VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q95980270  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000229.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q95980270‏
024 ‎‡a  0000-0002-0583-8019‏ ‎‡2  orcid‏
035 ‎‡a  (OCoLC)Q95980270‏
100 0 ‎‡a  Julie Fox‏ ‎‡c  researcher‏ ‎‡9  en‏
375 ‎‡a  2‏ ‎‡2  iso5218‏
400 0 ‎‡a  Julie Fox‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's A multi-country cross-sectional study to assess predictors of daily versus on-demand oral pre-exposure prophylaxis in youth from South Africa, Uganda and Zimbabwe‏
670 ‎‡a  Author's Administration of broadly neutralizing anti-HIV-1 antibodies at ART initiation maintains long-term CD8+ T cell immunity‏
670 ‎‡a  Author's Analytical Advances in the Ex Vivo Challenge Efficacy Assay‏
670 ‎‡a  Author's artikull shkencor i botuar në vitin 2022‏
670 ‎‡a  Author's artikull shkencor i botuar në vitin 2023‏
670 ‎‡a  Author's Bone mineral density, kidney function and participant‐reported outcome measures in women who switch from tenofovir disoproxil emtricitabine and a nonnucleoside reverse transcriptase inhibitor to abacavir, lamivudine and dolutegravir‏
670 ‎‡a  Author's Booster Vaccination Against SARS-CoV-2 Induces Potent Immune Responses in People With Human Immunodeficiency Virus‏
670 ‎‡a  Author's Brief Report: Pharmacokinetic/Pharmacodynamic Investigation of Single-Dose Oral Maraviroc in the Context of HIV-1 Pre-exposure Prophylaxis‏
670 ‎‡a  Author's Broadly neutralizing antibody responses in the longitudinal primary HIV-1 infection Short Pulse Anti-Retroviral Therapy at Seroconversion cohort‏
670 ‎‡a  Author's CD32 expressing doublets in HIV-infected gut-associated lymphoid tissue are associated with a T follicular helper cell phenotype‏
670 ‎‡a  Author's ChAdOx1 nCoV-19 vaccine elicits monoclonal antibodies with cross-neutralizing activity against SARS-CoV-2 viral variants‏
670 ‎‡a  Author's Clinical outcomes of patients with and without HIV hospitalized with COVID-19 in England during the early stages of the pandemic: a matched retrospective multi-centre analysis (RECEDE-C19 study)‏
670 ‎‡a  Author's Combined HIV Adolescent Prevention Study (CHAPS): comparison of HIV pre-exposure prophylaxis regimens for adolescents in sub-Saharan Africa-study protocol for a mixed-methods study including a randomised controlled trial‏
670 ‎‡a  Author's Early intervention with 3BNC117 and romidepsin at antiretroviral treatment initiation in people with HIV-1: a phase 1b/2a, randomized trial‏
670 ‎‡a  Author's Epigenetic scars of CD8<sup>+</sup> T cell exhaustion persist after cure of chronic infection in humans‏
670 ‎‡a  Author's Follicle‐stimulating hormone in postmenopausal women living with HIV: a prevalence study‏
670 ‎‡a  Author's Genetic Variants of Are Major Determinants of Kidney Failure in People of African Ancestry With HIV‏
670 ‎‡a  Author's GSTM1 Copy Number and Kidney Disease in People With HIV‏
