VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q50884218  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241221010720.0
008     241221nneanz||abbn n and d
035 ‎‡a  (WKP)Q50884218‏
024 ‎‡a  0000-0002-5813-332X‏ ‎‡2  orcid‏
024 ‎‡a  7006188042‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q50884218‏
100 0 ‎‡a  Ângela Maria Moraes‏ ‎‡9  ast‏ ‎‡9  es‏ ‎‡9  sl‏
375 ‎‡a  2‏ ‎‡2  iso5218‏
400 0 ‎‡a  Ângela Maria Moraes‏ ‎‡c  researcher‏ ‎‡9  en‏
400 0 ‎‡a  Ângela Maria Moraes‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's Advances in the Use of Supercritical Fluids for the Production of Poly‏
670 ‎‡a  Author's Advances in the Use of Supercritical Fluids for the Production of Poly(α-hydroxyester) Particles Incorporating Bioactive Agents‏
670 ‎‡a  Author's Analysis of process parameters on the characteristics of liposomes prepared by ethanol injection with a view to process scale-up: Effect of temperature and batch volume‏
670 ‎‡a  Author's Analysis of the performance of polysaccharide membranes in aqueous media as a tool to assist wound-dressing selection‏
670 ‎‡a  Author's Antibacterial and non-cytotoxic ultra-thin polyethylenimine film.‏
670 ‎‡a  Author's Avaliação do potencial antioxidante de extratos ativos de plantas obtidos por extração com fluido supercrítico‏
670 ‎‡a  Author's Behavior of wild-type and transfected S2 cells cultured in two different media.‏
670 ‎‡a  Author's BIOMATERIALS: TYPES, APPLICATIONS, AND MARKET‏
670 ‎‡a  Author's Characterization of chitosan and polycaprolactone membranes designed for wound repair application‏
670 ‎‡a  Author's Characterization of coatings for open-heart surgery tubing with heparin and lipid.‏
670 ‎‡a  Author's Chitosan-alginate membranes accelerate wound healing.‏
670 ‎‡a  Author's Coated electrospun bioactive wound dressings: Mechanical properties and ability to control lesion microenvironment‏
670 ‎‡a  Author's Combining xanthan and chitosan membranes to multipotent mesenchymal stromal cells as bioactive dressings for dermo-epidermal wounds.‏
670 ‎‡a  Author's Comparative study on complexes formed by chitosan and different polyanions: Potential of chitosan-pectin biomaterials as scaffolds in tissue engineering‏
670 ‎‡a  Author's Comparison of the properties of compacted and porous lamellar chitosan-xanthan membranes as dressings and scaffolds for the treatment of skin lesions‏
670 ‎‡a  Author's Comparison of the properties of membranes produced with alginate and chitosan from mushroom and from shrimp.‏
670 ‎‡a  Author's Composite membranes of alginate and chitosan reinforced with cotton or linen fibers incorporating epidermal growth factor.‏
670 ‎‡a  Author's Control of the properties of porous chitosan-alginate membranes through the addition of different proportions of Pluronic F68.‏
670 ‎‡a  Author's Culture of transgenic Drosophila melanogaster Schneider 2 cells in serum-free media based on TC100 basal medium‏
670 ‎‡a  Author's Development of polysaccharide-based membranes incorporating the bioactive compound aloin‏
670 ‎‡a  Author's Development of porous lamellar chitosan-alginate membranes: Effect of different surfactants on biomaterial properties‏
670 ‎‡a  Author's Differentiation of dental pulp stem cells into chondrocytes upon culture on porous chitosan-xanthan scaffolds in the presence of kartogenin‏
670 ‎‡a  Author's Dispersion and release of embelin from electrospun, biodegradable, polymeric membranes‏
