potential target for future development of therapeutic strategies for primary demyelination‏
670 ‎‡a  Author's Interaction between cytokines and oxidative stress in acute pancreatitis.‏
670 ‎‡a  Author's Intergenic transcripts originating from a subclass of ribosomal DNA repeats silence ribosomal RNA genes in trans‏
670 ‎‡a  Author's Maternal imprinting on cognition markers of wild type and transgenic Alzheimer's disease model mice.‏
670 ‎‡a  Author's MicroRNA expression profiling and DNA methylation signature for deregulated microRNA in cutaneous T-cell lymphoma‏
670 ‎‡a  Author's MiR-204 silencing in intraepithelial to invasive cutaneous squamous cell carcinoma progression‏
670 ‎‡a  Author's miRNAs Regulation and Its Role as Biomarkers in Endometriosis‏
670 ‎‡a  Author's Molecular mechanisms of Id2 down-regulation in rat liver after acetaminophen overdose. Protection by N-acetyl-L-cysteine‏
670 ‎‡a  Author's Molecular-Subtype-Specific Biomarkers Improve Prediction of Prognosis in Colorectal Cancer‏
670 ‎‡a  Author's NF-ĸB as node for signal amplification during weaning‏
670 ‎‡a  Author's Nitric oxide triggers mammary gland involution after weaning: remodelling is delayed but not impaired in mice lacking inducible nitric oxide synthase‏
670 ‎‡a  Author's Non-CpG island promoter hypomethylation and miR-149 regulate the expression of SRPX2 in colorectal cancer‏
670 ‎‡a  Author's Notch1 Pathway Activation Results from the Epigenetic Abrogation of Notch-Related MicroRNAs in Mycosis Fungoides.‏
670 ‎‡a  Author's Novel insights into DNA methylation features in spermatozoa: stability and peculiarities‏
670 ‎‡a  Author's Obesity and menopause modify the epigenomic profile of breast cancer‏
670 ‎‡a  Author's Ordered transcriptional factor recruitment and epigenetic regulation of tnf-alpha in necrotizing acute pancreatitis‏
670 ‎‡a  Author's Oxidative and nitrosative stress in acute pancreatitis. Modulation by pentoxifylline and oxypurinol‏
670 ‎‡a  Author's Pentoxifylline prevents loss of PP2A phosphatase activity and recruitment of histone acetyltransferases to proinflammatory genes in acute pancreatitis.‏
670 ‎‡a  Author's Primary cutaneous marginal zone B-cell lymphoma: response to treatment and disease-free survival in a series of 137 patients.‏
670 ‎‡a  Author's Putative cis-regulatory drivers in colorectal cancer.‏
670 ‎‡a  Author's RNAPol-ChIP: a novel application of chromatin immunoprecipitation to the analysis of real-time gene transcription.‏
670 ‎‡a  Author's Role of redox signaling, protein phosphatases and histone acetylation in the inflammatory cascade in acute pancreatitis. Therapeutic implications.‏
670 ‎‡a  Author's The PEG13-DMR and brain-specific enhancers dictate imprinted expression within the 8q24 intellectual disability risk locus‏
670 ‎‡a  Author's The transcription factor Yin Yang 1 is essential for oligodendrocyte progenitor differentiation.‏
670 ‎‡a  Author's Thyroid hormone biosynthesis machinery is altered in the ischemic myocardium: An epigenomic study.‏
670 ‎‡a  Author's Translating cancer epigenomics into the clinic: focus on lung cancer‏
