VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q56246784  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241221010723.0
008     241221nneanz||abbn n and d
035 ‎‡a  (WKP)Q56246784‏
024 ‎‡a  0000-0001-8383-3240‏ ‎‡2  orcid‏
024 ‎‡a  35414925100‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q56246784‏
046 ‎‡s  19010000‏
100 0 ‎‡a  Joseph Paul Robinson‏ ‎‡9  sl‏ ‎‡9  es‏ ‎‡9  ast‏
375 ‎‡a  1‏ ‎‡2  iso5218‏
400 0 ‎‡a  J. Paul Robinson‏ ‎‡c  biomedical engineer‏ ‎‡9  en‏
400 0 ‎‡a  Joseph Paul Robinson‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's 3-Methylindole-induced splenotoxicity: biochemical mechanisms of cytotoxicity‏
670 ‎‡a  Author's 3-Methylindole-induced splenotoxicity: functional analysis of immune parameters and lymphocyte phenotyping by flow cytometry.‏
670 ‎‡a  Author's 3-Methylindole-induced splenotoxicity: Functional analysis of immune parameters and lymphocyte phenotyping by flow cytometry*1‏
670 ‎‡a  Author's A cellular Trojan Horse for delivery of therapeutic nanoparticles into tumors.‏
670 ‎‡a  Author's A Machine-Learning Approach to Detecting Unknown Bacterial Serovars.‏
670 ‎‡a  Author's A novel and simple cell-based detection system with a collagen-encapsulated B-lymphocyte cell line as a biosensor for rapid detection of pathogens and toxins.‏
670 ‎‡a  Author's A statistical modeling approach to computer-aided quantification of dental biofilm‏
670 ‎‡a  Author's AccessScope project: Accessible light microscope for users with upper limb mobility or visual impairments.‏
670 ‎‡a  Author's Acrolein-induced cell death in PC12 cells: role of mitochondria-mediated oxidative stress.‏
670 ‎‡a  Author's Adaptive image-processing technique and effective visualization of confocal microscopy images.‏
670 ‎‡a  Author's Adsorption of avidin on microfabricated surfaces for protein biochip applications.‏
670 ‎‡a  Author's AFM/CLSM data visualization and comparison using an open-source toolkit‏
670 ‎‡a  Author's Alternatives to current flow cytometry data analysis for clinical and research studies‏
670 ‎‡a  Author's An excitation wavelength-scanning spectral imaging system for preclinical imaging.‏
670 ‎‡a  Author's An innovation in flow cytometry data collection and analysis producing a correlated multiple sample analysis in a single file.‏
670 ‎‡a  Author's Analysis of time-resolved scattering from macroscale bacterial colonies.‏
670 ‎‡a  Author's Application of flow cytometry for biomarker-based cervical cancer cells detection.‏
670 ‎‡a  Author's Application of wavelet denoising to improve compression efficiency while preserving integrity of digital micrographs.‏
670 ‎‡a  Author's Automated classification of bacterial particles in flow by multiangle scatter measurement and support vector machine classifier.‏
670 ‎‡a  Author's Bacteria-mediated delivery of nanoparticles and cargo into cells‏
670 ‎‡a  Author's BiofilmQuant: a computer-assisted tool for dental biofilm quantification‏
670 ‎‡a  Author's Biophysical modeling of forward scattering from bacterial colonies using scalar diffraction theory.‏
670 ‎‡a  Author's Classification of bacterial contamination using image processing and distributed computing.‏
670 ‎‡a  Author's Comparative three-dimensional imaging of living neurons with confocal and atomic force microscopy.‏
670 ‎‡a  Author's Composite surface for blocking bacterial adsorption on protein biochips.‏
670 ‎‡a  Author's Compression of fluorescence microscopy images based on the signal-to-noise estimation.‏
