Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q74060319 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241020233041.0 | ||
| 008 | 241020nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q74060319 | ||
| 024 | ‡a 0000-0002-9655-4918 ‡2 orcid | ||
| 035 | ‡a (OCoLC)Q74060319 | ||
| 100 | 0 | ‡a María A García-Sánchez ‡c researcher ‡9 en | |
| 400 | 0 | ‡a María A García-Sánchez ‡c wetenschapper ‡9 nl | |
| 670 | ‡a Author's A DNA-Based Procedure for In Planta Detection of Fusarium oxysporum f. sp. phaseoli. | ||
| 670 | ‡a Author's A gene coding for ornithine decarboxylase (odcA) is differentially expressed during the Mucor circinelloides yeast-to-hypha transition. | ||
| 670 | ‡a Author's Analysis of FOXP3 gene in children with allergy and autoimmune diseases. | ||
| 670 | ‡a Author's Assessment and Validation of New Genetic Variants: A Systematic In Silico Approach | ||
| 670 | ‡a Author's Atopy Can Be an Interfering Factor in Genetic Association Studies of ß-Lactam Allergy | ||
| 670 | ‡a Author's Cell Culture Techniques: Corticosteroid Treatment in A549 Human Lung Epithelial Cell. | ||
| 670 | ‡a Author's Chromatin Immunoprecipitation: Application to the Study of Asthma. | ||
| 670 | ‡a Author's Cluster Analysis Identifies 3 Phenotypes within Allergic Asthma. | ||
| 670 | ‡a Author's EVI1-mediated down regulation of MIR449A is essential for the survival of EVI1 positive leukaemic cells | ||
| 670 | ‡a Author's fost12, the Fusarium oxysporum homolog of the transcription factor Ste12, is upregulated during plant infection and required for virulence | ||
| 670 | ‡a Author's Functional characterization of the promoter region of the human EVI1 gene in acute myeloid leukemia: RUNX1 and ELK1 directly regulate its transcription. | ||
| 670 | ‡a Author's Gene Silencing Delivery Methods: Lipid-Mediated and Electroporation Transfection Protocols | ||
| 670 | ‡a Author's Genome-wide association studies (GWAS) and their importance in asthma. | ||
| 670 | ‡a Author's Genome-wide expression profiling of B lymphocytes reveals IL4R increase in allergic asthma. | ||
| 670 | ‡a Author's Implications of cytokine genes in allergic asthma. | ||
| 670 | ‡a Author's Interleukin 5 Receptor Subunit Alpha Expression as a Potential Biomarker in Patients with Nasal Polyposis | ||
| 670 | ‡a Author's New Virulence Groups in Fusarium oxysporum f. sp. phaseoli: The Expression of the Gene Coding for the Transcription Factor ftf1 Correlates with Virulence | ||
| 670 | ‡a Author's Overexpression of GATA2 predicts an adverse prognosis for patients with acute myeloid leukemia and it is associated with distinct molecular abnormalities. | ||
| 670 | ‡a Author's Overexpression of SET is a recurrent event associated with poor outcome and contributes to protein phosphatase 2A inhibition in acute myeloid leukemia | ||