670 ‎‡a  Author's Validation of a DNA methylation microarray for 450,000 CpG sites in the human genome‏
670 ‎‡a  Author's Vitamin E deficiency induces liver nuclear factor-kappaB DNA-binding activity and changes in related genes‏
670 ‎‡a  Author's Whole-genome bisulfite DNA sequencing of a DNMT3B mutant patient‏
670 ‎‡a  Author's Whole genome grey and white matter DNA methylation profiles in dorsolateral prefrontal cortex.‏
909 ‎‡a  (orcid) 0000000220414038‏ ‎‡9  1‏
909 ‎‡a  (orcid) 000000025100973x‏ ‎‡9  1‏
912 ‎‡a  31stannualmeetingandassociatedprogramsofthesocietyforimmunotherapyofcancersitc2016part1‏ ‎‡A  31st Annual Meeting and Associated Programs of the Society for Immunotherapy of Cancer (SITC 2016): part one‏ ‎‡9  1‏
919 ‎‡a  molecularmechanismsofid2downregulationinratliverafteracetaminophenoverdoseprotectionbynacetyl50cysteine‏ ‎‡A  Molecular mechanisms of Id2 down-regulation in rat liver after acetaminophen overdose. Protection by N-acetyl-L-cysteine‏ ‎‡9  1‏
919 ‎‡a  mirnasregulationanditsroleasbiomarkersinendometriosis‏ ‎‡A  miRNAs Regulation and Its Role as Biomarkers in Endometriosis‏ ‎‡9  1‏
919 ‎‡a  mir204silencinginintraepithelialtoinvasivecutaneoussquamouscellcarcinomaprogression‏ ‎‡A  MiR-204 silencing in intraepithelial to invasive cutaneous squamous cell carcinoma progression‏ ‎‡9  1‏
919 ‎‡a  micrornaexpressionprofilinganddnamethylationsignatureforderegulatedmicrornaincutaneoustcelllymphoma‏ ‎‡A  MicroRNA expression profiling and DNA methylation signature for deregulated microRNA in cutaneous T-cell lymphoma‏ ‎‡9  1‏
919 ‎‡a  maternalimprintingoncognitionmarkersofwildtypeandtransgenicalzheimersdiseasemodelmice‏ ‎‡A  Maternal imprinting on cognition markers of wild type and transgenic Alzheimer's disease model mice.‏ ‎‡9  1‏
919 ‎‡a  intergenictranscriptsoriginatingfromasubclassofribosomaldnarepeatssilenceribosomalrnagenesintrans‏ ‎‡A  Intergenic transcripts originating from a subclass of ribosomal DNA repeats silence ribosomal RNA genes in trans‏ ‎‡9  1‏
919 ‎‡a  interactionbetweencytokinesandoxidativestressinacutepancreatitis‏ ‎‡A  Interaction between cytokines and oxidative stress in acute pancreatitis.‏ ‎‡9  1‏
919 ‎‡a  inhibitionofp53transcriptionalactivityapotentialtargetforfuturedevelopmentoftherapeuticstrategiesforprimarydemyelination‏ ‎‡A  Inhibition of p53 transcriptional activity: a potential target for future development of therapeutic strategies for primary demyelination‏ ‎‡9  1‏
919 ‎‡a  invivogshdepletioninduces100mycexpressionbymodulationofchromatinproteincomplexes‏ ‎‡A  In vivo GSH depletion induces c-myc expression by modulation of chromatin protein complexes‏ ‎‡9  1‏
919 ‎‡a  identificationofherc5anditspotentialroleinnsclcprogression‏ ‎‡A  Identification of HERC5 and its potential role in NSCLC progression‏ ‎‡9  1‏
919 ‎‡a  identificationofanepisignatureofhumancolorectalcancerassociatedwithobesitybygenomewidednamethylationanalysis‏ ‎‡A  Identification of an episignature of human colorectal cancer associated with obesity by genome-wide DNA methylation analysis.‏ ‎‡9  1‏