670 ‎‡a  Author's Confocal fluorescence imaging of photosensitized DNA denaturation in cell nuclei.‏
670 ‎‡a  Author's Current status and future prospects of using advanced computer-based methods to study bacterial colonial morphology.‏
670 ‎‡a  Author's Detection of canine interleukin-2 receptors by flow cytometry.‏
670 ‎‡a  Author's Development of a multispectral light-scatter sensor for bacterial colonies.‏
670 ‎‡a  Author's Effect of basal lamina on progesterone production by chicken granulosa cells in vitro--influence of follicular development.‏
670 ‎‡a  Author's Familial occurrence of alpha 1-antitrypsin deficiency and Weber-Christian disease‏
670 ‎‡a  Author's Guidelines for the use of flow cytometry and cell sorting in immunological studies‏
670 ‎‡a  Author's Guidelines for the use of flow cytometry and cell sorting in immunological studies (second edition)‏
670 ‎‡a  Author's Hyperspectral cytometry at the single-cell level using a 32-channel photodetector.‏
670 ‎‡a  Author's Integrating cytomics and proteomics.‏
670 ‎‡a  Author's Isolation of two populations of myoblasts from porcine skeletal muscle‏
670 ‎‡a  Author's Label-free detection of multiple bacterial pathogens using light-scattering sensor.‏
670 ‎‡a  Author's Laser optical sensor, a label-free on-plate Salmonella enterica colony detection tool‏
670 ‎‡a  Author's Light-scattering sensor for real-time identification of Vibrio parahaemolyticus, Vibrio vulnificus and Vibrio cholerae colonies on solid agar plate‏
670 ‎‡a  Author's 'Living cantilever arrays' for characterization of mass of single live cells in fluids.‏
670 ‎‡a  Author's Local, three-dimensional strain measurements within largely deformed extracellular matrix constructs.‏
670 ‎‡a  Author's Measurement and analysis of angle-resolved scatter from small particles in a cylindrical microchannel.‏
670 ‎‡a  Author's Microenvironment-controlled encapsulation (MiCE) process: effects of PLGA concentration, flow rate, and collection method on microcapsule size and morphology.‏
670 ‎‡a  Author's Modeling light propagation through bacterial colonies and its correlation with forward scattering patterns‏
670 ‎‡a  Author's Mouse and human islets survive and function after coating by biosilicification‏
670 ‎‡a  Author's Optical forward-scattering for detection of Listeria monocytogenes and other Listeria species.‏
670 ‎‡a  Author's Oxidative metabolism‏
670 ‎‡a  Author's Phenotypic profiling of Raf inhibitors and mitochondrial toxicity in 3D tissue using biodynamic imaging.‏
670 ‎‡a  Author's Portable bacterial identification system based on elastic light scatter patterns.‏
670 ‎‡a  Author's Precision of light intensity measurement in biological optical microscopy.‏
670 ‎‡a  Author's Quadratic form: a robust metric for quantitative comparison of flow cytometric histograms.‏
670 ‎‡a  Author's Rapid purification of transfected porcine muscle cells‏
670 ‎‡a  Author's Reflected scatterometry for noninvasive interrogation of bacterial colonies.‏
670 ‎‡a  Author's Simultaneous mechanical loading and confocal reflection microscopy for three-dimensional microbiomechanical analysis of biomaterials and tissue constructs.‏
670 ‎‡a  Author's Single- and two-photon spectral imaging of intrinsic fluorescence of transformed human hepatocytes.‏
670 ‎‡a  Author's Spectral flow cytometry-Quo vadimus?‏
670 ‎‡a  Author's Subject classification obtained by cluster analysis and principal component analysis applied to flow cytometric data.‏