| 670 | ‡a Author's Pharmacogenetics and the treatment of asthma | ||
| 670 | ‡a Author's Promoter Assay Using Luciferase Reporter Gene in the A549 Cell Line | ||
| 670 | ‡a Author's Promoter genotyping and mRNA expression analysis of PTGDR gene in allergy | ||
| 670 | ‡a Author's Protocol for Lipid-Mediated Transient Transfection in A549 Epithelial Lung Cell Line. | ||
| 670 | ‡a Author's PTGDR expression is upregulated through retinoic acid receptors | ||
| 670 | ‡a Author's PTGDR expression is upregulated through retinoic acid receptors (RAR) mechanism in allergy | ||
| 670 | ‡a Author's PTGDR gene expression and response to dexamethasone treatment in an in vitro model. | ||
| 670 | ‡a Author's Real-Time PCR for Gene Expression Quantification in Asthma | ||
| 670 | ‡a Author's Retinoic Acid Modulates PTGDR Promoter Activity. | ||
| 670 | ‡a Author's Review of Methods to Study Gene Expression Regulation Applied to Asthma | ||
| 670 | ‡a Author's Review on Pharmacogenetics and Pharmacogenomics Applied to the Study of Asthma | ||
| 670 | ‡a Author's The gene coding for a new transcription factor | ||
| 670 | ‡a Author's The gene coding for a new transcription factor (ftf1) of Fusarium oxysporum is only expressed during infection of common bean | ||
| 670 | ‡a Author's The MDS and EVI1 complex locus (MECOM) isoforms regulate their own transcription and have different roles in the transformation of hematopoietic stem and progenitor cells | ||
| 670 | ‡a Author's The prostaglandin D2 receptor (PTGDR) gene in asthma and allergic diseases. | ||
| 670 | ‡a Author's The role of the GATA2 transcription factor in normal and malignant hematopoiesis | ||
| 670 | ‡a Author's Tryptase: genetic and functional considerations | ||
| 670 | ‡a Author's YRNAs overexpression and potential implications in allergy | ||
| 909 | ‡a (orcid) 0000000296554918 ‡9 1 | ||
| 919 | ‡a dnabasedprocedureforinplantadetectionoffusariumoxysporumfspphaseoli ‡A A DNA-Based Procedure for In Planta Detection of Fusarium oxysporum f. sp. phaseoli. ‡9 1 | ||
| 919 | ‡a genecodingforornithinedecarboxylaseodcaisdifferentiallyexpressedduringthemucorcircinelloidesyeasttohyphatransition ‡A A gene coding for ornithine decarboxylase (odcA) is differentially expressed during the Mucor circinelloides yeast-to-hypha transition. ‡9 1 | ||
| 919 | ‡a analysisoffoxp3geneinchildrenwithallergyandautoimmunediseases ‡A Analysis of FOXP3 gene in children with allergy and autoimmune diseases. ‡9 1 | ||
| 919 | ‡a assessmentandvalidationofnewgeneticvariantsasystematicinsilicoapproach ‡A Assessment and Validation of New Genetic Variants: A Systematic In Silico Approach ‡9 1 | ||
| 919 | ‡a atopycanbeaninterferingfactoringeneticassociationstudiesofsslactamallergy ‡A Atopy Can Be an Interfering Factor in Genetic Association Studies of ß-Lactam Allergy ‡9 1 | ||