670 ‎‡a  Author's Impact of antiretroviral therapy in primary HIV infection on natural killer cell function and the association with viral rebound and HIV DNA following treatment interruption‏
670 ‎‡a  Author's Low rates of p24 antigen detection using a fourth-generation point of care HIV test‏
670 ‎‡a  Author's Menopausal status, age and management among women living with HIV in the UK‏
670 ‎‡a  Author's Mobilization of systemic CCL4 following HIV pre-exposure prophylaxis in young men in Africa‏
670 ‎‡a  Author's No evidence of neuronal damage as measured by neurofilament light chain in a HIV cure study utilising a kick-and-kill approach‏
670 ‎‡a  Author's Pharmacokinetic/pharmacodynamic investigation of raltegravir with or without lamivudine in the context of HIV-1 pre-exposure prophylaxis (PrEP)‏
670 ‎‡a  Author's Pre-Clinical Evaluation of Tenofovir and Tenofovir Alafenamide for HIV-1 Pre-Exposure Prophylaxis in Foreskin Tissue‏
670 ‎‡a  Author's Pre-exposure Prophylaxis for HIV Prevention: Why, What, Who and How‏
670 ‎‡a  Author's Prevalence of HIV/hepatitis B and HIV/hepatitis C coinfection among people of East, South, Central and West African ancestry in the United Kingdom‏
670 ‎‡a  Author's Proteomic Analysis of Mucosal and Systemic Responses to SARS-CoV-2 Antigen‏
670 ‎‡a  Author's Re-valuation of annual cytology using HPV self-sampling to upgrade prevention (REACH UP): A feasibility study in women living with HIV in the UK‏
670 ‎‡a  Author's Response to 'The use of tenofovir in patients with COVID-19'‏
670 ‎‡a  Author's Self-start HIV postexposure prophylaxis (PEPSE), to reduce time to first dose and increase efficacy‏
670 ‎‡a  Author's Symptoms of post-traumatic stress and associations with sexual behaviour and PrEP preferences among young people in South Africa, Uganda and Zimbabwe‏
670 ‎‡a  Author's Tenofovir Disoproxil Fumarate Fails to Prevent HIV Acquisition or the Establishment of a Viral Reservoir: Two Case Reports‏
670 ‎‡a  Author's The effect of Omicron breakthrough infection and extended BNT162b2 booster dosing on neutralization breadth against SARS-CoV-2 variants of concern‏
670 ‎‡a  Author's The epidemiology of kidney disease in people of African ancestry with HIV in the UK‏
670 ‎‡a  Author's The potential effect of pre-exposure prophylaxis (PrEP) roll-out on sexual-risk behaviour among adolescents and young people in East and southern Africa‏
670 ‎‡a  Author's The RIO trial: rationale, design, and the role of community involvement in a randomised placebo-controlled trial of antiretroviral therapy plus dual long-acting HIV-specific broadly neutralising antibodies (bNAbs) in participants diagnosed with recen‏
670 ‎‡a  Author's The risks associated with stopping injectable antiretroviral treatment in women who are trying to conceive: a case series‏
670 ‎‡a  Author's UK guideline for the use of HIV post‐exposure prophylaxis 2021‏
