VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q57611762  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241221010728.0
008     241221nneanz||abbn n and d
035 ‎‡a  (WKP)Q57611762‏
024 ‎‡a  0000-0002-7641-6585‏ ‎‡2  orcid‏
024 ‎‡a  26431831700‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q57611762‏
100 0 ‎‡a  André Luís Branco De Barros‏ ‎‡c  researcher ORCID ID = 0000-0002-7641-6585‏ ‎‡9  en‏
400 0 ‎‡a  André Luís Branco De Barros‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's (1→3)-β-D-glucan aptamers labeled with technetium-99m: Biodistribution and imaging in experimental models of bacterial and fungal infection.‏
670 ‎‡a  Author's 99mTc-phytate as a diagnostic probe for assessing inflammatory reaction in malignant tumors‏
670 ‎‡a  Author's A novel D-glucose derivative radiolabeled with technetium-99m: synthesis, biodistribution studies and scintigraphic images in an experimental model of Ehrlich tumor.‏
670 ‎‡a  Author's Antiangiogenic activity of PLGA-Lupeol implants for potential intravitreal applications.‏
670 ‎‡a  Author's Antiangiogenic evaluation of ZnWO4 nanoparticles synthesised through microwave-assisted hydrothermal method.‏
670 ‎‡a  Author's Antitumor effectiveness of a combined therapy with a new cucurbitacin B derivative and paclitaxel on a human lung cancer xenograft model‏
670 ‎‡a  Author's Antitumoral activity and toxicity of PEG-coated and PEG-folate-coated pH-sensitive liposomes containing ¹⁵⁹Gd-DTPA-BMA in Ehrlich tumor bearing mice‏
670 ‎‡a  Author's Aptamers directly radiolabeled with technetium-99m as a potential agent capable of identifying carcinoembryonic antigen (CEA) in tumor cells T84.‏
670 ‎‡a  Author's Assessment of global cardiac uptake of radiolabeled iron oxide nanoparticles in apolipoprotein-E-deficient mice: implications for imaging cardiovascular inflammation‏
670 ‎‡a  Author's Bombesin derivative radiolabeled with technetium-99m as agent for tumor identification‏
670 ‎‡a  Author's Bombesin Encapsulated in Long-Circulating pH-Sensitive Liposomes as a Radiotracer for Breast Tumor Identification‏
670 ‎‡a  Author's Boron nitride nanotube-CREKA peptide as an effective target system to metastatic breast cancer‏
670 ‎‡a  Author's Co-delivery of doxorubicin, docosahexaenoic acid, and α-tocopherol succinate by nanostructured lipid carriers has a synergistic effect to enhance antitumor activity and reduce toxicity‏
670 ‎‡a  Author's Co-delivery of doxorubicin, docosahexaenoic acid, and α-tocopherol succinate by nanostructured lipid carriers has a synergistic effect to enhance antitumor activity and reduce toxicity‏
670 ‎‡a  Author's CPP-Ts: a new intracellular calcium channel modulator and a promising tool for drug delivery in cancer cells‏
670 ‎‡a  Author's Detection of bacterial infection by a technetium-99m-labeled peptidoglycan aptamer.‏
670 ‎‡a  Author's Development of imaging probes for bone cancer in animal models. A systematic review.‏
670 ‎‡a  Author's Doxorubicin-loaded nanocarriers: A comparative study of liposome and nanostructured lipid carrier as alternatives for cancer therapy‏