| 919 | ‡a cellculturetechniquescorticosteroidtreatmentina549humanlungepithelialcell ‡A Cell Culture Techniques: Corticosteroid Treatment in A549 Human Lung Epithelial Cell. ‡9 1 | ||
| 919 | ‡a chromatinimmunoprecipitationapplicationtothestudyofasthma ‡A Chromatin Immunoprecipitation: Application to the Study of Asthma. ‡9 1 | ||
| 919 | ‡a clusteranalysisidentifies3phenotypeswithinallergicasthma ‡A Cluster Analysis Identifies 3 Phenotypes within Allergic Asthma. ‡9 1 | ||
| 919 | ‡a evi1mediateddownregulationofmir449aisessentialforthesurvivalofevi1positiveleukaemiccells ‡A EVI1-mediated down regulation of MIR449A is essential for the survival of EVI1 positive leukaemic cells ‡9 1 | ||
| 919 | ‡a fost12thefusariumoxysporumhomologofthetranscriptionfactorste12isupregulatedduringplantinfectionandrequiredforvirulence ‡A fost12, the Fusarium oxysporum homolog of the transcription factor Ste12, is upregulated during plant infection and required for virulence ‡9 1 | ||
| 919 | ‡a functionalcharacterizationofthepromoterregionofthehumanevi1geneinacutemyeloidleukemiarunx1andelk1directlyregulateitstranscription ‡A Functional characterization of the promoter region of the human EVI1 gene in acute myeloid leukemia: RUNX1 and ELK1 directly regulate its transcription. ‡9 1 | ||
| 919 | ‡a genesilencingdeliverymethodslipidmediatedandelectroporationtransfectionprotocols ‡A Gene Silencing Delivery Methods: Lipid-Mediated and Electroporation Transfection Protocols ‡9 1 | ||
| 919 | ‡a genomewideassociationstudiesgwasandtheirimportanceinasthma ‡A Genome-wide association studies (GWAS) and their importance in asthma. ‡9 1 | ||
| 919 | ‡a genomewideexpressionprofilingofblymphocytesrevealsil4rincreaseinallergicasthma ‡A Genome-wide expression profiling of B lymphocytes reveals IL4R increase in allergic asthma. ‡9 1 | ||
| 919 | ‡a implicationsofcytokinegenesinallergicasthma ‡A Implications of cytokine genes in allergic asthma. ‡9 1 | ||
| 919 | ‡a interleukin5receptorsubunitalphaexpressionasapotentialbiomarkerinpatientswithnasalpolyposis ‡A Interleukin 5 Receptor Subunit Alpha Expression as a Potential Biomarker in Patients with Nasal Polyposis ‡9 1 | ||
| 919 | ‡a newvirulencegroupsinfusariumoxysporumfspphaseolitheexpressionofthegenecodingforthetranscriptionfactorftf1correlateswithvirulence ‡A New Virulence Groups in Fusarium oxysporum f. sp. phaseoli: The Expression of the Gene Coding for the Transcription Factor ftf1 Correlates with Virulence ‡9 1 | ||
| 919 | ‡a overexpressionofgata2predictsanadverseprognosisforpatientswithacutemyeloidleukemiaanditisassociatedwithdistinctmolecularabnormalities ‡A Overexpression of GATA2 predicts an adverse prognosis for patients with acute myeloid leukemia and it is associated with distinct molecular abnormalities. ‡9 1 | ||