919 ‎‡a  identificationofagenepathwayassociatedwithnonalcoholicsteatohepatitis‏ ‎‡A  Identification of a gene-pathway associated with non-alcoholic steatohepatitis‏ ‎‡9  1‏
919 ‎‡a  hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels‏ ‎‡A  Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels.‏ ‎‡9  1‏
919 ‎‡a  glutamatecysteineligaseupregulationfailsinnecrotizingpancreatitis‏ ‎‡A  Glutamate cysteine ligase up-regulation fails in necrotizing pancreatitis.‏ ‎‡9  1‏
919 ‎‡a  genomewidednamethylationprofilingpredictsrelapseinchildhoodbcellacutelymphoblasticleukaemia‏ ‎‡A  Genome-wide DNA methylation profiling predicts relapse in childhood B-cell acute lymphoblastic leukaemia‏ ‎‡9  1‏
919 ‎‡a  genomewidednamethylationpatterninvisceraladiposetissuedifferentiatesinsulinresistantfrominsulinsensitiveobesesubjects‏ ‎‡A  Genome-wide DNA methylation pattern in visceral adipose tissue differentiates insulin-resistant from insulin-sensitive obese subjects.‏ ‎‡9  1‏
919 ‎‡a  genomewidednamethylationanalysisidentifiesnovelhypomethylatednonpericentromericgeneswithpotentialclinicalimplicationsinicfsyndrome‏ ‎‡A  Genome-Wide DNA Methylation Analysis Identifies Novel Hypomethylated Non-Pericentromeric Genes with Potential Clinical Implications in ICF Syndrome‏ ‎‡9  1‏
919 ‎‡a  generationandcharacterizationofratandmousemonoclonalantibodiesspecificformecp2andtheirusein10inactivationstudies‏ ‎‡A  Generation and characterization of rat and mouse monoclonal antibodies specific for MeCP2 and their use in X-inactivation studies‏ ‎‡9  1‏
919 ‎‡a  epigenomicsignatureofadrenoleukodystrophypredictscompromisedoligodendrocytedifferentiation‏ ‎‡A  Epigenomic signature of adrenoleukodystrophy predicts compromised oligodendrocyte differentiation.‏ ‎‡9  1‏
919 ‎‡a  epigeneticsandoxidativestressinaging‏ ‎‡A  Epigenetics and Oxidative Stress in Aging‏ ‎‡9  1‏
919 ‎‡a  epigeneticregulationofvitamin500metabolisminhumanlungadenocarcinoma‏ ‎‡A  Epigenetic regulation of vitamin D metabolism in human lung adenocarcinoma‏ ‎‡9  1‏
919 ‎‡a  epigeneticregulationofearlyandlateresponsegenesinacutepancreatitis‏ ‎‡A  Epigenetic Regulation of Early- and Late-Response Genes in Acute Pancreatitis‏ ‎‡9  1‏
919 ‎‡a  epigeneticmodifiersarenecessarybutnotsufficientforreprogrammingnonmyelinatingcellsintomyelingeneexpressingcells‏ ‎‡A  Epigenetic modifiers are necessary but not sufficient for reprogramming non-myelinating cells into myelin gene-expressing cells‏ ‎‡9  1‏
919 ‎‡a  epigeneticinactivationofthep53inducedlongnoncodingrnatp53target1inhumancancer‏ ‎‡A  Epigenetic inactivation of the p53-induced long noncoding RNA TP53 target 1 in human cancer‏ ‎‡9  1‏
919 ‎‡a  epigeneticdisruptionofthepiwipathwayinhumanspermatogenicdisorders‏ ‎‡A  Epigenetic disruption of the PIWI pathway in human spermatogenic disorders‏ ‎‡9  1‏
919 ‎‡a  epigeneticcrosstalkamolecularlanguageinhumanmetabolicdisorders‏ ‎‡A  Epigenetic crosstalk: a molecular language in human metabolic disorders‏ ‎‡9  1‏
919 ‎‡a  epigeneticcontrolofinfluenzavirusroleofh3k79methylationininterferoninducedantiviralresponse‏ ‎‡A  Epigenetic control of influenza virus: role of H3K79 methylation in interferon-induced antiviral response.‏ ‎‡9  1‏