670 ‎‡a  Author's Evolving role of radiolabeled particles in detecting infection and inflammation, preliminary data with 99mTc-phytate in rats‏
670 ‎‡a  Author's Feasibility study with 99mTc-HYNIC-βAla-Bombesin(7-14) as an agent to early visualization of lung tumour cells in nude mice.‏
670 ‎‡a  Author's Folate-coated, long-circulating and pH-sensitive liposomes enhance doxorubicin antitumor effect in a breast cancer animal model‏
670 ‎‡a  Author's Functionalized single-walled carbon nanotubes: cellular uptake, biodistribution and applications in drug delivery.‏
670 ‎‡a  Author's Gold-loaded polymeric micelles for computed tomography-guided radiation therapy treatment and radiosensitization‏
670 ‎‡a  Author's Growth arrested live-attenuated Leishmania infantum KHARON1 null mutants display cytokinesis defect and protective immunity in mice‏
670 ‎‡a  Author's HER-2 and EGFR mRNA Expression and Its Relationship with Versican in Malignant Matrix-Producing Tumors of the Canine Mammary Gland.‏
670 ‎‡a  Author's Influence of PEG coating on the biodistribution and tumor accumulation of pH-sensitive liposomes‏
670 ‎‡a  Author's Inhibition of Tityus serrulatus venom hyaluronidase affects venom biodistribution‏
670 ‎‡a  Author's Interdomain twists of human thymidine phosphorylase and its active-inactive conformations: Binding of 5-FU and its analogues to human thymidine phosphorylase versus dihydropyrimidine dehydrogenase‏
670 ‎‡a  Author's Investigation of the antitumor activity and toxicity of long-circulating and fusogenic liposomes co-encapsulating paclitaxel and doxorubicin in a murine breast cancer animal model‏
670 ‎‡a  Author's Kit formulation for 99mTc-labeling of HYNIC-βAla-Bombesin((7-14))‏
670 ‎‡a  Author's Liposomes radiolabeled with (159)Gd: in vitro antitumoral activity, biodistribution study and scintigraphic image in Ehrlich tumor bearing mice‏
670 ‎‡a  Author's Long-Circulating and pH-Sensitive Liposome Preparation Trapping a Radiotracer for Inflammation Site Detection.‏
670 ‎‡a  Author's Long-circulating, pH-sensitive liposomes versus long-circulating, non-pH-sensitive liposomes as a delivery system for tumor identification.‏
670 ‎‡a  Author's Nanoparticle mucoadhesive system as a new tool for fish immune system modulation‏
670 ‎‡a  Author's Nanostructured Lipid Carrier Co-loaded with Doxorubicin and Docosahexaenoic Acid as a Theranostic Agent: Evaluation of Biodistribution and Antitumor Activity in Experimental Model‏
670 ‎‡a  Author's Paclitaxel-loaded folate-coated long circulating and pH-sensitive liposomes as a potential drug delivery system: A biodistribution study‏
670 ‎‡a  Author's Paclitaxel-Loaded Folate-Coated pH-Sensitive Liposomes Enhance Cellular Uptake and Antitumor Activity‏
670 ‎‡a  Author's PACLITAXEL-LOADED pH-SENSITIVE LIPOSOME: NEW INSIGHTS ON STRUCTURAL AND PHYSICOCHEMICAL CHARACTERIZATION.‏
670 ‎‡a  Author's pH-Sensitive, Long-Circulating Liposomes as an Alternative Tool to Deliver Doxorubicin into Tumors: a Feasibility Animal Study.‏