670 ‎‡a  Author's Tensile mechanical properties of three-dimensional type I collagen extracellular matrices with varied microstructure‏
670 ‎‡a  Author's The effect of intravenous immunoglobulin on the in vitro function of human neutrophils‏
670 ‎‡a  Author's The influence of exercise training on inflammatory cytokines and C-reactive protein‏
670 ‎‡a  Author's The nuclear structural protein NuMA is a negative regulator of 53BP1 in DNA double-strand break repair‏
670 ‎‡a  Author's Tunable lifetime multiplexing using luminescent nanocrystals‏
670 ‎‡a  Author's Ultrastructure and cytochemical staining characteristics of canine natural killer cells.‏
670 ‎‡a  Author's Validation of large-scale, monochromatic UV disinfection systems for drinking water using dyed microspheres.‏
670 ‎‡a  Author's Wallace H. Coulter: decades of invention and discovery.‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/NUKAT|n 2003090509‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/ISNI|0000000116216074‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/BNF|13563195‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/viaf/37082840‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/LC|n 92121862‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/SUDOC|052550591‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/LNB|LNC10-000061228‏
670 ‎‡a  wikidata site links‏ ‎‡u  https://en.wikipedia.org/wiki/Joseph_Paul_Robinson‏
909 ‎‡a  (orcid) 0000000183833240‏ ‎‡9  1‏
909 ‎‡a  (scopus) 35414925100‏ ‎‡9  1‏
912 ‎‡a  guidelinesfortheuseofflowcytometryandcellsortinginimmunologicalstudies‏ ‎‡A  Guidelines for the use of flow cytometry and cell sorting in immunological studies‏ ‎‡9  1‏
912 ‎‡a  guidelinesfortheuseofflowcytometryandcellsortinginimmunologicalstudies2edition‏ ‎‡A  Guidelines for the use of flow cytometry and cell sorting in immunological studies (second edition)‏ ‎‡9  1‏
919 ‎‡a  quadraticformarobustmetricforquantitativecomparisonofflowcytometrichistograms‏ ‎‡A  Quadratic form: a robust metric for quantitative comparison of flow cytometric histograms.‏ ‎‡9  1‏
919 ‎‡a  precisionoflightintensitymeasurementinbiologicalopticalmicroscopy‏ ‎‡A  Precision of light intensity measurement in biological optical microscopy.‏ ‎‡9  1‏
919 ‎‡a  portablebacterialidentificationsystembasedonelasticlightscatterpatterns‏ ‎‡A  Portable bacterial identification system based on elastic light scatter patterns.‏ ‎‡9  1‏
919 ‎‡a  phenotypicprofilingofrafinhibitorsandmitochondrialtoxicityin3dtissueusingbiodynamicimaging‏ ‎‡A  Phenotypic profiling of Raf inhibitors and mitochondrial toxicity in 3D tissue using biodynamic imaging.‏ ‎‡9  1‏
919 ‎‡a  oxidativemetabolism‏ ‎‡A  Oxidative metabolism‏ ‎‡9  1‏
919 ‎‡a  opticalforwardscatteringfordetectionoflisteriamonocytogenesandotherlisteriaspecies‏ ‎‡A  Optical forward-scattering for detection of Listeria monocytogenes and other Listeria species.‏ ‎‡9  1‏
919 ‎‡a  mouseandhumanisletssurviveandfunctionaftercoatingbybiosilicification‏ ‎‡A  Mouse and human islets survive and function after coating by biosilicification‏ ‎‡9  1‏
919 ‎‡a  modelinglightpropagationthroughbacterialcoloniesanditscorrelationwithforwardscatteringpatterns‏ ‎‡A  Modeling light propagation through bacterial colonies and its correlation with forward scattering patterns‏ ‎‡9  1‏