919 ‎‡a  epigeneticalterationsleadingtotmprss4promoterhypomethylationandproteinoverexpressionpredictpoorprognosisinsquamouslungcancerpatients‏ ‎‡A  Epigenetic alterations leading to TMPRSS4 promoter hypomethylation and protein overexpression predict poor prognosis in squamous lung cancer patients‏ ‎‡9  1‏
919 ‎‡a  earlyradiologicalresponseaspredictorofoverallsurvivalinnonsmallcelllungcancernsclcpatientswithepidermalgrowthfactorreceptormutations‏ ‎‡A  Early radiological response as predictor of overall survival in non-small cell lung cancer (NSCLC) patients with epidermal growth factor receptor mutations.‏ ‎‡9  1‏
919 ‎‡a  earlyradiologicalresponseaspredictorofoverallsurvivalinnonsmallcelllungcancer‏ ‎‡A  Early radiological response as predictor of overall survival in non-small cell lung cancer‏ ‎‡9  1‏
919 ‎‡a  dnamethylationprofilinginbreastcancerdiscordantidenticaltwinsidentifiesdok7asnovelepigeneticbiomarker‏ ‎‡A  DNA methylation profiling in breast cancer discordant identical twins identifies DOK7 as novel epigenetic biomarker‏ ‎‡9  1‏
919 ‎‡a  dnamethylationmapincirculatingleukocytesmirrorssubcutaneousadiposetissuemethylationpatternagenomewideanalysisfromnonobeseandobesepatients‏ ‎‡A  DNA methylation map in circulating leukocytes mirrors subcutaneous adipose tissue methylation pattern: a genome-wide analysis from non-obese and obese patients.‏ ‎‡9  1‏
919 ‎‡a  dnamethylationcontributestonaturalhumanvariation‏ ‎‡A  DNA methylation contributes to natural human variation‏ ‎‡9  1‏
919 ‎‡a  disruptionofnipblscc2incorneliadelangesyndromeprovokescohesingenomewideredistributionwithanimpactinthetranscriptome‏ ‎‡A  Disruption of NIPBL/Scc2 in Cornelia de Lange Syndrome provokes cohesin genome-wide redistribution with an impact in the transcriptome‏ ‎‡9  1‏
919 ‎‡a  crosstalkbetweenoxidativestressandproinflammatorycytokinesinacutepancreatitisakeyroleforproteinphosphatases‏ ‎‡A  Cross-talk between oxidative stress and pro-inflammatory cytokines in acute pancreatitis: a key role for protein phosphatases.‏ ‎‡9  1‏
919 ‎‡a  corrigendumaderl3associateddefectinthedegradationofslc2a1mediatesthewarburgeffect‏ ‎‡A  Corrigendum: A DERL3-associated defect in the degradation of SLC2A1 mediates the Warburg effect‏ ‎‡9  1‏
919 ‎‡a  cd13741bbcostimulationmodifiesdnamethylationincd8+tcellrelevantgenes‏ ‎‡A  CD137 (4-1BB) Costimulation Modifies DNA Methylation in CD8+ T Cell-Relevant Genes.‏ ‎‡9  1‏
919 ‎‡a  cancerepigenomicsbeyondgenomics‏ ‎‡A  Cancer epigenomics: beyond genomics‏ ‎‡9  1‏
919 ‎‡a  asb1differentialmethylationinischaemiccardiomyopathyrelationshipwithleftventricularperformanceinendstageheartfailurepatients‏ ‎‡A  ASB1 differential methylation in ischaemic cardiomyopathy: relationship with left ventricular performance in end-stage heart failure patients.‏ ‎‡9  1‏
919 ‎‡a  epigeneticsignatureinadiposetissueislinkedtonicotinamidenmethyltransferasegeneexpression‏ ‎‡A  An Epigenetic Signature in Adipose Tissue Is Linked to Nicotinamide N-Methyltransferase Gene Expression‏ ‎‡9  1‏