670 ‎‡a  Author's Physical and biological effects of paclitaxel encapsulation on disteraroylphosphatidylethanolamine-polyethyleneglycol polymeric micelles‏
670 ‎‡a  Author's Preliminary data of the antipancreatic tumor efficacy and toxicity of long-circulating and pH-sensitive liposomes containing cisplatin.‏
670 ‎‡a  Author's Responsive polymer conjugates for drug delivery applications: recent advances in bioconjugation methodologies‏
670 ‎‡a  Author's Scintigraphic imaging of Staphylococcus aureus infection using 99mTc radiolabeled aptamers.‏
670 ‎‡a  Author's Sclareol is a potent enhancer of doxorubicin: Evaluation of the free combination and co-loaded nanostructured lipid carriers against breast cancer‏
670 ‎‡a  Author's Synthesis and antimicrobial evaluation of two peptide LyeTx I derivatives modified with the chelating agent HYNIC for radiolabeling with technetium-99m‏
670 ‎‡a  Author's Synthesis and biodistribution studies of carbohydrate derivatives radiolabeled with technetium-99m.‏
670 ‎‡a  Author's Synthesis and biological evaluation of technetium-labeled D-glucose-MAG3 derivative as agent for tumor diagnosis.‏
670 ‎‡a  Author's Synthesis, characterization, and biodistribution studies of (99m)Tc-labeled SBA-16 mesoporous silica nanoparticles‏
670 ‎‡a  Author's Synthesis, characterization and radiolabeling of polymeric nano-micelles as a platform for tumor delivering‏
670 ‎‡a  Author's Synthesis of cholesterol-based neoglycoconjugates and their use in the preparation of liposomes for active liver targeting‏
670 ‎‡a  Author's Technetium-99m-labeled doxorubicin as an imaging probe for murine breast tumor (4T1 cell line) identification‏
670 ‎‡a  Author's Technetium-99m radiolabeled paclitaxel as an imaging probe for breast cancer in vivo‏
670 ‎‡a  Author's The role of radionuclide probes for monitoring anti-tumor drugs efficacy: A brief review.‏
670 ‎‡a  Author's Thermosensitive Nanosystems Associated with Hyperthermia for Cancer Treatment‏
670 ‎‡a  Author's Toxicological study of a new doxorubicin-loaded pH-sensitive liposome: A preclinical approach‏
670 ‎‡a  Author's Tumor bombesin analog loaded long-circulating and pH-sensitive liposomes as tool for tumor identification.‏
909 ‎‡a  (scopus) 26431831700‏ ‎‡9  1‏
909 ‎‡a  (orcid) 0000000276416585‏ ‎‡9  1‏
919 ‎‡a  synthesisandantimicrobialevaluationof2peptidelyetx1derivativesmodifiedwiththechelatingagenthynicforradiolabelingwithtechnetium99m‏ ‎‡A  Synthesis and antimicrobial evaluation of two peptide LyeTx I derivatives modified with the chelating agent HYNIC for radiolabeling with technetium-99m‏ ‎‡9  1‏
919 ‎‡a  sclareolisapotentenhancerofdoxorubicinevaluationofthefreecombinationandcoloadednanostructuredlipidcarriersagainstbreastcancer‏ ‎‡A  Sclareol is a potent enhancer of doxorubicin: Evaluation of the free combination and co-loaded nanostructured lipid carriers against breast cancer‏ ‎‡9  1‏
919 ‎‡a  scintigraphicimagingofstaphylococcusaureusinfectionusing99mtcradiolabeledaptamers‏ ‎‡A  Scintigraphic imaging of Staphylococcus aureus infection using 99mTc radiolabeled aptamers.‏ ‎‡9  1‏