919 ‎‡a  3methylindoleinducedsplenotoxicitybiochemicalmechanismsofcytotoxicity‏ ‎‡A  3-Methylindole-induced splenotoxicity: biochemical mechanisms of cytotoxicity‏ ‎‡9  1‏
919 ‎‡a  3methylindoleinducedsplenotoxicityfunctionalanalysisofimmuneparametersandlymphocytephenotypingbyflowcytometry‏ ‎‡A  3-Methylindole-induced splenotoxicity: functional analysis of immune parameters and lymphocyte phenotyping by flow cytometry.‏ ‎‡9  1‏
919 ‎‡a  3methylindoleinducedsplenotoxicityfunctionalanalysisofimmuneparametersandlymphocytephenotypingbyflowcytometry1‏ ‎‡A  3-Methylindole-induced splenotoxicity: Functional analysis of immune parameters and lymphocyte phenotyping by flow cytometry*1‏ ‎‡9  1‏
919 ‎‡a  cellulartrojanhorsefordeliveryoftherapeuticnanoparticlesintotumors‏ ‎‡A  A cellular Trojan Horse for delivery of therapeutic nanoparticles into tumors.‏ ‎‡9  1‏
919 ‎‡a  machinelearningapproachtodetectingunknownbacterialserovars‏ ‎‡A  A Machine-Learning Approach to Detecting Unknown Bacterial Serovars.‏ ‎‡9  1‏
919 ‎‡a  novelandsimplecellbaseddetectionsystemwithacollagenencapsulatedblymphocytecelllineasabiosensorforrapiddetectionofpathogensandtoxins‏ ‎‡A  A novel and simple cell-based detection system with a collagen-encapsulated B-lymphocyte cell line as a biosensor for rapid detection of pathogens and toxins.‏ ‎‡9  1‏
919 ‎‡a  statisticalmodelingapproachtocomputeraidedquantificationofdentalbiofilm‏ ‎‡A  A statistical modeling approach to computer-aided quantification of dental biofilm‏ ‎‡9  1‏
919 ‎‡a  accessscopeprojectaccessiblelightmicroscopeforuserswithupperlimbmobilityorvisualimpairments‏ ‎‡A  AccessScope project: Accessible light microscope for users with upper limb mobility or visual impairments.‏ ‎‡9  1‏
919 ‎‡a  acroleininducedcelldeathinpc12cellsroleofmitochondriamediatedoxidativestress‏ ‎‡A  Acrolein-induced cell death in PC12 cells: role of mitochondria-mediated oxidative stress.‏ ‎‡9  1‏
919 ‎‡a  adaptiveimageprocessingtechniqueandeffectivevisualizationofconfocalmicroscopyimages‏ ‎‡A  Adaptive image-processing technique and effective visualization of confocal microscopy images.‏ ‎‡9  1‏
919 ‎‡a  adsorptionofavidinonmicrofabricatedsurfacesforproteinbiochipapplications‏ ‎‡A  Adsorption of avidin on microfabricated surfaces for protein biochip applications.‏ ‎‡9  1‏
919 ‎‡a  afmclsmdatavisualizationandcomparisonusinganopensourcetoolkit‏ ‎‡A  AFM/CLSM data visualization and comparison using an open-source toolkit‏ ‎‡9  1‏
919 ‎‡a  alternativestocurrentflowcytometrydataanalysisforclinicalandresearchstudies‏ ‎‡A  Alternatives to current flow cytometry data analysis for clinical and research studies‏ ‎‡9  1‏
919 ‎‡a  excitationwavelengthscanningspectralimagingsystemforpreclinicalimaging‏ ‎‡A  An excitation wavelength-scanning spectral imaging system for preclinical imaging.‏ ‎‡9  1‏
919 ‎‡a  innovationinflowcytometrydatacollectionandanalysisproducingacorrelatedmultiplesampleanalysisinasinglefile‏ ‎‡A  An innovation in flow cytometry data collection and analysis producing a correlated multiple sample analysis in a single file.‏ ‎‡9  1‏
919 ‎‡a  analysisoftimeresolvedscatteringfrommacroscalebacterialcolonies‏ ‎‡A  Analysis of time-resolved scattering from macroscale bacterial colonies.‏ ‎‡9  1‏
919 ‎‡a  applicationofflowcytometryforbiomarkerbasedcervicalcancercellsdetection‏ ‎‡A  Application of flow cytometry for biomarker-based cervical cancer cells detection.‏ ‎‡9  1‏
919 ‎‡a  applicationofwaveletdenoisingtoimprovecompressionefficiencywhilepreservingintegrityofdigitalmicrographs‏ ‎‡A  Application of wavelet denoising to improve compression efficiency while preserving integrity of digital micrographs.‏ ‎‡9  1‏