| 919 | ‡a overexpressionofsetisarecurrenteventassociatedwithpooroutcomeandcontributestoproteinphosphatase2ainhibitioninacutemyeloidleukemia ‡A Overexpression of SET is a recurrent event associated with poor outcome and contributes to protein phosphatase 2A inhibition in acute myeloid leukemia ‡9 1 | ||
| 919 | ‡a pharmacogeneticsandthetreatmentofasthma ‡A Pharmacogenetics and the treatment of asthma ‡9 1 | ||
| 919 | ‡a promoterassayusingluciferasereportergeneinthea549cellline ‡A Promoter Assay Using Luciferase Reporter Gene in the A549 Cell Line ‡9 1 | ||
| 919 | ‡a promotergenotypingandmrnaexpressionanalysisofptgdrgeneinallergy ‡A Promoter genotyping and mRNA expression analysis of PTGDR gene in allergy ‡9 1 | ||
| 919 | ‡a protocolforlipidmediatedtransienttransfectionina549epitheliallungcellline ‡A Protocol for Lipid-Mediated Transient Transfection in A549 Epithelial Lung Cell Line. ‡9 1 | ||
| 919 | ‡a ptgdrexpressionisupregulatedthroughretinoicacidreceptors ‡A PTGDR expression is upregulated through retinoic acid receptors ‡9 1 | ||
| 919 | ‡a ptgdrexpressionisupregulatedthroughretinoicacidreceptorsrarmechanisminallergy ‡A PTGDR expression is upregulated through retinoic acid receptors (RAR) mechanism in allergy ‡9 1 | ||
| 919 | ‡a ptgdrgeneexpressionandresponsetodexamethasonetreatmentinaninvitromodel ‡A PTGDR gene expression and response to dexamethasone treatment in an in vitro model. ‡9 1 | ||
| 919 | ‡a realtimepcrforgeneexpressionquantificationinasthma ‡A Real-Time PCR for Gene Expression Quantification in Asthma ‡9 1 | ||
| 919 | ‡a retinoicacidmodulatesptgdrpromoteractivity ‡A Retinoic Acid Modulates PTGDR Promoter Activity. ‡9 1 | ||
| 919 | ‡a reviewofmethodstostudygeneexpressionregulationappliedtoasthma ‡A Review of Methods to Study Gene Expression Regulation Applied to Asthma ‡9 1 | ||
| 919 | ‡a reviewonpharmacogeneticsandpharmacogenomicsappliedtothestudyofasthma ‡A Review on Pharmacogenetics and Pharmacogenomics Applied to the Study of Asthma ‡9 1 | ||
| 919 | ‡a genecodingforanewtranscriptionfactor ‡A The gene coding for a new transcription factor ‡9 1 | ||
| 919 | ‡a genecodingforanewtranscriptionfactorftf1offusariumoxysporumisonlyexpressedduringinfectionofcommonbean ‡A The gene coding for a new transcription factor (ftf1) of Fusarium oxysporum is only expressed during infection of common bean ‡9 1 | ||
| 919 | ‡a mdsandevi1complexlocusmecomisoformsregulatetheirowntranscriptionandhavedifferentrolesinthetransformationofhematopoieticstemandprogenitorcells ‡A The MDS and EVI1 complex locus (MECOM) isoforms regulate their own transcription and have different roles in the transformation of hematopoietic stem and progenitor cells ‡9 1 | ||
| 919 | ‡a prostaglandind2receptorptgdrgeneinasthmaandallergicdiseases ‡A The prostaglandin D2 receptor (PTGDR) gene in asthma and allergic diseases. ‡9 1 | ||
| 919 | ‡a roleofthegata2transcriptionfactorinnormalandmalignanthematopoiesis ‡A The role of the GATA2 transcription factor in normal and malignant hematopoiesis ‡9 1 | ||