919 ‎‡a  responsivepolymerconjugatesfordrugdeliveryapplicationsrecentadvancesinbioconjugationmethodologies‏ ‎‡A  Responsive polymer conjugates for drug delivery applications: recent advances in bioconjugation methodologies‏ ‎‡9  1‏
919 ‎‡a  preliminarydataoftheantipancreatictumorefficacyandtoxicityoflongcirculatingandphsensitiveliposomescontainingcisplatin‏ ‎‡A  Preliminary data of the antipancreatic tumor efficacy and toxicity of long-circulating and pH-sensitive liposomes containing cisplatin.‏ ‎‡9  1‏
919 ‎‡a  physicalandbiologicaleffectsofpaclitaxelencapsulationondisteraroylphosphatidylethanolaminepolyethyleneglycolpolymericmicelles‏ ‎‡A  Physical and biological effects of paclitaxel encapsulation on disteraroylphosphatidylethanolamine-polyethyleneglycol polymeric micelles‏ ‎‡9  1‏
919 ‎‡a  phsensitivelongcirculatingliposomesasanalternativetooltodeliverdoxorubicinintotumorsafeasibilityanimalstudy‏ ‎‡A  pH-Sensitive, Long-Circulating Liposomes as an Alternative Tool to Deliver Doxorubicin into Tumors: a Feasibility Animal Study.‏ ‎‡9  1‏
919 ‎‡a  paclitaxelloadedphsensitiveliposomenewinsightsonstructuralandphysicochemicalcharacterization‏ ‎‡A  PACLITAXEL-LOADED pH-SENSITIVE LIPOSOME: NEW INSIGHTS ON STRUCTURAL AND PHYSICOCHEMICAL CHARACTERIZATION.‏ ‎‡9  1‏
919 ‎‡a  paclitaxelloadedfolatecoatedphsensitiveliposomesenhancecellularuptakeandantitumoractivity‏ ‎‡A  Paclitaxel-Loaded Folate-Coated pH-Sensitive Liposomes Enhance Cellular Uptake and Antitumor Activity‏ ‎‡9  1‏
919 ‎‡a  paclitaxelloadedfolatecoatedlongcirculatingandphsensitiveliposomesasapotentialdrugdeliverysystemabiodistributionstudy‏ ‎‡A  Paclitaxel-loaded folate-coated long circulating and pH-sensitive liposomes as a potential drug delivery system: A biodistribution study‏ ‎‡9  1‏
919 ‎‡a  nanostructuredlipidcarriercoloadedwithdoxorubicinanddocosahexaenoicacidasatheranosticagentevaluationofbiodistributionandantitumoractivityinexperimentalmodel‏ ‎‡A  Nanostructured Lipid Carrier Co-loaded with Doxorubicin and Docosahexaenoic Acid as a Theranostic Agent: Evaluation of Biodistribution and Antitumor Activity in Experimental Model‏ ‎‡9  1‏
919 ‎‡a  nanoparticlemucoadhesivesystemasanewtoolforfishimmunesystemmodulation‏ ‎‡A  Nanoparticle mucoadhesive system as a new tool for fish immune system modulation‏ ‎‡9  1‏
919 ‎‡a  longcirculatingphsensitiveliposomesversuslongcirculatingnonphsensitiveliposomesasadeliverysystemfortumoridentification‏ ‎‡A  Long-circulating, pH-sensitive liposomes versus long-circulating, non-pH-sensitive liposomes as a delivery system for tumor identification.‏ ‎‡9  1‏
919 ‎‡a  longcirculatingandphsensitiveliposomepreparationtrappingaradiotracerforinflammationsitedetection‏ ‎‡A  Long-Circulating and pH-Sensitive Liposome Preparation Trapping a Radiotracer for Inflammation Site Detection.‏ ‎‡9  1‏
919 ‎‡a  liposomesradiolabeledwith159gdinvitroantitumoralactivitybiodistributionstudyandscintigraphicimageinehrlichtumorbearingmice‏ ‎‡A  Liposomes radiolabeled with (159)Gd: in vitro antitumoral activity, biodistribution study and scintigraphic image in Ehrlich tumor bearing mice‏ ‎‡9  1‏