670 ‎‡a  Author's Drosophila melanogaster S2 cells for expression of heterologous genes: From gene cloning to bioprocess development‏
670 ‎‡a  Author's Effects of chitosan solution concentration and incorporation of chitin and glycerol on dense chitosan membrane properties‏
670 ‎‡a  Author's Effects of different sterilization methods on the morphology, mechanical properties, and cytotoxicity of chitosan membranes used as wound dressings‏
670 ‎‡a  Author's Effects of Electrospun Fibrous Membranes of PolyCaprolactone and Chitosan/Poly(Ethylene Oxide) on Mouse Acute Skin Lesions‏
670 ‎‡a  Author's Effects of supercritical carbon dioxide processing on the properties of chitosan–alginate membranes‏
670 ‎‡a  Author's Electrospun multilayer chitosan scaffolds as potential wound dressings for skin lesions‏
670 ‎‡a  Author's Encapsulamento do 5-fluorouracil em lipossomas para administração tópica‏
670 ‎‡a  Author's Enhancement of cellular activity in hyperglycemic mice dermal wounds dressed with chitosan-alginate membranes‏
670 ‎‡a  Author's Enhancement of Sf9 Cells and Baculovirus Production Employing Grace's Medium Supplemented with Milk Whey Ultrafiltrate.‏
670 ‎‡a  Author's Evaluation of concentrated milk whey as a supplement for SF9 Spodoptera frugiperda cells in culture‏
670 ‎‡a  Author's Evaluation of in vitro anti-inflammatory effects of crude ginger and rosemary extracts obtained through supercritical CO2 extraction on macrophage and tumor cell line: the influence of vehicle type‏
670 ‎‡a  Author's Formation of PLA particles incorporating 17α-methyltestosterone by supercritical fluid technology‏
670 ‎‡a  Author's Formulation of a protein-free medium based on IPL-41 for the sustained growth of Drosophila melanogaster S2 cells.‏
670 ‎‡a  Author's Growth of recombinant Drosophila melanogaster Schneider 2 cells producing rabies virus glycoprotein in bioreactor employing serum-free medium‏
670 ‎‡a  Author's Hyaluronan/chitosan nanofilms assembled layer-by-layer and their antibacterial effect: A study using Staphylococcus aureus and Pseudomonas aeruginosa.‏
670 ‎‡a  Author's Improvement of the mechanical properties of chitosan-alginate wound dressings containing silver through the addition of a biocompatible silicone rubber‏
670 ‎‡a  Author's INCORPORATION AND RELEASE KINETICS OF ALPHA-BISABOLOL FROM PCL AND CHITOSAN/GUAR GUM MEMBRANES‏
670 ‎‡a  Author's Influence of a triazine derivative-based biocide on microbial biofilms of cutting fluids in contact with different substrates‏
670 ‎‡a  Author's Influence of culture conditions on recombinant Drosophila melanogaster S2 cells producing rabies virus glycoprotein cultivated in serum-free medium‏
670 ‎‡a  Author's Influence of the incorporation of the antimicrobial agent polyhexamethylene biguanide on the properties of dense and porous chitosan-alginate membranes‏
670 ‎‡a  Author's Kanamycin incorporation in lipid vesicles prepared by ethanol injection designed for tuberculosis treatment‏
670 ‎‡a  Author's Kinetic response of a Drosophila melanogaster cell line to different medium formulations and culture conditions.‏
670 ‎‡a  Author's Mechanically-enhanced polysaccharide-based scaffolds for tissue engineering of soft tissues‏
670 ‎‡a  Author's Nomenclature and guideline to express the amount of a membrane protein synthesized in animal cells in view of bioprocess optimization and production monitoring.‏
670 ‎‡a  Author's Oral and parenteral vaccines against Flavobacterium columnare: evaluation of humoral immune response by ELISA and in vivo efficiency in Nile tilapia‏