919 ‎‡a  agedependentepigeneticcontrolofdifferentiationinhibitorsiscriticalforremyelinationefficiency‏ ‎‡A  Age-dependent epigenetic control of differentiation inhibitors is critical for remyelination efficiency‏ ‎‡9  1‏
919 ‎‡a  prognosticdnamethylationsignatureforstage1nonsmallcelllungcancer‏ ‎‡A  A Prognostic DNA Methylation Signature for Stage I Non–Small-Cell Lung Cancer‏ ‎‡9  1‏
919 ‎‡a  novelepigeneticsignatureforearlydiagnosisinlungcancer‏ ‎‡A  A Novel Epigenetic Signature for Early Diagnosis in Lung Cancer.‏ ‎‡9  1‏
919 ‎‡a  dnamethylationbaseddefinitionofbiologicallydistinctbreastcancersubtypes‏ ‎‡A  A DNA methylation-based definition of biologically distinct breast cancer subtypes‏ ‎‡9  1‏
919 ‎‡a  derl3associateddefectinthedegradationofslc2a1mediatesthewarburgeffect‏ ‎‡A  A DERL3-associated defect in the degradation of SLC2A1 mediates the Warburg effect‏ ‎‡9  1‏
919 ‎‡a  wholegenomegreyandwhitematterdnamethylationprofilesindorsolateralprefrontalcortex‏ ‎‡A  Whole genome grey and white matter DNA methylation profiles in dorsolateral prefrontal cortex.‏ ‎‡9  1‏
919 ‎‡a  wholegenomebisulfitednasequencingofadnmt3bmutantpatient‏ ‎‡A  Whole-genome bisulfite DNA sequencing of a DNMT3B mutant patient‏ ‎‡9  1‏
919 ‎‡a  vitaminedeficiencyinduceslivernuclearfactorkappabdnabindingactivityandchangesinrelatedgenes‏ ‎‡A  Vitamin E deficiency induces liver nuclear factor-kappaB DNA-binding activity and changes in related genes‏ ‎‡9  1‏
919 ‎‡a  validationofadnamethylationmicroarrayfor450000cpgsitesinthehumangenome‏ ‎‡A  Validation of a DNA methylation microarray for 450,000 CpG sites in the human genome‏ ‎‡9  1‏
919 ‎‡a  translatingcancerepigenomicsintotheclinicfocusonlungcancer‏ ‎‡A  Translating cancer epigenomics into the clinic: focus on lung cancer‏ ‎‡9  1‏
919 ‎‡a  thyroidhormonebiosynthesismachineryisalteredintheischemicmyocardiumanepigenomicstudy‏ ‎‡A  Thyroid hormone biosynthesis machinery is altered in the ischemic myocardium: An epigenomic study.‏ ‎‡9  1‏
919 ‎‡a  transcriptionfactoryinyang1isessentialforoligodendrocyteprogenitordifferentiation‏ ‎‡A  The transcription factor Yin Yang 1 is essential for oligodendrocyte progenitor differentiation.‏ ‎‡9  1‏
919 ‎‡a  peg13dmrandbrainspecificenhancersdictateimprintedexpressionwithinthe8q24intellectualdisabilityrisklocus‏ ‎‡A  The PEG13-DMR and brain-specific enhancers dictate imprinted expression within the 8q24 intellectual disability risk locus‏ ‎‡9  1‏
919 ‎‡a  roleofredoxsignalingproteinphosphatasesandhistoneacetylationintheinflammatorycascadeinacutepancreatitistherapeuticimplications‏ ‎‡A  Role of redox signaling, protein phosphatases and histone acetylation in the inflammatory cascade in acute pancreatitis. Therapeutic implications.‏ ‎‡9  1‏
919 ‎‡a  rnapolchipanovelapplicationofchromatinimmunoprecipitationtotheanalysisofrealtimegenetranscription‏ ‎‡A  RNAPol-ChIP: a novel application of chromatin immunoprecipitation to the analysis of real-time gene transcription.‏ ‎‡9  1‏
919 ‎‡a  putativecisregulatorydriversincolorectalcancer‏ ‎‡A  Putative cis-regulatory drivers in colorectal cancer.‏ ‎‡9  1‏