919 ‎‡a  automatedclassificationofbacterialparticlesinflowbymultianglescattermeasurementandsupportvectormachineclassifier‏ ‎‡A  Automated classification of bacterial particles in flow by multiangle scatter measurement and support vector machine classifier.‏ ‎‡9  1‏
919 ‎‡a  bacteriamediateddeliveryofnanoparticlesandcargointocells‏ ‎‡A  Bacteria-mediated delivery of nanoparticles and cargo into cells‏ ‎‡9  1‏
919 ‎‡a  biofilmquantacomputerassistedtoolfordentalbiofilmquantification‏ ‎‡A  BiofilmQuant: a computer-assisted tool for dental biofilm quantification‏ ‎‡9  1‏
919 ‎‡a  biophysicalmodelingofforwardscatteringfrombacterialcoloniesusingscalardiffractiontheory‏ ‎‡A  Biophysical modeling of forward scattering from bacterial colonies using scalar diffraction theory.‏ ‎‡9  1‏
919 ‎‡a  classificationofbacterialcontaminationusingimageprocessinganddistributedcomputing‏ ‎‡A  Classification of bacterial contamination using image processing and distributed computing.‏ ‎‡9  1‏
919 ‎‡a  comparative3dimensionalimagingoflivingneuronswithconfocalandatomicforcemicroscopy‏ ‎‡A  Comparative three-dimensional imaging of living neurons with confocal and atomic force microscopy.‏ ‎‡9  1‏
919 ‎‡a  compositesurfaceforblockingbacterialadsorptiononproteinbiochips‏ ‎‡A  Composite surface for blocking bacterial adsorption on protein biochips.‏ ‎‡9  1‏
919 ‎‡a  compressionoffluorescencemicroscopyimagesbasedonthesignaltonoiseestimation‏ ‎‡A  Compression of fluorescence microscopy images based on the signal-to-noise estimation.‏ ‎‡9  1‏
919 ‎‡a  confocalfluorescenceimagingofphotosensitizeddnadenaturationincellnuclei‏ ‎‡A  Confocal fluorescence imaging of photosensitized DNA denaturation in cell nuclei.‏ ‎‡9  1‏
919 ‎‡a  currentstatusandfutureprospectsofusingadvancedcomputerbasedmethodstostudybacterialcolonialmorphology‏ ‎‡A  Current status and future prospects of using advanced computer-based methods to study bacterial colonial morphology.‏ ‎‡9  1‏
919 ‎‡a  detectionofcanineinterleukin2receptorsbyflowcytometry‏ ‎‡A  Detection of canine interleukin-2 receptors by flow cytometry.‏ ‎‡9  1‏
919 ‎‡a  developmentofamultispectrallightscattersensorforbacterialcolonies‏ ‎‡A  Development of a multispectral light-scatter sensor for bacterial colonies.‏ ‎‡9  1‏
919 ‎‡a  effectofbasallaminaonprogesteroneproductionbychickengranulosacellsinvitroinfluenceoffolliculardevelopment‏ ‎‡A  Effect of basal lamina on progesterone production by chicken granulosa cells in vitro--influence of follicular development.‏ ‎‡9  1‏
919 ‎‡a  familialoccurrenceofalpha1antitrypsindeficiencyandweberchristiandisease‏ ‎‡A  Familial occurrence of alpha 1-antitrypsin deficiency and Weber-Christian disease‏ ‎‡9  1‏
919 ‎‡a  hyperspectralcytometryatthesinglecelllevelusinga32channelphotodetector‏ ‎‡A  Hyperspectral cytometry at the single-cell level using a 32-channel photodetector.‏ ‎‡9  1‏
919 ‎‡a  integratingcytomicsandproteomics‏ ‎‡A  Integrating cytomics and proteomics.‏ ‎‡9  1‏
919 ‎‡a  isolationof2populationsofmyoblastsfromporcineskeletalmuscle‏ ‎‡A  Isolation of two populations of myoblasts from porcine skeletal muscle‏ ‎‡9  1‏
919 ‎‡a  wallacehcoulterdecadesofinventionanddiscovery‏ ‎‡A  Wallace H. Coulter: decades of invention and discovery.‏ ‎‡9  1‏