909 ‎‡a  (orcid) 0000000205838019‏ ‎‡9  1‏
912 ‎‡a  artikullshkencor1botuarnevitin‏ ‎‡A  artikull shkencor i botuar në vitin 2023‏ ‎‡9  2‏
919 ‎‡a  briefreportpharmacokineticpharmacodynamicinvestigationofsingledoseoralmaravirocinthecontextofhiv1preexposureprophylaxis‏ ‎‡A  Brief Report: Pharmacokinetic/Pharmacodynamic Investigation of Single-Dose Oral Maraviroc in the Context of HIV-1 Pre-exposure Prophylaxis‏ ‎‡9  1‏
919 ‎‡a  broadlyneutralizingantibodyresponsesinthelongitudinalprimaryhiv1infectionshortpulseantiretroviraltherapyatseroconversioncohort‏ ‎‡A  Broadly neutralizing antibody responses in the longitudinal primary HIV-1 infection Short Pulse Anti-Retroviral Therapy at Seroconversion cohort‏ ‎‡9  1‏
919 ‎‡a  cd32expressingdoubletsinhivinfectedgutassociatedlymphoidtissueareassociatedwithatfollicularhelpercellphenotype‏ ‎‡A  CD32 expressing doublets in HIV-infected gut-associated lymphoid tissue are associated with a T follicular helper cell phenotype‏ ‎‡9  1‏
919 ‎‡a  bonemineraldensitykidneyfunctionandparticipantreportedoutcomemeasuresinwomenwhoswitchfromtenofovirdisoproxilemtricitabineandanonnucleosidereversetranscriptaseinhibitortoabacavirlamivudineanddolutegravir‏ ‎‡A  Bone mineral density, kidney function and participant‐reported outcome measures in women who switch from tenofovir disoproxil emtricitabine and a nonnucleoside reverse transcriptase inhibitor to abacavir, lamivudine and dolutegravir‏ ‎‡9  1‏
919 ‎‡a  chadox1ncov19vaccineelicitsmonoclonalantibodieswithcrossneutralizingactivityagainstsarscov2viralvariants‏ ‎‡A  ChAdOx1 nCoV-19 vaccine elicits monoclonal antibodies with cross-neutralizing activity against SARS-CoV-2 viral variants‏ ‎‡9  1‏
919 ‎‡a  clinicaloutcomesofpatientswithandwithouthivhospitalizedwithcovid19inenglandduringtheearlystagesofthepandemicamatchedretrospectivemulticentreanalysisrecedec19study‏ ‎‡A  Clinical outcomes of patients with and without HIV hospitalized with COVID-19 in England during the early stages of the pandemic: a matched retrospective multi-centre analysis (RECEDE-C19 study)‏ ‎‡9  1‏
919 ‎‡a  analyticaladvancesintheexvivochallengeefficacyassay‏ ‎‡A  Analytical Advances in the Ex Vivo Challenge Efficacy Assay‏ ‎‡9  1‏
919 ‎‡a  administrationofbroadlyneutralizingantihiv1antibodiesatartinitiationmaintainslongtermcd8+tcellimmunity‏ ‎‡A  Administration of broadly neutralizing anti-HIV-1 antibodies at ART initiation maintains long-term CD8+ T cell immunity‏ ‎‡9  1‏
919 ‎‡a  multicountrycrosssectionalstudytoassesspredictorsofdailyversusondemandoralpreexposureprophylaxisinyouthfromsouthafricaugandaandzimbabwe‏ ‎‡A  A multi-country cross-sectional study to assess predictors of daily versus on-demand oral pre-exposure prophylaxis in youth from South Africa, Uganda and Zimbabwe‏ ‎‡9  1‏