670 ‎‡a  Author's Oral and parenteral vaccines against Flavobacterium columnare: evaluation of humoral immune response by ELISA and in vivo efficiency in Nile tilapia (Oreochromis niloticus)‏
670 ‎‡a  Author's Polysaccharide-based membranes loaded with erythromycin for application as wound dressings‏
670 ‎‡a  Author's Polysaccharide-based tissue-engineered vascular patches‏
670 ‎‡a  Author's Preparation and characterization of liposomal systems entrapping the boronated compound o-carboranylpropylamine.‏
670 ‎‡a  Author's Properties of films obtained from biopolymers of different origins for skin lesions therapy‏
670 ‎‡a  Author's Properties of PLA/PCL particles as vehicles for oral delivery of the androgen hormone 17α-methyltestosterone‏
670 ‎‡a  Author's Study of the swelling and stability properties of chitosan-xanthan membranes‏
670 ‎‡a  Author's Supercritical fluid extraction of lycopene from tomato juice and characterization of its antioxidation activity‏
670 ‎‡a  Author's Terapia celular combinada com membranas de biopolímeros melhora a cicatrização de úlceras em paciente com dermatomiosite juvenil‏
670 ‎‡a  Author's The influence of preparation conditions on the characteristics of chitosan-alginate dressings for skin lesions‏
670 ‎‡a  Author's Towards wound dressings with improved properties: Effects of poly‏
670 ‎‡a  Author's Towards wound dressings with improved properties: Effects of poly(dimethylsiloxane) on chitosan-alginate films loaded with thymol and beta-carotene‏
670 ‎‡a  Author's Tuning the properties of alginate-chitosan membranes by varying the viscosity and the proportions of polymers‏
670 ‎‡a  Author's Use of chitosan membrane associated with polypropylene mesh to prevent peritoneal adhesion in rats‏
670 ‎‡a  Author's Waterborne microorganisms and biofilms related to hospital infections: strategies for prevention and control in healthcare facilities‏
909 ‎‡a  (orcid) 000000025813332x‏ ‎‡9  1‏
909 ‎‡a  (scopus) 7006188042‏ ‎‡9  1‏
919 ‎‡a  encapsulamentodo5fluorouracilemlipossomasparaadministracaotopica‏ ‎‡A  Encapsulamento do 5-fluorouracil em lipossomas para administração tópica‏ ‎‡9  1‏
919 ‎‡a  enhancementofcellularactivityinhyperglycemicmicedermalwoundsdressedwithchitosanalginatemembranes‏ ‎‡A  Enhancement of cellular activity in hyperglycemic mice dermal wounds dressed with chitosan-alginate membranes‏ ‎‡9  1‏
919 ‎‡a  enhancementofsf9cellsandbaculovirusproductionemployinggracesmediumsupplementedwithmilkwheyultrafiltrate‏ ‎‡A  Enhancement of Sf9 Cells and Baculovirus Production Employing Grace's Medium Supplemented with Milk Whey Ultrafiltrate.‏ ‎‡9  1‏
919 ‎‡a  evaluationofconcentratedmilkwheyasasupplementforsf9spodopterafrugiperdacellsinculture‏ ‎‡A  Evaluation of concentrated milk whey as a supplement for SF9 Spodoptera frugiperda cells in culture‏ ‎‡9  1‏
919 ‎‡a  oralandparenteralvaccinesagainstflavobacteriumcolumnareevaluationofhumoralimmuneresponsebyelisaandinvivoefficiencyinniletilapia‏ ‎‡A  Oral and parenteral vaccines against Flavobacterium columnare: evaluation of humoral immune response by ELISA and in vivo efficiency in Nile tilapia‏ ‎‡9  1‏
919 ‎‡a  nomenclatureandguidelinetoexpresstheamountofamembraneproteinsynthesizedinanimalcellsinviewofbioprocessoptimizationandproductionmonitoring‏ ‎‡A  Nomenclature and guideline to express the amount of a membrane protein synthesized in animal cells in view of bioprocess optimization and production monitoring.‏ ‎‡9  1‏