919 ‎‡a  primarycutaneousmarginalzonebcelllymphomaresponsetotreatmentanddiseasefreesurvivalinaseriesof137patients‏ ‎‡A  Primary cutaneous marginal zone B-cell lymphoma: response to treatment and disease-free survival in a series of 137 patients.‏ ‎‡9  1‏
919 ‎‡a  pentoxifyllinepreventslossofpp2aphosphataseactivityandrecruitmentofhistoneacetyltransferasestoproinflammatorygenesinacutepancreatitis‏ ‎‡A  Pentoxifylline prevents loss of PP2A phosphatase activity and recruitment of histone acetyltransferases to proinflammatory genes in acute pancreatitis.‏ ‎‡9  1‏
919 ‎‡a  oxidativeandnitrosativestressinacutepancreatitismodulationbypentoxifyllineandoxypurinol‏ ‎‡A  Oxidative and nitrosative stress in acute pancreatitis. Modulation by pentoxifylline and oxypurinol‏ ‎‡9  1‏
919 ‎‡a  orderedtranscriptionalfactorrecruitmentandepigeneticregulationoftnfalphainnecrotizingacutepancreatitis‏ ‎‡A  Ordered transcriptional factor recruitment and epigenetic regulation of tnf-alpha in necrotizing acute pancreatitis‏ ‎‡9  1‏
919 ‎‡a  obesityandmenopausemodifytheepigenomicprofileofbreastcancer‏ ‎‡A  Obesity and menopause modify the epigenomic profile of breast cancer‏ ‎‡9  1‏
919 ‎‡a  novelinsightsintodnamethylationfeaturesinspermatozoastabilityandpeculiarities‏ ‎‡A  Novel insights into DNA methylation features in spermatozoa: stability and peculiarities‏ ‎‡9  1‏
919 ‎‡a  notch1pathwayactivationresultsfromtheepigeneticabrogationofnotchrelatedmicrornasinmycosisfungoides‏ ‎‡A  Notch1 Pathway Activation Results from the Epigenetic Abrogation of Notch-Related MicroRNAs in Mycosis Fungoides.‏ ‎‡9  1‏
919 ‎‡a  noncpgislandpromoterhypomethylationandmir149regulatetheexpressionofsrpx2incolorectalcancer‏ ‎‡A  Non-CpG island promoter hypomethylation and miR-149 regulate the expression of SRPX2 in colorectal cancer‏ ‎‡9  1‏
919 ‎‡a  nitricoxidetriggersmammaryglandinvolutionafterweaningremodellingisdelayedbutnotimpairedinmicelackinginduciblenitricoxidesynthase‏ ‎‡A  Nitric oxide triggers mammary gland involution after weaning: remodelling is delayed but not impaired in mice lacking inducible nitric oxide synthase‏ ‎‡9  1‏
919 ‎‡a  nfĸbasnodeforsignalamplificationduringweaning‏ ‎‡A  NF-ĸB as node for signal amplification during weaning‏ ‎‡9  1‏
919 ‎‡a  molecularsubtypespecificbiomarkersimprovepredictionofprognosisincolorectalcancer‏ ‎‡A  Molecular-Subtype-Specific Biomarkers Improve Prediction of Prognosis in Colorectal Cancer‏ ‎‡9  1‏
946 ‎‡a  b‏ ‎‡9  1‏
996 ‎‡2  BNE|XX1512145‏
996 ‎‡2  BNE|XX1751467‏
996 ‎‡2  LC|ns2022002332‏
996 ‎‡2  BNE|XX861756‏
996 ‎‡2  BNCHL|10000000000000000125607‏
996 ‎‡2  LC|n 2024029854‏
996 ‎‡2  SUDOC|112008488‏
996 ‎‡2  LC|n 79070474‏
996 ‎‡2  SUDOC|235908258‏
996 ‎‡2  DNB|1056172983‏
996 ‎‡2  ISNI|0000000497881325‏
996 ‎‡2  NTA|102181845‏
996 ‎‡2  BLBNB|000200836‏
996 ‎‡2  ISNI|0000000059275691‏
996 ‎‡2  SUDOC|225817012‏
996 ‎‡2  PTBNP|269014‏
996 ‎‡2  DNB|1098140273‏
996 ‎‡2  LC|no2009096141‏
996 ‎‡2  LC|no2015160444‏
996 ‎‡2  LC|n 2002038996‏
996 ‎‡2  LC|no 00067860‏
996 ‎‡2  ISNI|0000000497774925‏
996 ‎‡2  BNE|XX5610930‏
996 ‎‡2  DNB|1053047169‏
996 ‎‡2  DNB|1196385602‏
