Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q80001493 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241121000343.0 | ||
| 008 | 241121nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q80001493 | ||
| 024 | ‡a 0000-0002-1573-4678 ‡2 orcid | ||
| 024 | ‡a 26637306600 ‡2 scopus | ||
| 035 | ‡a (OCoLC)Q80001493 | ||
| 100 | 0 | ‡a E I O Vidal ‡c researcher ‡9 en | |
| 400 | 0 | ‡a E I O Vidal ‡c wetenschapper ‡9 nl | |
| 670 | ‡a Author's Anticonvulsants for chronic low-back pain | ||
| 670 | ‡a Author's Authors' reply to Ninan | ||
| 670 | ‡a Author's Authors' reply to Notcutt | ||
| 670 | ‡a Author's Comparing objective and self-reported measures of adherence in haemophilia | ||
| 670 | ‡a Author's Complex regional pain syndrome | ||
| 670 | ‡a Author's Cross-Cultural Adaptation of the Physician Orders for Life-Sustaining Treatment Form to Brazil | ||
| 670 | ‡a Author's Delirium in older adults | ||
| 670 | ‡a Author's Effects of symbiotic food consumption in diabetic patients | ||
| 670 | ‡a Author's Evaluation of the Interrater Reliability of End-of-Life Medical Orders in the Physician Orders for Life-Sustaining Treatment Form | ||
| 670 | ‡a Author's Frailty in older adults: perspectives for research and practice in Public Health | ||
| 670 | ‡a Author's Hip fracture in the elderly: does counting time from fracture to surgery or from hospital admission to surgery matter when studying in-hospital mortality? | ||
| 670 | ‡a Author's Influenza among adults in Latin America, current status, and future directions: a consensus statement. | ||
| 670 | ‡a Author's Influenza among the elderly in the Americas: a consensus statement | ||
| 670 | ‡a Author's Is the number of previous hospitalizations associated with increased in-hospital mortality after hip fracture in a developing country? | ||
| 670 | ‡a Author's Missed opportunities in the way medical schools evaluate the ethical domain in clerkship rotations | ||
| 670 | ‡a Author's Mortality within 1 year after hip fracture surgical repair in the elderly according to postoperative period: a probabilistic record linkage study in Brazil | ||
| 670 | ‡a Author's Nutritional interventions for the treatment of frailty in older adults: a systematic review protocol | ||
| 670 | ‡a Author's Physical frailty as a clinical marker of biological age and aging | ||
| 670 | ‡a Author's Picture-based memory impairment screen: a major achievement for cognitive assessment of older adults in developing countries. | ||
| 670 | ‡a Author's Platypnea-Orthodeoxia Syndrome Masked by Delirium in an 85-Year-Old Woman. | ||
| 670 | ‡a Author's Position statement of ANCP and SBGG on shared decision-making in palliative care | ||
| 670 | ‡a Author's Risk Factors for Hepatocellular Carcinoma Recurrence and Survival after Liver Transplantation in Patients with HCV-Related Cirrhosis | ||