919 ‎‡a  kitformulationfor99mtclabelingofhynicβalabombesin714‏ ‎‡A  Kit formulation for 99mTc-labeling of HYNIC-βAla-Bombesin((7-14))‏ ‎‡9  1‏
919 ‎‡a  investigationoftheantitumoractivityandtoxicityoflongcirculatingandfusogenicliposomescoencapsulatingpaclitaxelanddoxorubicininamurinebreastcanceranimalmodel‏ ‎‡A  Investigation of the antitumor activity and toxicity of long-circulating and fusogenic liposomes co-encapsulating paclitaxel and doxorubicin in a murine breast cancer animal model‏ ‎‡9  1‏
919 ‎‡a  interdomaintwistsofhumanthymidinephosphorylaseanditsactiveinactiveconformationsbindingof5fuanditsanaloguestohumanthymidinephosphorylaseversusdihydropyrimidinedehydrogenase‏ ‎‡A  Interdomain twists of human thymidine phosphorylase and its active-inactive conformations: Binding of 5-FU and its analogues to human thymidine phosphorylase versus dihydropyrimidine dehydrogenase‏ ‎‡9  1‏
919 ‎‡a  inhibitionoftityusserrulatusvenomhyaluronidaseaffectsvenombiodistribution‏ ‎‡A  Inhibition of Tityus serrulatus venom hyaluronidase affects venom biodistribution‏ ‎‡9  1‏
919 ‎‡a  influenceofpegcoatingonthebiodistributionandtumoraccumulationofphsensitiveliposomes‏ ‎‡A  Influence of PEG coating on the biodistribution and tumor accumulation of pH-sensitive liposomes‏ ‎‡9  1‏
919 ‎‡a  her2andegfrmrnaexpressionanditsrelationshipwithversicaninmalignantmatrixproducingtumorsofthecaninemammarygland‏ ‎‡A  HER-2 and EGFR mRNA Expression and Its Relationship with Versican in Malignant Matrix-Producing Tumors of the Canine Mammary Gland.‏ ‎‡9  1‏
919 ‎‡a  growtharrestedliveattenuatedleishmaniainfantumkharon1nullmutantsdisplaycytokinesisdefectandprotectiveimmunityinmice‏ ‎‡A  Growth arrested live-attenuated Leishmania infantum KHARON1 null mutants display cytokinesis defect and protective immunity in mice‏ ‎‡9  1‏
919 ‎‡a  goldloadedpolymericmicellesforcomputedtomographyguidedradiationtherapytreatmentandradiosensitization‏ ‎‡A  Gold-loaded polymeric micelles for computed tomography-guided radiation therapy treatment and radiosensitization‏ ‎‡9  1‏
919 ‎‡a  functionalizedsinglewalledcarbonnanotubescellularuptakebiodistributionandapplicationsindrugdelivery‏ ‎‡A  Functionalized single-walled carbon nanotubes: cellular uptake, biodistribution and applications in drug delivery.‏ ‎‡9  1‏
919 ‎‡a  folatecoatedlongcirculatingandphsensitiveliposomesenhancedoxorubicinantitumoreffectinabreastcanceranimalmodel‏ ‎‡A  Folate-coated, long-circulating and pH-sensitive liposomes enhance doxorubicin antitumor effect in a breast cancer animal model‏ ‎‡9  1‏
919 ‎‡a  feasibilitystudywith99mtchynicβalabombesin714asanagenttoearlyvisualizationoflungtumourcellsinnudemice‏ ‎‡A  Feasibility study with 99mTc-HYNIC-βAla-Bombesin(7-14) as an agent to early visualization of lung tumour cells in nude mice.‏ ‎‡9  1‏
919 ‎‡a  evolvingroleofradiolabeledparticlesindetectinginfectionandinflammationpreliminarydatawith99mtcphytateinrats‏ ‎‡A  Evolving role of radiolabeled particles in detecting infection and inflammation, preliminary data with 99mTc-phytate in rats‏ ‎‡9  1‏