919 ‎‡a  combinedhivadolescentpreventionstudychapscomparisonofhivpreexposureprophylaxisregimensforadolescentsinsubsaharanafricastudyprotocolforamixedmethodsstudyincludingarandomisedcontrolledtrial‏ ‎‡A  Combined HIV Adolescent Prevention Study (CHAPS): comparison of HIV pre-exposure prophylaxis regimens for adolescents in sub-Saharan Africa-study protocol for a mixed-methods study including a randomised controlled trial‏ ‎‡9  1‏
919 ‎‡a  earlyinterventionwith3bnc117andromidepsinatantiretroviraltreatmentinitiationinpeoplewithhiv1aphase1b2arandomizedtrial‏ ‎‡A  Early intervention with 3BNC117 and romidepsin at antiretroviral treatment initiation in people with HIV-1: a phase 1b/2a, randomized trial‏ ‎‡9  1‏
919 ‎‡a  epigeneticscarsofcd8sup+suptcellexhaustionpersistaftercureofchronicinfectioninhumans‏ ‎‡A  Epigenetic scars of CD8<sup>+</sup> T cell exhaustion persist after cure of chronic infection in humans‏ ‎‡9  1‏
919 ‎‡a  folliclestimulatinghormoneinpostmenopausalwomenlivingwithhivaprevalencestudy‏ ‎‡A  Follicle‐stimulating hormone in postmenopausal women living with HIV: a prevalence study‏ ‎‡9  1‏
919 ‎‡a  geneticvariantsofaremajordeterminantsofkidneyfailureinpeopleofafricanancestrywithhiv‏ ‎‡A  Genetic Variants of Are Major Determinants of Kidney Failure in People of African Ancestry With HIV‏ ‎‡9  1‏
919 ‎‡a  gstm1copynumberandkidneydiseaseinpeoplewithhiv‏ ‎‡A  GSTM1 Copy Number and Kidney Disease in People With HIV‏ ‎‡9  1‏
919 ‎‡a  impactofantiretroviraltherapyinprimaryhivinfectiononnaturalkillercellfunctionandtheassociationwithviralreboundandhivdnafollowingtreatmentinterruption‏ ‎‡A  Impact of antiretroviral therapy in primary HIV infection on natural killer cell function and the association with viral rebound and HIV DNA following treatment interruption‏ ‎‡9  1‏
919 ‎‡a  lowratesofp24antigendetectionusinga4generationpointofcarehivtest‏ ‎‡A  Low rates of p24 antigen detection using a fourth-generation point of care HIV test‏ ‎‡9  1‏
919 ‎‡a  menopausalstatusageandmanagementamongwomenlivingwithhivintheuk‏ ‎‡A  Menopausal status, age and management among women living with HIV in the UK‏ ‎‡9  1‏
919 ‎‡a  mobilizationofsystemicccl4followinghivpreexposureprophylaxisinyoungmeninafrica‏ ‎‡A  Mobilization of systemic CCL4 following HIV pre-exposure prophylaxis in young men in Africa‏ ‎‡9  1‏
919 ‎‡a  noevidenceofneuronaldamageasmeasuredbyneurofilamentlightchaininahivcurestudyutilisingakickandkillapproach‏ ‎‡A  No evidence of neuronal damage as measured by neurofilament light chain in a HIV cure study utilising a kick-and-kill approach‏ ‎‡9  1‏
919 ‎‡a  pharmacokineticpharmacodynamicinvestigationofraltegravirwithorwithoutlamivudineinthecontextofhiv1preexposureprophylaxisprep‏ ‎‡A  Pharmacokinetic/pharmacodynamic investigation of raltegravir with or without lamivudine in the context of HIV-1 pre-exposure prophylaxis (PrEP)‏ ‎‡9  1‏
919 ‎‡a  preclinicalevaluationoftenofovirandtenofoviralafenamideforhiv1preexposureprophylaxisinforeskintissue‏ ‎‡A  Pre-Clinical Evaluation of Tenofovir and Tenofovir Alafenamide for HIV-1 Pre-Exposure Prophylaxis in Foreskin Tissue‏ ‎‡9  1‏