| 919 | ‡a tryptasegeneticandfunctionalconsiderations ‡A Tryptase: genetic and functional considerations ‡9 1 | ||
| 919 | ‡a yrnasoverexpressionandpotentialimplicationsinallergy ‡A YRNAs overexpression and potential implications in allergy ‡9 1 | ||
| 996 | ‡2 BNE|XX1223760 | ||
| 996 | ‡2 BNE|XX1097064 | ||
| 996 | ‡2 DNB|105733989X | ||
| 996 | ‡2 ISNI|0000000047121687 | ||
| 996 | ‡2 LC|no2010136826 | ||
| 996 | ‡2 ISNI|0000000112661349 | ||
| 996 | ‡2 SUDOC|264003772 | ||
| 996 | ‡2 ISNI|0000000079737128 | ||
| 996 | ‡2 BNC|981058527293206706 | ||
| 996 | ‡2 LC|nb2008009915 | ||
| 996 | ‡2 BNE|XX1108075 | ||
| 996 | ‡2 BNE|XX974879 | ||
| 996 | ‡2 LC|n 87938696 | ||
| 996 | ‡2 DNB|1057179620 | ||
| 996 | ‡2 SUDOC|145727637 | ||
| 996 | ‡2 BNC|981060540206106706 | ||
| 996 | ‡2 NUKAT|n 2020075545 | ||
| 996 | ‡2 NKC|mzk20221147351 | ||
| 996 | ‡2 ISNI|0000000115575446 | ||
| 996 | ‡2 DNB|1057504602 | ||
| 996 | ‡2 SUDOC|121431908 | ||
| 996 | ‡2 RERO|A008652677 | ||
| 996 | ‡2 J9U|987007259342505171 | ||
| 996 | ‡2 LC|n 84182439 | ||
| 996 | ‡2 PLWABN|9811782256705606 | ||
| 996 | ‡2 DNB|1157216579 | ||
| 996 | ‡2 LC|no2008003041 | ||
| 996 | ‡2 BNC|981058510766306706 | ||
| 996 | ‡2 BNE|XX4728473 | ||
| 996 | ‡2 BNE|XX1711554 | ||
| 996 | ‡2 SUDOC|17166048X | ||
| 996 | ‡2 BNCHL|10000000000000000822748 | ||
| 996 | ‡2 DNB|1051411238 | ||
| 996 | ‡2 LC|no 98126399 | ||
| 996 | ‡2 DNB|1208777629 | ||
| 996 | ‡2 SUDOC|183664779 | ||
| 996 | ‡2 ISNI|0000000116824467 | ||
| 996 | ‡2 BNE|XX843807 | ||
| 996 | ‡2 LC|n 94003508 | ||
| 996 | ‡2 LC|n 95108198 | ||
| 996 | ‡2 BNF|14441698 | ||
| 996 | ‡2 DNB|1036299759 | ||
| 996 | ‡2 LC|no2015079401 | ||
| 996 | ‡2 LC|no2011105051 | ||
| 996 | ‡2 BNE|XX5200843 | ||
| 996 | ‡2 SKMASNL|vtls012964185 | ||
| 996 | ‡2 DE633|pe41010431 | ||
| 996 | ‡2 LC|n 2008057901 | ||
| 996 | ‡2 BNC|981058518686906706 | ||
| 996 | ‡2 BNE|XX869516 | ||
| 996 | ‡2 BNE|XX917452 | ||
| 996 | ‡2 BNE|XX5600900 | ||
| 996 | ‡2 BNE|XX4829537 | ||
| 996 | ‡2 ISNI|0000000083791303 | ||
| 996 | ‡2 BNF|14564043 | ||
| 996 | ‡2 SUDOC|14640162X | ||
| 996 | ‡2 SUDOC|029042801 | ||
| 996 | ‡2 DNB|1146932421 | ||
| 996 | ‡2 BNE|XX983817 | ||
| 996 | ‡2 ISNI|0000000060561206 | ||
| 996 | ‡2 BNE|XX5101339 | ||
| 996 | ‡2 ISNI|0000000386683481 | ||
| 996 | ‡2 LC|n 86130251 | ||
| 996 | ‡2 SUDOC|071920358 | ||
| 996 | ‡2 ISNI|0000000060391622 | ||
| 996 | ‡2 BIBSYS|14010184 | ||
| 996 | ‡2 NUKAT|nx2023923412 | ||
| 996 | ‡2 ISNI|0000000431012469 | ||
| 996 | ‡2 SUDOC|280968698 | ||
| 996 | ‡2 DNB|1057258121 | ||
| 996 | ‡2 BNE|XX5047938 | ||
| 996 | ‡2 BNE|XX830459 | ||
| 996 | ‡2 LC|no2018001128 | ||
| 996 | ‡2 BNE|XX5618003 | ||
| 996 | ‡2 BNE|XX5798928 | ||
| 996 | ‡2 BNC|981058527877706706 | ||
| 996 | ‡2 BNE|XX1687731 | ||