919 ‎‡a  mechanicallyenhancedpolysaccharidebasedscaffoldsfortissueengineeringofsofttissues‏ ‎‡A  Mechanically-enhanced polysaccharide-based scaffolds for tissue engineering of soft tissues‏ ‎‡9  1‏
919 ‎‡a  kineticresponseofadrosophilamelanogastercelllinetodifferentmediumformulationsandcultureconditions‏ ‎‡A  Kinetic response of a Drosophila melanogaster cell line to different medium formulations and culture conditions.‏ ‎‡9  1‏
919 ‎‡a  kanamycinincorporationinlipidvesiclespreparedbyethanolinjectiondesignedfortuberculosistreatment‏ ‎‡A  Kanamycin incorporation in lipid vesicles prepared by ethanol injection designed for tuberculosis treatment‏ ‎‡9  1‏
919 ‎‡a  influenceoftheincorporationoftheantimicrobialagentpolyhexamethylenebiguanideonthepropertiesofdenseandporouschitosanalginatemembranes‏ ‎‡A  Influence of the incorporation of the antimicrobial agent polyhexamethylene biguanide on the properties of dense and porous chitosan-alginate membranes‏ ‎‡9  1‏
919 ‎‡a  influenceofcultureconditionsonrecombinantdrosophilamelanogasters2cellsproducingrabiesvirusglycoproteincultivatedinserumfreemedium‏ ‎‡A  Influence of culture conditions on recombinant Drosophila melanogaster S2 cells producing rabies virus glycoprotein cultivated in serum-free medium‏ ‎‡9  1‏
919 ‎‡a  evaluationofinvitroantiinflammatoryeffectsofcrudegingerandrosemaryextractsobtainedthroughsupercriticalco2extractiononmacrophageandtumorcelllinetheinfluenceofvehicletype‏ ‎‡A  Evaluation of in vitro anti-inflammatory effects of crude ginger and rosemary extracts obtained through supercritical CO2 extraction on macrophage and tumor cell line: the influence of vehicle type‏ ‎‡9  1‏
919 ‎‡a  formationofplaparticlesincorporating17αmethyltestosteronebysupercriticalfluidtechnology‏ ‎‡A  Formation of PLA particles incorporating 17α-methyltestosterone by supercritical fluid technology‏ ‎‡9  1‏
919 ‎‡a  formulationofaproteinfreemediumbasedonipl41forthesustainedgrowthofdrosophilamelanogasters2cells‏ ‎‡A  Formulation of a protein-free medium based on IPL-41 for the sustained growth of Drosophila melanogaster S2 cells.‏ ‎‡9  1‏
919 ‎‡a  growthofrecombinantdrosophilamelanogasterschneider2cellsproducingrabiesvirusglycoproteininbioreactoremployingserumfreemedium‏ ‎‡A  Growth of recombinant Drosophila melanogaster Schneider 2 cells producing rabies virus glycoprotein in bioreactor employing serum-free medium‏ ‎‡9  1‏
919 ‎‡a  hyaluronanchitosannanofilmsassembledlayerbylayerandtheirantibacterialeffectastudyusingstaphylococcusaureusandpseudomonasaeruginosa‏ ‎‡A  Hyaluronan/chitosan nanofilms assembled layer-by-layer and their antibacterial effect: A study using Staphylococcus aureus and Pseudomonas aeruginosa.‏ ‎‡9  1‏
919 ‎‡a  improvementofthemechanicalpropertiesofchitosanalginatewounddressingscontainingsilverthroughtheadditionofabiocompatiblesiliconerubber‏ ‎‡A  Improvement of the mechanical properties of chitosan-alginate wound dressings containing silver through the addition of a biocompatible silicone rubber‏ ‎‡9  1‏
919 ‎‡a  influenceofatriazinederivativebasedbiocideonmicrobialbiofilmsofcuttingfluidsincontactwithdifferentsubstrates‏ ‎‡A  Influence of a triazine derivative-based biocide on microbial biofilms of cutting fluids in contact with different substrates‏ ‎‡9  1‏
919 ‎‡a  incorporationandreleasekineticsofalphabisabololfrompclandchitosanguargummembranes‏ ‎‡A  INCORPORATION AND RELEASE KINETICS OF ALPHA-BISABOLOL FROM PCL AND CHITOSAN/GUAR GUM MEMBRANES‏ ‎‡9  1‏
919 ‎‡a  advancesintheuseofsupercriticalfluidsfortheproductionofpoly‏ ‎‡A  Advances in the Use of Supercritical Fluids for the Production of Poly‏ ‎‡9  1‏