996 ‎‡2  ISNI|0000000027080953‏
996 ‎‡2  SUDOC|260339202‏
996 ‎‡2  RERO|A013769533‏
996 ‎‡2  BNE|XX1122895‏
996 ‎‡2  LC|no2014027594‏
996 ‎‡2  LC|nb2014002404‏
996 ‎‡2  SUDOC|279151381‏
996 ‎‡2  ISNI|0000000497911555‏
996 ‎‡2  ISNI|000000007657495X‏
996 ‎‡2  ISNI|0000000060199374‏
996 ‎‡2  BNF|14405872‏
996 ‎‡2  NYNYRILM|284742‏
996 ‎‡2  BNF|12259333‏
996 ‎‡2  DNB|1057498920‏
996 ‎‡2  ISNI|0000000060181967‏
996 ‎‡2  DNB|1068496460‏
996 ‎‡2  RERO|A003067531‏
996 ‎‡2  BNE|XX911174‏
996 ‎‡2  SUDOC|233623299‏
996 ‎‡2  SUDOC|132113597‏
996 ‎‡2  BNCHL|10000000000000000088055‏
996 ‎‡2  BNF|15059659‏
996 ‎‡2  LC|no2018044424‏
996 ‎‡2  BNE|XX1621655‏
996 ‎‡2  BNCHL|10000000000000000827342‏
996 ‎‡2  DNB|1056523603‏
996 ‎‡2  LC|ns2015002071‏
996 ‎‡2  LC|no2021055178‏
996 ‎‡2  BNE|XX5264729‏
996 ‎‡2  DNB|1140866982‏
996 ‎‡2  LC|no2022007373‏
996 ‎‡2  LC|no2010006939‏
996 ‎‡2  ISNI|0000000060002797‏
996 ‎‡2  LC|no2010140537‏
996 ‎‡2  BNCHL|10000000000000000262430‏
996 ‎‡2  BNCHL|10000000000000000806792‏
996 ‎‡2  LC|no2018076503‏
996 ‎‡2  ISNI|0000000115789452‏
996 ‎‡2  BNE|XX825823‏
996 ‎‡2  BNCHL|10000000000000000008347‏
996 ‎‡2  ISNI|000000003856104X‏
996 ‎‡2  LC|no2017006276‏
996 ‎‡2  DNB|1056349298‏
996 ‎‡2  BNCHL|10000000000000000231552‏
996 ‎‡2  NUKAT|n 2006150586‏
996 ‎‡2  ISNI|0000000055441525‏
996 ‎‡2  SUDOC|079274056‏
996 ‎‡2  DNB|137031254‏
996 ‎‡2  LC|no2010147528‏
996 ‎‡2  BNE|XX1223454‏
996 ‎‡2  LC|no2010092011‏
996 ‎‡2  SUDOC|180921002‏
996 ‎‡2  RERO|A018991780‏
996 ‎‡2  BNE|XX820808‏
996 ‎‡2  NTA|185209777‏
996 ‎‡2  LC|n 87146804‏
996 ‎‡2  SUDOC|250819783‏
996 ‎‡2  BNE|XX1724970‏
996 ‎‡2  ISNI|0000000046732363‏
996 ‎‡2  SUDOC|224839632‏
996 ‎‡2  ISNI|0000000042932421‏
996 ‎‡2  BNE|XX1067426‏
996 ‎‡2  ISNI|000000043336314X‏
996 ‎‡2  BNC|981058607857206706‏
996 ‎‡2  BNE|XX4611681‏
996 ‎‡2  LC|no2016151800‏
996 ‎‡2  ISNI|0000000116095874‏
996 ‎‡2  BNCHL|10000000000000000123342‏
996 ‎‡2  LC|no 97030077‏
996 ‎‡2  LC|ns2021001906‏
996 ‎‡2  ISNI|0000000450584462‏
996 ‎‡2  NII|DA09467701‏
996 ‎‡2  DNB|1014321514‏
996 ‎‡2  J9U|987007311734105171‏
996 ‎‡2  BNCHL|10000000000000000854369‏
996 ‎‡2  JPG|500037497‏
996 ‎‡2  LC|ns2023001651‏
996 ‎‡2  DNB|131681974‏
996 ‎‡2  BNE|XX1703222‏
996 ‎‡2  LC|n 86808706‏
996 ‎‡2  ISNI|0000000062741120‏
996 ‎‡2  BNE|XX1518973‏
996 ‎‡2  ISNI|0000000110283305‏
996 ‎‡2  LC|no2010002767‏
996 ‎‡2  NTA|128917350‏
996 ‎‡2  LC|n 88013530‏
996 ‎‡2  ISNI|0000000053072578‏
996 ‎‡2  RERO|A011913466‏
996 ‎‡2  ISNI|0000000454219243‏
996 ‎‡2  ISNI|0000000038962783‏
996 ‎‡2  SUDOC|031363733‏
996 ‎‡2  JPG|500037847‏
996 ‎‡2  SUDOC|080655815‏
996 ‎‡2  SUDOC|174128088‏
996 ‎‡2  BNCHL|10000000000000000084876‏
996 ‎‡2  ISNI|0000000080646506‏
996 ‎‡2  BNF|12219094‏
996 ‎‡2  LC|no2011184662‏
996 ‎‡2  LC|no 94020319‏
996 ‎‡2  BNE|XX1431686‏
996 ‎‡2  LC|no2017005324‏
996 ‎‡2  LC|nr 99020697‏
996 ‎‡2  ISNI|0000000027678082‏
996 ‎‡2  LC|no2018040263‏
996 ‎‡2  BNE|XX1188154‏
996 ‎‡2  BNE|XX5122917‏
996 ‎‡2  ISNI|0000000076501777‏
996 ‎‡2  BNE|XX981659‏
996 ‎‡2  DNB|105745334X‏
996 ‎‡2  LC|ns2016004262‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