919 ‎‡a  preexposureprophylaxisforhivpreventionwhywhatwhoandhow‏ ‎‡A  Pre-exposure Prophylaxis for HIV Prevention: Why, What, Who and How‏ ‎‡9  1‏
919 ‎‡a  prevalenceofhivhepatitisbandhivhepatitis100coinfectionamongpeopleofeastsouthcentralandwestafricanancestryintheunitedkingdom‏ ‎‡A  Prevalence of HIV/hepatitis B and HIV/hepatitis C coinfection among people of East, South, Central and West African ancestry in the United Kingdom‏ ‎‡9  1‏
919 ‎‡a  proteomicanalysisofmucosalandsystemicresponsestosarscov2antigen‏ ‎‡A  Proteomic Analysis of Mucosal and Systemic Responses to SARS-CoV-2 Antigen‏ ‎‡9  1‏
919 ‎‡a  revaluationofannualcytologyusinghpvselfsamplingtoupgradepreventionreachupafeasibilitystudyinwomenlivingwithhivintheuk‏ ‎‡A  Re-valuation of annual cytology using HPV self-sampling to upgrade prevention (REACH UP): A feasibility study in women living with HIV in the UK‏ ‎‡9  1‏
919 ‎‡a  responsetotheuseoftenofovirinpatientswithcovid19‏ ‎‡A  Response to 'The use of tenofovir in patients with COVID-19'‏ ‎‡9  1‏
919 ‎‡a  selfstarthivpostexposureprophylaxispepsetoreducetimeto1doseandincreaseefficacy‏ ‎‡A  Self-start HIV postexposure prophylaxis (PEPSE), to reduce time to first dose and increase efficacy‏ ‎‡9  1‏
919 ‎‡a  symptomsofposttraumaticstressandassociationswithsexualbehaviourandpreppreferencesamongyoungpeopleinsouthafricaugandaandzimbabwe‏ ‎‡A  Symptoms of post-traumatic stress and associations with sexual behaviour and PrEP preferences among young people in South Africa, Uganda and Zimbabwe‏ ‎‡9  1‏
919 ‎‡a  tenofovirdisoproxilfumaratefailstopreventhivacquisitionortheestablishmentofaviralreservoir2casereports‏ ‎‡A  Tenofovir Disoproxil Fumarate Fails to Prevent HIV Acquisition or the Establishment of a Viral Reservoir: Two Case Reports‏ ‎‡9  1‏
919 ‎‡a  effectofomicronbreakthroughinfectionandextendedbnt162b2boosterdosingonneutralizationbreadthagainstsarscov2variantsofconcern‏ ‎‡A  The effect of Omicron breakthrough infection and extended BNT162b2 booster dosing on neutralization breadth against SARS-CoV-2 variants of concern‏ ‎‡9  1‏
919 ‎‡a  epidemiologyofkidneydiseaseinpeopleofafricanancestrywithhivintheuk‏ ‎‡A  The epidemiology of kidney disease in people of African ancestry with HIV in the UK‏ ‎‡9  1‏
919 ‎‡a  potentialeffectofpreexposureprophylaxispreprolloutonsexualriskbehaviouramongadolescentsandyoungpeopleineastandsouthernafrica‏ ‎‡A  The potential effect of pre-exposure prophylaxis (PrEP) roll-out on sexual-risk behaviour among adolescents and young people in East and southern Africa‏ ‎‡9  1‏
919 ‎‡a  riotrialrationaledesignandtheroleofcommunityinvolvementinarandomisedplacebocontrolledtrialofantiretroviraltherapyplusduallongactinghivspecificbroadlyneutralisingantibodiesbnabsinparticipantsdiagnosedwithrecen‏ ‎‡A  The RIO trial: rationale, design, and the role of community involvement in a randomised placebo-controlled trial of antiretroviral therapy plus dual long-acting HIV-specific broadly neutralising antibodies (bNAbs) in participants diagnosed with recen‏ ‎‡9  1‏