| 996 | ‡2 ISNI|000000006006236X | ||
| 996 | ‡2 ISNI|0000000383446472 | ||
| 996 | ‡2 SUDOC|241687128 | ||
| 996 | ‡2 ISNI|0000000107850890 | ||
| 996 | ‡2 DNB|1220119334 | ||
| 996 | ‡2 ISNI|0000000498116115 | ||
| 996 | ‡2 SUDOC|030513936 | ||
| 996 | ‡2 SUDOC|166707430 | ||
| 996 | ‡2 ISNI|0000000359842360 | ||
| 996 | ‡2 ISNI|0000000120566835 | ||
| 996 | ‡2 PTBNP|1771210 | ||
| 996 | ‡2 LC|ns2024001565 | ||
| 996 | ‡2 PLWABN|9810947044905606 | ||
| 996 | ‡2 SUDOC|19093770X | ||
| 996 | ‡2 BNE|XX4866831 | ||
| 996 | ‡2 BNE|XX935383 | ||
| 996 | ‡2 LC|n 90640183 | ||
| 996 | ‡2 ISNI|0000000059940372 | ||
| 996 | ‡2 LIH|LNB:I81;=_m_7 | ||
| 996 | ‡2 PLWABN|9810613337805606 | ||
| 996 | ‡2 SUDOC|096278641 | ||
| 996 | ‡2 LC|n 2002110218 | ||
| 996 | ‡2 LC|ns2013004214 | ||
| 996 | ‡2 NKC|jn20020726045 | ||
| 996 | ‡2 NSK|000715514 | ||
| 996 | ‡2 SIMACOB|321797731 | ||
| 996 | ‡2 BNE|XX1044359 | ||
| 996 | ‡2 ISNI|000000006016434X | ||
| 996 | ‡2 BNE|XX5236034 | ||
| 996 | ‡2 ISNI|0000000043185173 | ||
| 996 | ‡2 BNF|12203585 | ||
| 996 | ‡2 NUKAT|n 2019008480 | ||
| 996 | ‡2 BNE|XX1211948 | ||
| 996 | ‡2 LC|n 2002105346 | ||
| 996 | ‡2 ISNI|0000000059562981 | ||
| 996 | ‡2 NII|DA08546201 | ||
| 996 | ‡2 RERO|A018128307 | ||
| 996 | ‡2 PTBNP|1885790 | ||
| 996 | ‡2 NII|DA15945364 | ||
| 996 | ‡2 BNE|XX6022270 | ||
| 996 | ‡2 SUDOC|162070527 | ||
| 996 | ‡2 BNF|15947990 | ||
| 996 | ‡2 CAOONL|ncf11861446 | ||
| 996 | ‡2 DNB|134902076 | ||
| 996 | ‡2 BNE|XX4921072 | ||
| 996 | ‡2 JPG|500040140 | ||
| 996 | ‡2 LC|no2021029113 | ||
| 996 | ‡2 DNB|1068297786 | ||
| 996 | ‡2 ISNI|0000000105320730 | ||
| 996 | ‡2 SUDOC|029534925 | ||
| 996 | ‡2 LC|ns2018000887 | ||
| 996 | ‡2 DNB|1012212963 | ||
| 996 | ‡2 BNF|17772697 | ||
| 996 | ‡2 SUDOC|233262660 | ||
| 996 | ‡2 BLBNB|000340930 | ||
| 996 | ‡2 BNE|XX938555 | ||
| 996 | ‡2 SUDOC|08670219X | ||
| 996 | ‡2 NUKAT|n 2018178423 | ||
| 996 | ‡2 LC|n 94099817 | ||
| 996 | ‡2 BNE|XX863049 | ||
| 996 | ‡2 LC|no2024039059 | ||
| 996 | ‡2 BNE|XX1550749 | ||
| 996 | ‡2 BNC|981058528286006706 | ||
| 996 | ‡2 NKC|xx0267794 | ||
| 996 | ‡2 PLWABN|9813204202805606 | ||
| 996 | ‡2 DNB|1210309483 | ||
| 996 | ‡2 ISNI|0000000059860452 | ||
| 996 | ‡2 BNE|XX1229024 | ||
| 996 | ‡2 JPG|500040496 | ||
| 996 | ‡2 LC|ns2022001643 | ||
| 996 | ‡2 JPG|500040490 | ||
| 996 | ‡2 BNCHL|10000000000000000267788 | ||
| 996 | ‡2 SUDOC|127962611 | ||
| 996 | ‡2 NUKAT|n 96002815 | ||
| 996 | ‡2 ISNI|0000000409971356 | ||
| 996 | ‡2 LC|n 98005959 | ||
| 996 | ‡2 LC|nb2022003596 | ||
| 996 | ‡2 LC|no2011131531 | ||
| 996 | ‡2 B2Q|0000460016 | ||
| 996 | ‡2 PLWABN|9811461901205606 | ||
| 996 | ‡2 SUDOC|25566558X | ||
| 996 | ‡2 ISNI|000000005954904X | ||
| 996 | ‡2 BNE|XX1625872 | ||
| 996 | ‡2 ISNI|0000000075408220 | ||
| 996 | ‡2 BNE|XX5674770 | ||
| 996 | ‡2 SUDOC|163919305 | ||
| 996 | ‡2 LC|no2010133861 | ||