919 ‎‡a  doxorubicinloadednanocarriersacomparativestudyofliposomeandnanostructuredlipidcarrierasalternativesforcancertherapy‏ ‎‡A  Doxorubicin-loaded nanocarriers: A comparative study of liposome and nanostructured lipid carrier as alternatives for cancer therapy‏ ‎‡9  1‏
919 ‎‡a  developmentofimagingprobesforbonecancerinanimalmodelsasystematicreview‏ ‎‡A  Development of imaging probes for bone cancer in animal models. A systematic review.‏ ‎‡9  1‏
919 ‎‡a  detectionofbacterialinfectionbyatechnetium99mlabeledpeptidoglycanaptamer‏ ‎‡A  Detection of bacterial infection by a technetium-99m-labeled peptidoglycan aptamer.‏ ‎‡9  1‏
919 ‎‡a  cpptsanewintracellularcalciumchannelmodulatorandapromisingtoolfordrugdeliveryincancercells‏ ‎‡A  CPP-Ts: a new intracellular calcium channel modulator and a promising tool for drug delivery in cancer cells‏ ‎‡9  1‏
919 ‎‡a  codeliveryofdoxorubicindocosahexaenoicacidandαtocopherolsuccinatebynanostructuredlipidcarriershasasynergisticeffecttoenhanceantitumoractivityandreducetoxicity‏ ‎‡A  Co-delivery of doxorubicin, docosahexaenoic acid, and α-tocopherol succinate by nanostructured lipid carriers has a synergistic effect to enhance antitumor activity and reduce toxicity‏ ‎‡9  1‏
919 ‎‡a  codeliveryofdoxorubicindocosahexaenoicacidand1tocopherolsuccinatebynanostructuredlipidcarriershasasynergisticeffecttoenhanceantitumoractivityandreducetoxicity‏ ‎‡A  Co-delivery of doxorubicin, docosahexaenoic acid, and α-tocopherol succinate by nanostructured lipid carriers has a synergistic effect to enhance antitumor activity and reduce toxicity‏ ‎‡9  1‏
919 ‎‡a  boronnitridenanotubecrekapeptideasaneffectivetargetsystemtometastaticbreastcancer‏ ‎‡A  Boron nitride nanotube-CREKA peptide as an effective target system to metastatic breast cancer‏ ‎‡9  1‏
919 ‎‡a  bombesinencapsulatedinlongcirculatingphsensitiveliposomesasaradiotracerforbreasttumoridentification‏ ‎‡A  Bombesin Encapsulated in Long-Circulating pH-Sensitive Liposomes as a Radiotracer for Breast Tumor Identification‏ ‎‡9  1‏
919 ‎‡a  bombesinderivativeradiolabeledwithtechnetium99masagentfortumoridentification‏ ‎‡A  Bombesin derivative radiolabeled with technetium-99m as agent for tumor identification‏ ‎‡9  1‏
919 ‎‡a  assessmentofglobalcardiacuptakeofradiolabeledironoxidenanoparticlesinapolipoproteinedeficientmiceimplicationsforimagingcardiovascularinflammation‏ ‎‡A  Assessment of global cardiac uptake of radiolabeled iron oxide nanoparticles in apolipoprotein-E-deficient mice: implications for imaging cardiovascular inflammation‏ ‎‡9  1‏
919 ‎‡a  aptamersdirectlyradiolabeledwithtechnetium99masapotentialagentcapableofidentifyingcarcinoembryonicantigenceaintumorcellst84‏ ‎‡A  Aptamers directly radiolabeled with technetium-99m as a potential agent capable of identifying carcinoembryonic antigen (CEA) in tumor cells T84.‏ ‎‡9  1‏
919 ‎‡a  antitumoralactivityandtoxicityofpegcoatedandpegfolatecoatedphsensitiveliposomescontaining159gddtpabmainehrlichtumorbearingmice‏ ‎‡A  Antitumoral activity and toxicity of PEG-coated and PEG-folate-coated pH-sensitive liposomes containing ¹⁵⁹Gd-DTPA-BMA in Ehrlich tumor bearing mice‏ ‎‡9  1‏