| 670 | ‡a Author's She Saved My Life | ||
| 670 | ‡a Author's Teaching medical students about dementia: A brief review | ||
| 670 | ‡a Author's The neuraxial effects of intraspinal amitriptyline at low concentrations. | ||
| 670 | ‡a Author's Unexpected improvement in levodopa-induced dyskinesia and on-off phenomena after introduction of memantine for treatment of Parkinson's disease dementia | ||
| 670 | ‡a Author's What CSP expects of systematic reviews in the future | ||
| 909 | ‡a (scopus) 26637306600 ‡9 1 | ||
| 909 | ‡a (orcid) 0000000215734678 ‡9 1 | ||
| 919 | ‡a whatcspexpectsofsystematicreviewsinthefuture ‡A What CSP expects of systematic reviews in the future ‡9 1 | ||
| 919 | ‡a unexpectedimprovementinlevodopainduceddyskinesiaandonoffphenomenaafterintroductionofmemantinefortreatmentofparkinsonsdiseasedementia ‡A Unexpected improvement in levodopa-induced dyskinesia and on-off phenomena after introduction of memantine for treatment of Parkinson's disease dementia ‡9 1 | ||
| 919 | ‡a neuraxialeffectsofintraspinalamitriptylineatlowconcentrations ‡A The neuraxial effects of intraspinal amitriptyline at low concentrations. ‡9 1 | ||
| 919 | ‡a teachingmedicalstudentsaboutdementiaabriefreview ‡A Teaching medical students about dementia: A brief review ‡9 1 | ||
| 919 | ‡a shesavedmylife ‡A She Saved My Life ‡9 1 | ||
| 919 | ‡a riskfactorsforhepatocellularcarcinomarecurrenceandsurvivalafterlivertransplantationinpatientswithhcvrelatedcirrhosis ‡A Risk Factors for Hepatocellular Carcinoma Recurrence and Survival after Liver Transplantation in Patients with HCV-Related Cirrhosis ‡9 1 | ||
| 919 | ‡a positionstatementofancpandsbggonshareddecisionmakinginpalliativecare ‡A Position statement of ANCP and SBGG on shared decision-making in palliative care ‡9 1 | ||
| 919 | ‡a platypneaorthodeoxiasyndromemaskedbydeliriuminan85yearoldwoman ‡A Platypnea-Orthodeoxia Syndrome Masked by Delirium in an 85-Year-Old Woman. ‡9 1 | ||
| 919 | ‡a picturebasedmemoryimpairmentscreenamajorachievementforcognitiveassessmentofolderadultsindevelopingcountries ‡A Picture-based memory impairment screen: a major achievement for cognitive assessment of older adults in developing countries. ‡9 1 | ||
| 919 | ‡a physicalfrailtyasaclinicalmarkerofbiologicalageandaging ‡A Physical frailty as a clinical marker of biological age and aging ‡9 1 | ||
| 919 | ‡a nutritionalinterventionsforthetreatmentoffrailtyinolderadultsasystematicreviewprotocol ‡A Nutritional interventions for the treatment of frailty in older adults: a systematic review protocol ‡9 1 | ||