919 ‎‡a  advancesintheuseofsupercriticalfluidsfortheproductionofpolyαhydroxyesterparticlesincorporatingbioactiveagents‏ ‎‡A  Advances in the Use of Supercritical Fluids for the Production of Poly(α-hydroxyester) Particles Incorporating Bioactive Agents‏ ‎‡9  1‏
919 ‎‡a  analysisofprocessparametersonthecharacteristicsofliposomespreparedbyethanolinjectionwithaviewtoprocessscaleupeffectoftemperatureandbatchvolume‏ ‎‡A  Analysis of process parameters on the characteristics of liposomes prepared by ethanol injection with a view to process scale-up: Effect of temperature and batch volume‏ ‎‡9  1‏
919 ‎‡a  analysisoftheperformanceofpolysaccharidemembranesinaqueousmediaasatooltoassistwounddressingselection‏ ‎‡A  Analysis of the performance of polysaccharide membranes in aqueous media as a tool to assist wound-dressing selection‏ ‎‡9  1‏
919 ‎‡a  antibacterialandnoncytotoxicultrathinpolyethyleniminefilm‏ ‎‡A  Antibacterial and non-cytotoxic ultra-thin polyethylenimine film.‏ ‎‡9  1‏
919 ‎‡a  avaliacaodopotencialantioxidantedeextratosativosdeplantasobtidosporextracaocomfluidosupercritico‏ ‎‡A  Avaliação do potencial antioxidante de extratos ativos de plantas obtidos por extração com fluido supercrítico‏ ‎‡9  1‏
919 ‎‡a  behaviorofwildtypeandtransfecteds2cellsculturedin2differentmedia‏ ‎‡A  Behavior of wild-type and transfected S2 cells cultured in two different media.‏ ‎‡9  1‏
919 ‎‡a  biomaterialstypesapplicationsandmarket‏ ‎‡A  BIOMATERIALS: TYPES, APPLICATIONS, AND MARKET‏ ‎‡9  1‏
919 ‎‡a  characterizationofchitosanandpolycaprolactonemembranesdesignedforwoundrepairapplication‏ ‎‡A  Characterization of chitosan and polycaprolactone membranes designed for wound repair application‏ ‎‡9  1‏
919 ‎‡a  characterizationofcoatingsforopenheartsurgerytubingwithheparinandlipid‏ ‎‡A  Characterization of coatings for open-heart surgery tubing with heparin and lipid.‏ ‎‡9  1‏
919 ‎‡a  chitosanalginatemembranesacceleratewoundhealing‏ ‎‡A  Chitosan-alginate membranes accelerate wound healing.‏ ‎‡9  1‏
919 ‎‡a  coatedelectrospunbioactivewounddressingsmechanicalpropertiesandabilitytocontrollesionmicroenvironment‏ ‎‡A  Coated electrospun bioactive wound dressings: Mechanical properties and ability to control lesion microenvironment‏ ‎‡9  1‏
919 ‎‡a  combiningxanthanandchitosanmembranestomultipotentmesenchymalstromalcellsasbioactivedressingsfordermoepidermalwounds‏ ‎‡A  Combining xanthan and chitosan membranes to multipotent mesenchymal stromal cells as bioactive dressings for dermo-epidermal wounds.‏ ‎‡9  1‏
919 ‎‡a  comparativestudyoncomplexesformedbychitosananddifferentpolyanionspotentialofchitosanpectinbiomaterialsasscaffoldsintissueengineering‏ ‎‡A  Comparative study on complexes formed by chitosan and different polyanions: Potential of chitosan-pectin biomaterials as scaffolds in tissue engineering‏ ‎‡9  1‏
919 ‎‡a  comparisonofthepropertiesofcompactedandporouslamellarchitosanxanthanmembranesasdressingsandscaffoldsforthetreatmentofskinlesions‏ ‎‡A  Comparison of the properties of compacted and porous lamellar chitosan-xanthan membranes as dressings and scaffolds for the treatment of skin lesions‏ ‎‡9  1‏
919 ‎‡a  comparisonofthepropertiesofmembranesproducedwithalginateandchitosanfrommushroomandfromshrimp‏ ‎‡A  Comparison of the properties of membranes produced with alginate and chitosan from mushroom and from shrimp.‏ ‎‡9  1‏