919 ‎‡a  antitumoreffectivenessofacombinedtherapywithanewcucurbitacinbderivativeandpaclitaxelonahumanlungcancerxenograftmodel‏ ‎‡A  Antitumor effectiveness of a combined therapy with a new cucurbitacin B derivative and paclitaxel on a human lung cancer xenograft model‏ ‎‡9  1‏
919 ‎‡a  antiangiogenicevaluationofznwo4nanoparticlessynthesisedthroughmicrowaveassistedhydrothermalmethod‏ ‎‡A  Antiangiogenic evaluation of ZnWO4 nanoparticles synthesised through microwave-assisted hydrothermal method.‏ ‎‡9  1‏
919 ‎‡a  antiangiogenicactivityofplgalupeolimplantsforpotentialintravitrealapplications‏ ‎‡A  Antiangiogenic activity of PLGA-Lupeol implants for potential intravitreal applications.‏ ‎‡9  1‏
919 ‎‡a  novel500glucosederivativeradiolabeledwithtechnetium99msynthesisbiodistributionstudiesandscintigraphicimagesinanexperimentalmodelofehrlichtumor‏ ‎‡A  A novel D-glucose derivative radiolabeled with technetium-99m: synthesis, biodistribution studies and scintigraphic images in an experimental model of Ehrlich tumor.‏ ‎‡9  1‏
919 ‎‡a  99mtcphytateasadiagnosticprobeforassessinginflammatoryreactioninmalignanttumors‏ ‎‡A  99mTc-phytate as a diagnostic probe for assessing inflammatory reaction in malignant tumors‏ ‎‡9  1‏
919 ‎‡a  13β500glucanaptamerslabeledwithtechnetium99mbiodistributionandimaginginexperimentalmodelsofbacterialandfungalinfection‏ ‎‡A  (1→3)-β-D-glucan aptamers labeled with technetium-99m: Biodistribution and imaging in experimental models of bacterial and fungal infection.‏ ‎‡9  1‏
919 ‎‡a  tumorbombesinanalogloadedlongcirculatingandphsensitiveliposomesastoolfortumoridentification‏ ‎‡A  Tumor bombesin analog loaded long-circulating and pH-sensitive liposomes as tool for tumor identification.‏ ‎‡9  1‏
919 ‎‡a  toxicologicalstudyofanewdoxorubicinloadedphsensitiveliposomeapreclinicalapproach‏ ‎‡A  Toxicological study of a new doxorubicin-loaded pH-sensitive liposome: A preclinical approach‏ ‎‡9  1‏
919 ‎‡a  thermosensitivenanosystemsassociatedwithhyperthermiaforcancertreatment‏ ‎‡A  Thermosensitive Nanosystems Associated with Hyperthermia for Cancer Treatment‏ ‎‡9  1‏
919 ‎‡a  roleofradionuclideprobesformonitoringantitumordrugsefficacyabriefreview‏ ‎‡A  The role of radionuclide probes for monitoring anti-tumor drugs efficacy: A brief review.‏ ‎‡9  1‏
919 ‎‡a  technetium99mradiolabeledpaclitaxelasanimagingprobeforbreastcancerinvivo‏ ‎‡A  Technetium-99m radiolabeled paclitaxel as an imaging probe for breast cancer in vivo‏ ‎‡9  1‏
919 ‎‡a  technetium99mlabeleddoxorubicinasanimagingprobeformurinebreasttumor4t1celllineidentification‏ ‎‡A  Technetium-99m-labeled doxorubicin as an imaging probe for murine breast tumor (4T1 cell line) identification‏ ‎‡9  1‏
919 ‎‡a  synthesisofcholesterolbasedneoglycoconjugatesandtheiruseinthepreparationofliposomesforactivelivertargeting‏ ‎‡A  Synthesis of cholesterol-based neoglycoconjugates and their use in the preparation of liposomes for active liver targeting‏ ‎‡9  1‏