| 919 | ‡a mortalitywithin1yearafterhipfracturesurgicalrepairintheelderlyaccordingtopostoperativeperiodaprobabilisticrecordlinkagestudyinbrazil ‡A Mortality within 1 year after hip fracture surgical repair in the elderly according to postoperative period: a probabilistic record linkage study in Brazil ‡9 1 | ||
| 919 | ‡a missedopportunitiesinthewaymedicalschoolsevaluatetheethicaldomaininclerkshiprotations ‡A Missed opportunities in the way medical schools evaluate the ethical domain in clerkship rotations ‡9 1 | ||
| 919 | ‡a isthenumberofprevioushospitalizationsassociatedwithincreasedinhospitalmortalityafterhipfractureinadevelopingcountry ‡A Is the number of previous hospitalizations associated with increased in-hospital mortality after hip fracture in a developing country? ‡9 1 | ||
| 919 | ‡a influenzaamongtheelderlyintheamericasaconsensusstatement ‡A Influenza among the elderly in the Americas: a consensus statement ‡9 1 | ||
| 919 | ‡a influenzaamongadultsinlatinamericacurrentstatusandfuturedirectionsaconsensusstatement ‡A Influenza among adults in Latin America, current status, and future directions: a consensus statement. ‡9 1 | ||
| 919 | ‡a hipfractureintheelderlydoescountingtimefromfracturetosurgeryorfromhospitaladmissiontosurgerymatterwhenstudyinginhospitalmortality ‡A Hip fracture in the elderly: does counting time from fracture to surgery or from hospital admission to surgery matter when studying in-hospital mortality? ‡9 1 | ||
| 919 | ‡a frailtyinolderadultsperspectivesforresearchandpracticeinpublichealth ‡A Frailty in older adults: perspectives for research and practice in Public Health ‡9 1 | ||
| 919 | ‡a evaluationoftheinterraterreliabilityofendoflifemedicalordersinthephysicianordersforlifesustainingtreatmentform ‡A Evaluation of the Interrater Reliability of End-of-Life Medical Orders in the Physician Orders for Life-Sustaining Treatment Form ‡9 1 | ||
| 919 | ‡a effectsofsymbioticfoodconsumptionindiabeticpatients ‡A Effects of symbiotic food consumption in diabetic patients ‡9 1 | ||
| 919 | ‡a deliriuminolderadults ‡A Delirium in older adults ‡9 1 | ||
| 919 | ‡a crossculturaladaptationofthephysicianordersforlifesustainingtreatmentformtobrazil ‡A Cross-Cultural Adaptation of the Physician Orders for Life-Sustaining Treatment Form to Brazil ‡9 1 | ||
| 919 | ‡a complexregionalpainsyndrome ‡A Complex regional pain syndrome ‡9 1 | ||
| 919 | ‡a comparingobjectiveandselfreportedmeasuresofadherenceinhaemophilia ‡A Comparing objective and self-reported measures of adherence in haemophilia ‡9 1 | ||
| 919 | ‡a authorsreplytonotcutt ‡A Authors' reply to Notcutt ‡9 1 | ||
| 919 | ‡a authorsreplytoninan ‡A Authors' reply to Ninan ‡9 1 | ||
| 919 | ‡a anticonvulsantsforchroniclowbackpain ‡A Anticonvulsants for chronic low-back pain ‡9 1 | ||
| 996 | ‡2 LC|no 98064954 | ||
| 996 | ‡2 NTA|068576404 | ||
| 996 | ‡2 RERO|A011678826 | ||
| 996 | ‡2 ISNI|0000000079997149 | ||