| 996 | ‡2 BNF|16506783 | ||
| 996 | ‡2 DNB|1214004008 | ||
| 996 | ‡2 BNE|XX1108867 | ||
| 996 | ‡2 DNB|1023666103 | ||
| 996 | ‡2 DNB|1158138989 | ||
| 996 | ‡2 KRNLK|KAC200704978 | ||
| 996 | ‡2 SZ|1162903538 | ||
| 996 | ‡2 BNE|XX952472 | ||
| 996 | ‡2 CAOONL|ncf11438684 | ||
| 996 | ‡2 DNB|1223032574 | ||
| 996 | ‡2 BNE|XX4877197 | ||
| 996 | ‡2 ISNI|0000000118257515 | ||
| 996 | ‡2 LC|nr 96032138 | ||
| 996 | ‡2 LC|no2022011786 | ||
| 996 | ‡2 LC|no2022011789 | ||
| 996 | ‡2 ISNI|0000000118479329 | ||
| 996 | ‡2 BNE|XX1107554 | ||
| 996 | ‡2 ISNI|0000000059290517 | ||
| 996 | ‡2 BNE|XX1080143 | ||
| 996 | ‡2 ISNI|0000000042554555 | ||
| 996 | ‡2 BNE|XX5651743 | ||
| 996 | ‡2 DNB|1056548967 | ||
| 996 | ‡2 LC|no2009139039 | ||
| 996 | ‡2 LC|n 2024181309 | ||
| 996 | ‡2 ISNI|0000000503517600 | ||
| 996 | ‡2 BNC|981058608648906706 | ||
| 996 | ‡2 SUDOC|15204759X | ||
| 996 | ‡2 BNE|XX888743 | ||
| 996 | ‡2 BIBSYS|25359 | ||
| 996 | ‡2 LC|no2014120321 | ||
| 996 | ‡2 BNF|16951951 | ||
| 996 | ‡2 ISNI|0000000059286446 | ||
| 996 | ‡2 BNE|XX1020811 | ||
| 996 | ‡2 LC|ns2012004429 | ||
| 996 | ‡2 LC|n 00005864 | ||
| 996 | ‡2 ISNI|0000000376296103 | ||
| 996 | ‡2 BNE|XX858797 | ||
| 996 | ‡2 BNE|XX1623497 | ||
| 996 | ‡2 PTBNP|1689390 | ||
| 996 | ‡2 PLWABN|9812403707305606 | ||
| 996 | ‡2 BLBNB|001021704 | ||
| 996 | ‡2 ISNI|000000006151310X | ||
| 996 | ‡2 ISNI|0000000060057528 | ||
| 996 | ‡2 DNB|1265410801 | ||
| 996 | ‡2 BNE|XX6414266 | ||
| 996 | ‡2 BNE|XX1591713 | ||
| 996 | ‡2 BNC|981058512860306706 | ||
| 996 | ‡2 BNE|XX1096582 | ||
| 996 | ‡2 DNB|1064034330 | ||
| 996 | ‡2 BNF|17012370 | ||
| 996 | ‡2 LC|no2014034887 | ||
| 996 | ‡2 BNE|XX5880715 | ||
| 996 | ‡2 SUDOC|112020585 | ||
| 996 | ‡2 LC|n 87904387 | ||
| 996 | ‡2 BNE|XX859178 | ||
| 996 | ‡2 ISNI|0000000046961756 | ||
| 996 | ‡2 SUDOC|280722788 | ||
| 996 | ‡2 LC|n 96001248 | ||
| 996 | ‡2 RERO|A000102699 | ||
| 996 | ‡2 CAOONL|ncf11723095 | ||
| 996 | ‡2 LC|no2010008170 | ||
| 996 | ‡2 BNE|XX1518296 | ||
| 996 | ‡2 RERO|A009280229 | ||
| 996 | ‡2 BNE|XX1492655 | ||
| 996 | ‡2 DNB|1157247156 | ||
| 996 | ‡2 ISNI|0000000059380627 | ||
| 996 | ‡2 BNE|XX1431143 | ||
| 996 | ‡2 LC|n 2012000428 | ||
| 996 | ‡2 BNE|XX895599 | ||
| 996 | ‡2 BNCHL|10000000000000000871527 | ||
| 996 | ‡2 LC|n 2017035655 | ||
| 996 | ‡2 LC|n 85092815 | ||
| 996 | ‡2 J9U|987007281359705171 | ||
| 996 | ‡2 BNC|981058508778606706 | ||
| 996 | ‡2 BNE|XX5744355 | ||
| 996 | ‡2 BNE|XX1178253 | ||
| 996 | ‡2 ISNI|0000000371396797 | ||
| 996 | ‡2 BNE|XX5060223 | ||
| 996 | ‡2 BNE|XX1413754 | ||
| 996 | ‡2 SUDOC|158998855 | ||
| 996 | ‡2 BNE|XX920312 | ||
| 996 | ‡2 DNB|1041851901 | ||
| 996 | ‡2 DNB|137889712 | ||
| 996 | ‡2 PTBNP|1654393 | ||
| 996 | ‡2 LC|no2021073429 | ||
| 996 | ‡2 BNCHL|10000000000000000092015 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 |