919 ‎‡a  compositemembranesofalginateandchitosanreinforcedwithcottonorlinenfibersincorporatingepidermalgrowthfactor‏ ‎‡A  Composite membranes of alginate and chitosan reinforced with cotton or linen fibers incorporating epidermal growth factor.‏ ‎‡9  1‏
919 ‎‡a  waterbornemicroorganismsandbiofilmsrelatedtohospitalinfectionsstrategiesforpreventionandcontrolinhealthcarefacilities‏ ‎‡A  Waterborne microorganisms and biofilms related to hospital infections: strategies for prevention and control in healthcare facilities‏ ‎‡9  1‏
919 ‎‡a  useofchitosanmembraneassociatedwithpolypropylenemeshtopreventperitonealadhesioninrats‏ ‎‡A  Use of chitosan membrane associated with polypropylene mesh to prevent peritoneal adhesion in rats‏ ‎‡9  1‏
919 ‎‡a  tuningthepropertiesofalginatechitosanmembranesbyvaryingtheviscosityandtheproportionsofpolymers‏ ‎‡A  Tuning the properties of alginate-chitosan membranes by varying the viscosity and the proportions of polymers‏ ‎‡9  1‏
919 ‎‡a  towardswounddressingswithimprovedpropertieseffectsofpolydimethylsiloxaneonchitosanalginatefilmsloadedwiththymolandbetacarotene‏ ‎‡A  Towards wound dressings with improved properties: Effects of poly(dimethylsiloxane) on chitosan-alginate films loaded with thymol and beta-carotene‏ ‎‡9  1‏
919 ‎‡a  towardswounddressingswithimprovedpropertieseffectsofpoly‏ ‎‡A  Towards wound dressings with improved properties: Effects of poly‏ ‎‡9  1‏
919 ‎‡a  influenceofpreparationconditionsonthecharacteristicsofchitosanalginatedressingsforskinlesions‏ ‎‡A  The influence of preparation conditions on the characteristics of chitosan-alginate dressings for skin lesions‏ ‎‡9  1‏
919 ‎‡a  terapiacelularcombinadacommembranasdebiopolimerosmelhoraacicatrizacaodeulcerasempacientecomdermatomiositejuvenil‏ ‎‡A  Terapia celular combinada com membranas de biopolímeros melhora a cicatrização de úlceras em paciente com dermatomiosite juvenil‏ ‎‡9  1‏
919 ‎‡a  supercriticalfluidextractionoflycopenefromtomatojuiceandcharacterizationofitsantioxidationactivity‏ ‎‡A  Supercritical fluid extraction of lycopene from tomato juice and characterization of its antioxidation activity‏ ‎‡9  1‏
919 ‎‡a  controlofthepropertiesofporouschitosanalginatemembranesthroughtheadditionofdifferentproportionsofpluronicf68‏ ‎‡A  Control of the properties of porous chitosan-alginate membranes through the addition of different proportions of Pluronic F68.‏ ‎‡9  1‏
919 ‎‡a  cultureoftransgenicdrosophilamelanogasterschneider2cellsinserumfreemediabasedontc100basalmedium‏ ‎‡A  Culture of transgenic Drosophila melanogaster Schneider 2 cells in serum-free media based on TC100 basal medium‏ ‎‡9  1‏
919 ‎‡a  developmentofpolysaccharidebasedmembranesincorporatingthebioactivecompoundaloin‏ ‎‡A  Development of polysaccharide-based membranes incorporating the bioactive compound aloin‏ ‎‡9  1‏
919 ‎‡a  developmentofporouslamellarchitosanalginatemembraneseffectofdifferentsurfactantsonbiomaterialproperties‏ ‎‡A  Development of porous lamellar chitosan-alginate membranes: Effect of different surfactants on biomaterial properties‏ ‎‡9  1‏
919 ‎‡a  differentiationofdentalpulpstemcellsintochondrocytesuponcultureonporouschitosanxanthanscaffoldsinthepresenceofkartogenin‏ ‎‡A  Differentiation of dental pulp stem cells into chondrocytes upon culture on porous chitosan-xanthan scaffolds in the presence of kartogenin‏ ‎‡9  1‏
919 ‎‡a  dispersionandreleaseofembelinfromelectrospunbiodegradablepolymericmembranes‏ ‎‡A  Dispersion and release of embelin from electrospun, biodegradable, polymeric membranes‏ ‎‡9  1‏