919 ‎‡a  synthesischaracterizationandradiolabelingofpolymericnanomicellesasaplatformfortumordelivering‏ ‎‡A  Synthesis, characterization and radiolabeling of polymeric nano-micelles as a platform for tumor delivering‏ ‎‡9  1‏
919 ‎‡a  synthesischaracterizationandbiodistributionstudiesof99mtclabeledsba16mesoporoussilicananoparticles‏ ‎‡A  Synthesis, characterization, and biodistribution studies of (99m)Tc-labeled SBA-16 mesoporous silica nanoparticles‏ ‎‡9  1‏
919 ‎‡a  synthesisandbiologicalevaluationoftechnetiumlabeled500glucosemag3derivativeasagentfortumordiagnosis‏ ‎‡A  Synthesis and biological evaluation of technetium-labeled D-glucose-MAG3 derivative as agent for tumor diagnosis.‏ ‎‡9  1‏
919 ‎‡a  synthesisandbiodistributionstudiesofcarbohydratederivativesradiolabeledwithtechnetium99m‏ ‎‡A  Synthesis and biodistribution studies of carbohydrate derivatives radiolabeled with technetium-99m.‏ ‎‡9  1‏
996 ‎‡2  BNF|12064392‏
996 ‎‡2  ISNI|000000006775393X‏
996 ‎‡2  LC|n 2004093221‏
996 ‎‡2  NUKAT|n 2017160444‏
996 ‎‡2  LC|n 98052109‏
996 ‎‡2  BLBNB|000986482‏
996 ‎‡2  BNCHL|10000000000000000126740‏
996 ‎‡2  LC|n 2018250736‏
996 ‎‡2  CAOONL|ncf13683804‏
996 ‎‡2  SUDOC|081316046‏
996 ‎‡2  PLWABN|9810603983205606‏
996 ‎‡2  LC|n 2022254063‏
996 ‎‡2  JPG|500550334‏
996 ‎‡2  DNB|1055232745‏
996 ‎‡2  BNE|XX6011256‏
996 ‎‡2  LC|no2022127827‏
996 ‎‡2  NII|DA19115755‏
996 ‎‡2  BLBNB|000986174‏
996 ‎‡2  ISNI|0000000486555110‏
996 ‎‡2  LC|no2014155472‏
996 ‎‡2  BLBNB|000235810‏
996 ‎‡2  BNCHL|10000000000000000262053‏
996 ‎‡2  PTBNP|252942‏
996 ‎‡2  LC|no2021093755‏
996 ‎‡2  DNB|1235898547‏
996 ‎‡2  DNB|171106334‏
996 ‎‡2  BLBNB|001462934‏
996 ‎‡2  BLBNB|001517056‏
996 ‎‡2  ISNI|0000000070031014‏
996 ‎‡2  BLBNB|000988508‏
996 ‎‡2  ISNI|0000000066669875‏
996 ‎‡2  SUDOC|077613120‏
996 ‎‡2  LC|no2021022818‏
996 ‎‡2  DNB|1165810107‏
996 ‎‡2  BNCHL|10000000000000000192729‏
996 ‎‡2  DNB|117231795X‏
996 ‎‡2  PTBNP|85531‏
996 ‎‡2  ISNI|0000000069123982‏
996 ‎‡2  BLBNB|000506441‏
996 ‎‡2  J9U|987008729540905171‏
996 ‎‡2  BLBNB|000991882‏
996 ‎‡2  BLBNB|000508007‏
996 ‎‡2  BNCHL|10000000000000000056378‏
996 ‎‡2  PTBNP|1804463‏
996 ‎‡2  DNB|1202021905‏
996 ‎‡2  ISNI|000000035809206X‏
996 ‎‡2  ISNI|0000000069221523‏
996 ‎‡2  J9U|987007258232605171‏
996 ‎‡2  BLBNB|000622879‏
996 ‎‡2  SUDOC|197430228‏
996 ‎‡2  BNC|981058524118406706‏
996 ‎‡2  LC|n 2018029962‏
996 ‎‡2  NTA|10004333X‏
996 ‎‡2  BLBNB|000321039‏
996 ‎‡2  NYNYRILM|387127‏
996 ‎‡2  SUDOC|276006631‏
996 ‎‡2  BNE|XX1171780‏
996 ‎‡2  LC|n 2018250680‏
996 ‎‡2  PTBNP|1900035‏
996 ‎‡2  BIBSYS|1535375970146‏
996 ‎‡2  BLBNB|000426790‏
996 ‎‡2  BLBNB|000461697‏
996 ‎‡2  BNE|XX5399175‏
996 ‎‡2  BLBNB|000989301‏
996 ‎‡2  SUDOC|224500406‏
996 ‎‡2  DNB|1287818420‏
996 ‎‡2  LC|no 98028958‏
996 ‎‡2  BNF|17923094‏
996 ‎‡2  PTBNP|50076‏
996 ‎‡2  ISNI|0000000083706164‏
996 ‎‡2  BNF|17967947‏
996 ‎‡2  PTBNP|77233‏
996 ‎‡2  SUDOC|243782691‏
996 ‎‡2  BLBNB|000943986‏
996 ‎‡2  SUDOC|23396469X‏
996 ‎‡2  ISNI|000000010776946X‏
996 ‎‡2  PTBNP|799152‏
996 ‎‡2  BLBNB|000827123‏
996 ‎‡2  ISNI|0000000443604824‏
996 ‎‡2  BLBNB|000989262‏
996 ‎‡2  DNB|117191427X‏
996 ‎‡2  NTA|326544542‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