| 996 | ‡2 ISNI|0000000059546578 | ||
| 996 | ‡2 DNB|1056742380 | ||
| 996 | ‡2 BNE|XX5864700 | ||
| 996 | ‡2 LC|n 2014189361 | ||
| 996 | ‡2 BIBSYS|7040781 | ||
| 996 | ‡2 DBC|87097969059988 | ||
| 996 | ‡2 PLWABN|9814282954905606 | ||
| 996 | ‡2 BNCHL|10000000000000000083320 | ||
| 996 | ‡2 CAOONL|ncf11560012 | ||
| 996 | ‡2 BNC|981058513645406706 | ||
| 996 | ‡2 SUDOC|088649520 | ||
| 996 | ‡2 ISNI|000000005920886X | ||
| 996 | ‡2 PLWABN|9810679239205606 | ||
| 996 | ‡2 RERO|A003942544 | ||
| 996 | ‡2 BNF|10596427 | ||
| 996 | ‡2 ISNI|0000000434654846 | ||
| 996 | ‡2 LC|n 96067755 | ||
| 996 | ‡2 SUDOC|156356023 | ||
| 996 | ‡2 J9U|987007269596505171 | ||
| 996 | ‡2 BNC|981058517613306706 | ||
| 996 | ‡2 LC|ns2017000069 | ||
| 996 | ‡2 SUDOC|090409809 | ||
| 996 | ‡2 BNCHL|10000000000000000244855 | ||
| 996 | ‡2 LC|nr2001045119 | ||
| 996 | ‡2 LC|n 2013015198 | ||
| 996 | ‡2 ARBABN|000066915 | ||
| 996 | ‡2 BNC|981061006354306706 | ||
| 996 | ‡2 LC|n 2007026466 | ||
| 996 | ‡2 LC|n 97078096 | ||
| 996 | ‡2 ISNI|0000000017872594 | ||
| 996 | ‡2 LC|n 85820255 | ||
| 996 | ‡2 ISNI|0000000108323208 | ||
| 996 | ‡2 LC|n 2004114210 | ||
| 996 | ‡2 LC|nr2005019006 | ||
| 996 | ‡2 ISNI|0000000043184656 | ||
| 996 | ‡2 DNB|132804794 | ||
| 996 | ‡2 LC|n 2006084102 | ||
| 996 | ‡2 LC|n 82000305 | ||
| 996 | ‡2 NKC|mzk2016917544 | ||
| 996 | ‡2 LC|n 85070749 | ||
| 996 | ‡2 LC|no2004063856 | ||
| 996 | ‡2 CAOONL|ncf10730396 | ||
| 996 | ‡2 LC|no2023012136 | ||
| 996 | ‡2 ISNI|0000000066385346 | ||
| 996 | ‡2 J9U|987007331923405171 | ||
| 996 | ‡2 BNC|981058510200706706 | ||
| 996 | ‡2 SUDOC|262245787 | ||
| 996 | ‡2 CAOONL|ncf10949151 | ||
| 996 | ‡2 BNF|16264694 | ||
| 996 | ‡2 LC|no2020150671 | ||
| 996 | ‡2 BNCHL|10000000000000000862074 | ||
| 996 | ‡2 ISNI|0000000122833466 | ||
| 996 | ‡2 LC|no2017041430 | ||
| 996 | ‡2 LC|nr 96031906 | ||
| 996 | ‡2 BLBNB|001023373 | ||
| 996 | ‡2 BNC|981058527007306706 | ||
| 996 | ‡2 NTA|17011810X | ||
| 996 | ‡2 NUKAT|n 2008059412 | ||
| 996 | ‡2 BNE|XX955833 | ||
| 996 | ‡2 ARBABN|000049326 | ||
| 996 | ‡2 BNE|XX847939 | ||
| 996 | ‡2 LC|no 00040540 | ||
| 996 | ‡2 BNE|XX847377 | ||
| 996 | ‡2 SUDOC|190781254 | ||
| 996 | ‡2 DNB|1057571032 | ||
| 996 | ‡2 DNB|1061824039 | ||
| 996 | ‡2 DNB|1056677252 | ||
| 996 | ‡2 BNCHL|10000000000000000066556 | ||
| 996 | ‡2 ISNI|0000000358873181 | ||
| 996 | ‡2 PTBNP|95583 | ||
| 996 | ‡2 LC|n 2002092094 | ||
| 996 | ‡2 ISNI|0000000059212009 | ||
| 996 | ‡2 DNB|138448655 | ||
| 996 | ‡2 BNF|13322094 | ||
| 996 | ‡2 ISNI|0000000068216677 | ||
| 996 | ‡2 PTBNP|1047803 | ||
| 996 | ‡2 ISNI|0000000359756892 | ||
| 996 | ‡2 LC|no2011010235 | ||
| 996 | ‡2 SUDOC|116525827 | ||
| 996 | ‡2 LC|n 2019042999 | ||
| 996 | ‡2 LC|no2010196231 | ||
| 996 | ‡2 NII|DA12238655 | ||
| 996 | ‡2 RERO|A003941078 | ||