919 ‎‡a  risksassociatedwithstoppinginjectableantiretroviraltreatmentinwomenwhoaretryingtoconceiveacaseseries‏ ‎‡A  The risks associated with stopping injectable antiretroviral treatment in women who are trying to conceive: a case series‏ ‎‡9  1‏
919 ‎‡a  ukguidelinefortheuseofhivpostexposureprophylaxis‏ ‎‡A  UK guideline for the use of HIV post‐exposure prophylaxis 2021‏ ‎‡9  1‏
919 ‎‡a  boostervaccinationagainstsarscov2inducespotentimmuneresponsesinpeoplewithhumanimmunodeficiencyvirus‏ ‎‡A  Booster Vaccination Against SARS-CoV-2 Induces Potent Immune Responses in People With Human Immunodeficiency Virus‏ ‎‡9  1‏
943 ‎‡a  202x‏ ‎‡A  2023‏ ‎‡9  3‏
946 ‎‡a  a‏ ‎‡9  1‏
996 ‎‡2  J9U|987012615845705171‏
996 ‎‡2  DNB|1037757327‏
996 ‎‡2  NTA|321857119‏
996 ‎‡2  SUDOC|199259208‏
996 ‎‡2  LC|n 50023154‏
996 ‎‡2  PTBNP|256349‏
996 ‎‡2  ISNI|000000007022553X‏
996 ‎‡2  LC|n 80059668‏
996 ‎‡2  BNF|12549959‏
996 ‎‡2  LC|nr 00015210‏
996 ‎‡2  LC|no2012087727‏
996 ‎‡2  ISNI|0000000079340454‏
996 ‎‡2  N6I|vtls000116020‏
996 ‎‡2  NKC|osa20241219400‏
996 ‎‡2  J9U|987007333426905171‏
996 ‎‡2  ISNI|0000000023086290‏
996 ‎‡2  LC|no2021002382‏
996 ‎‡2  LC|nb2002096753‏
996 ‎‡2  BIBSYS|1707991621223‏
996 ‎‡2  DNB|1253417563‏
996 ‎‡2  ISNI|0000000054535183‏
996 ‎‡2  N6I|vtls000114654‏
996 ‎‡2  ISNI|0000000385426838‏
996 ‎‡2  LC|nb2011010615‏
996 ‎‡2  LC|n 93082311‏
996 ‎‡2  BIBSYS|90174577‏
996 ‎‡2  CAOONL|ncf10592796‏
996 ‎‡2  NDL|00754720‏
996 ‎‡2  N6I|vtls001210191‏
996 ‎‡2  SUDOC|204248701‏
996 ‎‡2  PLWABN|9813704496505606‏
996 ‎‡2  ISNI|0000000030561715‏
996 ‎‡2  DNB|1312076682‏
996 ‎‡2  SUDOC|140770097‏
996 ‎‡2  J9U|987007373411105171‏
996 ‎‡2  LC|no2013121342‏
996 ‎‡2  J9U|987007411573405171‏
996 ‎‡2  ISNI|0000000508286688‏
996 ‎‡2  CAOONL|ncf13725133‏
996 ‎‡2  NTA|241434750‏
996 ‎‡2  SUDOC|144377071‏
996 ‎‡2  ISNI|0000000031237925‏
996 ‎‡2  LC|n 93119027‏
996 ‎‡2  LC|n 95079372‏
996 ‎‡2  J9U|987007369378705171‏
996 ‎‡2  SUDOC|256146985‏
996 ‎‡2  ISNI|0000000394683190‏
996 ‎‡2  BIBSYS|90298748‏
996 ‎‡2  BIBSYS|90680944‏
996 ‎‡2  W2Z|1707991621223‏
996 ‎‡2  LC|nb2023010106‏
996 ‎‡2  DNB|1334681635‏
996 ‎‡2  PTBNP|1809250‏
996 ‎‡2  NUKAT|n 2014195492‏
996 ‎‡2  W2Z|1707991621113‏
996 ‎‡2  LC|nb2007025411‏
996 ‎‡2  BIBSYS|1707991621113‏
996 ‎‡2  N6I|vtls002072613‏
996 ‎‡2  J9U|987007330909505171‏
996 ‎‡2  ISNI|000000003535829X‏
996 ‎‡2  LC|no2009114734‏
996 ‎‡2  LC|nb2013008819‏
996 ‎‡2  LC|no2003016902‏
996 ‎‡2  LC|no2022119778‏
996 ‎‡2  ISNI|0000000380320241‏
996 ‎‡2  CAOONL|ncf10135235‏
996 ‎‡2  LC|n 2007047910‏
996 ‎‡2  ISNI|0000000114918988‏
996 ‎‡2  NTA|074826247‏
996 ‎‡2  LC|no2017028924‏
996 ‎‡2  NUKAT|nx2023807142‏
996 ‎‡2  NTA|252131444‏
996 ‎‡2  LC|n 87948700‏
996 ‎‡2  ISNI|0000000119264290‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