919 ‎‡a  drosophilamelanogasters2cellsforexpressionofheterologousgenesfromgenecloningtobioprocessdevelopment‏ ‎‡A  Drosophila melanogaster S2 cells for expression of heterologous genes: From gene cloning to bioprocess development‏ ‎‡9  1‏
919 ‎‡a  effectsofchitosansolutionconcentrationandincorporationofchitinandglycerolondensechitosanmembraneproperties‏ ‎‡A  Effects of chitosan solution concentration and incorporation of chitin and glycerol on dense chitosan membrane properties‏ ‎‡9  1‏
919 ‎‡a  effectsofdifferentsterilizationmethodsonthemorphologymechanicalpropertiesandcytotoxicityofchitosanmembranesusedaswounddressings‏ ‎‡A  Effects of different sterilization methods on the morphology, mechanical properties, and cytotoxicity of chitosan membranes used as wound dressings‏ ‎‡9  1‏
919 ‎‡a  effectsofelectrospunfibrousmembranesofpolycaprolactoneandchitosanpolyethyleneoxideonmouseacuteskinlesions‏ ‎‡A  Effects of Electrospun Fibrous Membranes of PolyCaprolactone and Chitosan/Poly(Ethylene Oxide) on Mouse Acute Skin Lesions‏ ‎‡9  1‏
919 ‎‡a  studyoftheswellingandstabilitypropertiesofchitosanxanthanmembranes‏ ‎‡A  Study of the swelling and stability properties of chitosan-xanthan membranes‏ ‎‡9  1‏
919 ‎‡a  propertiesofplapclparticlesasvehiclesfororaldeliveryoftheandrogenhormone17αmethyltestosterone‏ ‎‡A  Properties of PLA/PCL particles as vehicles for oral delivery of the androgen hormone 17α-methyltestosterone‏ ‎‡9  1‏
919 ‎‡a  propertiesoffilmsobtainedfrombiopolymersofdifferentoriginsforskinlesionstherapy‏ ‎‡A  Properties of films obtained from biopolymers of different origins for skin lesions therapy‏ ‎‡9  1‏
919 ‎‡a  preparationandcharacterizationofliposomalsystemsentrappingtheboronatedcompoundocarboranylpropylamine‏ ‎‡A  Preparation and characterization of liposomal systems entrapping the boronated compound o-carboranylpropylamine.‏ ‎‡9  1‏
919 ‎‡a  polysaccharidebasedtissueengineeredvascularpatches‏ ‎‡A  Polysaccharide-based tissue-engineered vascular patches‏ ‎‡9  1‏
919 ‎‡a  polysaccharidebasedmembranesloadedwitherythromycinforapplicationaswounddressings‏ ‎‡A  Polysaccharide-based membranes loaded with erythromycin for application as wound dressings‏ ‎‡9  1‏
919 ‎‡a  oralandparenteralvaccinesagainstflavobacteriumcolumnareevaluationofhumoralimmuneresponsebyelisaandinvivoefficiencyinniletilapiaoreochromisniloticus‏ ‎‡A  Oral and parenteral vaccines against Flavobacterium columnare: evaluation of humoral immune response by ELISA and in vivo efficiency in Nile tilapia (Oreochromis niloticus)‏ ‎‡9  1‏
919 ‎‡a  effectsofsupercriticalcarbondioxideprocessingonthepropertiesofchitosanalginatemembranes‏ ‎‡A  Effects of supercritical carbon dioxide processing on the properties of chitosan–alginate membranes‏ ‎‡9  1‏
919 ‎‡a  electrospunmultilayerchitosanscaffoldsaspotentialwounddressingsforskinlesions‏ ‎‡A  Electrospun multilayer chitosan scaffolds as potential wound dressings for skin lesions‏ ‎‡9  1‏
946 ‎‡a  a‏ ‎‡9  1‏
996 ‎‡2  LC|no2008017879
996 ‎‡2  LIH|LNB:C_v_X_z_;=C_b_
996 ‎‡2  PTBNP|1626465
996 ‎‡2  CAOONL|ncf10897986
996 ‎‡2  ISNI|0000000083897976
996 ‎‡2  BLBNB|000300256
996 ‎‡2  BNF|14208436
996 ‎‡2  ISNI|000000050047457X
996 ‎‡2  ISNI|0000000451775228
996 ‎‡2  B2Q|0000910313
996 ‎‡2  BNE|XX994048
996 ‎‡2  DNB|135321433
996 ‎‡2  ISNI|0000000067459458
996 ‎‡2  BLBNB|001413179
996 ‎‡2  ISNI|0000000081184358
996 ‎‡2  SUDOC|149190409
996 ‎‡2  PTBNP|1153299
996 ‎‡2  ARBABN|000054756
996 ‎‡2  LC|n 2021250260
996 ‎‡2  LC|no2019082329
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