| 996 | ‡2 BNF|14236529 | ||
| 996 | ‡2 SUDOC|035565446 | ||
| 996 | ‡2 JPG|500202740 | ||
| 996 | ‡2 BNE|XX855413 | ||
| 996 | ‡2 RERO|A003941076 | ||
| 996 | ‡2 ISNI|0000000080794170 | ||
| 996 | ‡2 BNF|10295166 | ||
| 996 | ‡2 BNF|12017481 | ||
| 996 | ‡2 SUDOC|270478388 | ||
| 996 | ‡2 BNCHL|10000000000000000241722 | ||
| 996 | ‡2 BLBNB|000250316 | ||
| 996 | ‡2 BNF|13059624 | ||
| 996 | ‡2 BNCHL|10000000000000000173502 | ||
| 996 | ‡2 PLWABN|9810547655205606 | ||
| 996 | ‡2 LC|no2002088390 | ||
| 996 | ‡2 NII|DA14237992 | ||
| 996 | ‡2 LC|ns2018001140 | ||
| 996 | ‡2 LC|n 99900033 | ||
| 996 | ‡2 BNCHL|10000000000000000284842 | ||
| 996 | ‡2 ISNI|000000044207354X | ||
| 996 | ‡2 LC|no2011041761 | ||
| 996 | ‡2 SUDOC|055274838 | ||
| 996 | ‡2 LC|no2011180011 | ||
| 996 | ‡2 BNE|XX884989 | ||
| 996 | ‡2 J9U|987007261115405171 | ||
| 996 | ‡2 LC|n 2022034705 | ||
| 996 | ‡2 SUDOC|162052197 | ||
| 996 | ‡2 SUDOC|143319817 | ||
| 996 | ‡2 SUDOC|08601451X | ||
| 996 | ‡2 SELIBR|183762 | ||
| 996 | ‡2 ISNI|0000000108632641 | ||
| 996 | ‡2 BNF|17980098 | ||
| 996 | ‡2 ISNI|0000000052020506 | ||
| 996 | ‡2 ISNI|0000000005297668 | ||
| 996 | ‡2 SUDOC|276255690 | ||
| 996 | ‡2 NII|DA18007509 | ||
| 996 | ‡2 BNE|XX5051692 | ||
| 996 | ‡2 J9U|987007322321505171 | ||
| 996 | ‡2 NII|DA08712901 | ||
| 996 | ‡2 LC|no2011130187 | ||
| 996 | ‡2 ISNI|0000000059739361 | ||
| 996 | ‡2 ISNI|0000000354846098 | ||
| 996 | ‡2 SUDOC|232888760 | ||
| 996 | ‡2 BNF|11509767 | ||
| 996 | ‡2 DNB|13755320X | ||
| 996 | ‡2 ISNI|0000000395514030 | ||
| 996 | ‡2 CAOONL|ncf11955058 | ||
| 996 | ‡2 ISNI|0000000459504510 | ||
| 996 | ‡2 BNC|981058520946306706 | ||
| 996 | ‡2 BNC|981058615576606706 | ||
| 996 | ‡2 PTBNP|1775161 | ||
| 996 | ‡2 DNB|1036101851 | ||
| 996 | ‡2 SUDOC|257327452 | ||
| 996 | ‡2 ISNI|0000000060343815 | ||
| 996 | ‡2 NTA|258267526 | ||
| 996 | ‡2 NKC|utb2011672322 | ||
| 996 | ‡2 DNB|105736682X | ||
| 996 | ‡2 SUDOC|270705074 | ||
| 996 | ‡2 BNF|16696606 | ||
| 996 | ‡2 SUDOC|130851426 | ||
| 996 | ‡2 BNE|XX5604859 | ||
| 996 | ‡2 ISNI|0000000512765569 | ||
| 996 | ‡2 SUDOC|261262319 | ||
| 996 | ‡2 J9U|987007282794805171 | ||
| 996 | ‡2 SUDOC|083909834 | ||
| 996 | ‡2 CAOONL|ncf10501255 | ||
| 996 | ‡2 BNF|17957651 | ||
| 996 | ‡2 DNB|119376768 | ||
| 996 | ‡2 J9U|987007449124705171 | ||
| 996 | ‡2 DNB|1261497759 | ||
| 996 | ‡2 DBC|87097969737811 | ||
| 996 | ‡2 SUDOC|197693156 | ||
| 996 | ‡2 RERO|A013935238 | ||
| 996 | ‡2 LIH|LNB:B_c_,_s_;=B_z_ | ||
| 996 | ‡2 LC|nr 97000288 | ||
| 996 | ‡2 LC|no2010051121 | ||
| 996 | ‡2 BLBNB|000374493 | ||
| 996 | ‡2 LC|no2023094309 | ||
| 996 | ‡2 BNCHL|10000000000000000118188 | ||
| 996 | ‡2 BNF|16923891 | ||
| 996 | ‡2 BNE|XX1124334 | ||
| 996 | ‡2 CAOONL|ncf10930468 | ||
| 996 | ‡2 ISNI|0000000029321167 | ||
| 996 | ‡2 ISNI|0000000140414388 | ||
| 996 | ‡2 NSK|000423683 | ||
| 996 | ‡2 SUDOC|137050658 | ||
| 996 | ‡2 BNCHL|10000000000000000069748 | ||
| 996 | ‡2 LC|n 85163094 | ||
| 996 | ‡2 LC|no2018154489 | ||
| 996 | ‡2 PLWABN|9810657236005606 | ||
| 996 | ‡2 DNB|1057362972 | ||
| 996 | ‡2 ISNI|0000000066983733 | ||
| 996 | ‡2 LC|no2013131292 | ||
| 996 | ‡2 NTA|120625059 | ||
| 996 | ‡2 RERO|A024445818 | ||
| 996 | ‡2 SUDOC|061133868 | ||
| 996 | ‡2 ISNI|000000009774847X | ||
| 996 | ‡2 NUKAT|n 2013048136 | ||
| 996 | ‡2 JPG|500243637 | ||
| 996 | ‡2 ISNI|0000000040034230 | ||
| 996 | ‡2 PLWABN|9810666273305606 | ||
| 996 | ‡2 BNC|981058518211006706 | ||
| 996 | ‡2 SUDOC|131406728 | ||
| 996 | ‡2 NTA|117590541 | ||
| 996 | ‡2 BNCHL|10000000000000000274755 | ||
| 996 | ‡2 BIBSYS|14054222 | ||
| 996 | ‡2 BNF|16191462 | ||
| 996 | ‡2 JPG|500029136 | ||
| 996 | ‡2 SUDOC|067300782 | ||
| 996 | ‡2 RERO|A000172555 | ||
| 996 | ‡2 ISNI|0000000496178558 | ||
| 996 | ‡2 DNB|119512599 | ||
| 996 | ‡2 SUDOC|114107262 | ||
| 996 | ‡2 BNE|XX4863894 | ||
| 996 | ‡2 LC|n 79040150 | ||
| 996 | ‡2 N6I|vtls000025875 | ||
| 996 | ‡2 DNB|1057413976 | ||
| 996 | ‡2 SUDOC|267974248 | ||
| 996 | ‡2 BNE|XX5717982 | ||
| 996 | ‡2 BNE|XX1101711 | ||
| 996 | ‡2 NLA|000035413885 | ||
| 996 | ‡2 SUDOC|162387709 | ||
| 996 | ‡2 ISNI|0000000053236106 | ||
| 996 | ‡2 NII|DA07498464 | ||
| 996 | ‡2 BNCHL|10000000000000000240173 | ||
| 996 | ‡2 BNE|XX1166194 | ||
| 996 | ‡2 ISNI|0000000041467812 | ||
| 996 | ‡2 LC|no 95023255 | ||
| 996 | ‡2 BNE|XX1246946 | ||
| 996 | ‡2 BNF|13625126 | ||
| 996 | ‡2 SUDOC|171858433 | ||
| 996 | ‡2 ISNI|0000000371196859 | ||
| 996 | ‡2 SUDOC|112881947 | ||
| 996 | ‡2 DNB|1053285698 | ||
| 996 | ‡2 DNB|1184606692 | ||
| 996 | ‡2 PLWABN|9810633487405606 | ||
| 996 | ‡2 BNC|981058613000706706 | ||
| 996 | ‡2 JPG|500037966 | ||
| 996 | ‡2 SUDOC|250960737 | ||
| 996 | ‡2 ISNI|0000000070198148 | ||
| 996 | ‡2 LC|nr2003010789 | ||
| 996 | ‡2 ISNI|0000000120964921 | ||
| 996 | ‡2 BNCHL|10000000000000000053721 | ||
| 996 | ‡2 LC|n 93040793 | ||
| 996 | ‡2 BLBNB|001482841 | ||
| 996 | ‡2 BNCHL|10000000000000000219689 | ||
| 996 | ‡2 NYNYRILM|271253 | ||
| 996 | ‡2 NUKAT|n 97064048 | ||
| 996 | ‡2 LC|no2017078258 | ||
| 996 | ‡2 SUDOC|248485318 | ||
| 996 | ‡2 BLBNB|000565193 | ||
| 996 | ‡2 LIH|LNB:BQ_z__b_;=B, | ||
| 996 | ‡2 ISNI|0000000116822752 | ||
| 996 | ‡2 ISNI|0000000060228139 | ||
| 996 | ‡2 BNCHL|10000000000000000247160 | ||
| 996 | ‡2 NUKAT|n 2009075713 | ||
| 996 | ‡2 BNC|981058607727406706 | ||
| 996 | ‡2 NUKAT|n 2021122359 | ||
| 996 | ‡2 J9U|987007283998705171 | ||
| 996 | ‡2 SUDOC|24401860X | ||
| 996 | ‡2 SUDOC|078807794 | ||
| 996 | ‡2 BNE|XX1520762 | ||
| 996 | ‡2 SUDOC|272998699 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 |