919 ‎‡a  validationoflargescalemonochromaticuvdisinfectionsystemsfordrinkingwaterusingdyedmicrospheres‏ ‎‡A  Validation of large-scale, monochromatic UV disinfection systems for drinking water using dyed microspheres.‏ ‎‡9  1‏
919 ‎‡a  ultrastructureandcytochemicalstainingcharacteristicsofcaninenaturalkillercells‏ ‎‡A  Ultrastructure and cytochemical staining characteristics of canine natural killer cells.‏ ‎‡9  1‏
919 ‎‡a  tunablelifetimemultiplexingusingluminescentnanocrystals‏ ‎‡A  Tunable lifetime multiplexing using luminescent nanocrystals‏ ‎‡9  1‏
919 ‎‡a  nuclearstructuralproteinnumaisanegativeregulatorof53bp1indnadoublestrandbreakrepair‏ ‎‡A  The nuclear structural protein NuMA is a negative regulator of 53BP1 in DNA double-strand break repair‏ ‎‡9  1‏
919 ‎‡a  influenceofexercisetrainingoninflammatorycytokinesand100reactiveprotein‏ ‎‡A  The influence of exercise training on inflammatory cytokines and C-reactive protein‏ ‎‡9  1‏
919 ‎‡a  effectofintravenousimmunoglobulinontheinvitrofunctionofhumanneutrophils‏ ‎‡A  The effect of intravenous immunoglobulin on the in vitro function of human neutrophils‏ ‎‡9  1‏
919 ‎‡a  labelfreedetectionofmultiplebacterialpathogensusinglightscatteringsensor‏ ‎‡A  Label-free detection of multiple bacterial pathogens using light-scattering sensor.‏ ‎‡9  1‏
919 ‎‡a  laseropticalsensoralabelfreeonplatesalmonellaentericacolonydetectiontool‏ ‎‡A  Laser optical sensor, a label-free on-plate Salmonella enterica colony detection tool‏ ‎‡9  1‏
919 ‎‡a  lightscatteringsensorforrealtimeidentificationofvibrioparahaemolyticusvibriovulnificusandvibriocholeraecoloniesonsolidagarplate‏ ‎‡A  Light-scattering sensor for real-time identification of Vibrio parahaemolyticus, Vibrio vulnificus and Vibrio cholerae colonies on solid agar plate‏ ‎‡9  1‏
919 ‎‡a  livingcantileverarraysforcharacterizationofmassofsinglelivecellsinfluids‏ ‎‡A  'Living cantilever arrays' for characterization of mass of single live cells in fluids.‏ ‎‡9  1‏
919 ‎‡a  local3dimensionalstrainmeasurementswithinlargelydeformedextracellularmatrixconstructs‏ ‎‡A  Local, three-dimensional strain measurements within largely deformed extracellular matrix constructs.‏ ‎‡9  1‏
919 ‎‡a  measurementandanalysisofangleresolvedscatterfromsmallparticlesinacylindricalmicrochannel‏ ‎‡A  Measurement and analysis of angle-resolved scatter from small particles in a cylindrical microchannel.‏ ‎‡9  1‏
919 ‎‡a  microenvironmentcontrolledencapsulationmiceprocesseffectsofplgaconcentrationflowrateandcollectionmethodonmicrocapsulesizeandmorphology‏ ‎‡A  Microenvironment-controlled encapsulation (MiCE) process: effects of PLGA concentration, flow rate, and collection method on microcapsule size and morphology.‏ ‎‡9  1‏
919 ‎‡a  tensilemechanicalpropertiesof3dimensionaltype1collagenextracellularmatriceswithvariedmicrostructure‏ ‎‡A  Tensile mechanical properties of three-dimensional type I collagen extracellular matrices with varied microstructure‏ ‎‡9  1‏
919 ‎‡a  subjectclassificationobtainedbyclusteranalysisandprincipalcomponentanalysisappliedtoflowcytometricdata‏ ‎‡A  Subject classification obtained by cluster analysis and principal component analysis applied to flow cytometric data.‏ ‎‡9  1‏
919 ‎‡a  spectralflowcytometryquovadimus‏ ‎‡A  Spectral flow cytometry-Quo vadimus?‏ ‎‡9  1‏
919 ‎‡a  singleand2photonspectralimagingofintrinsicfluorescenceoftransformedhumanhepatocytes‏ ‎‡A  Single- and two-photon spectral imaging of intrinsic fluorescence of transformed human hepatocytes.‏ ‎‡9  1‏
919 ‎‡a  simultaneousmechanicalloadingandconfocalreflectionmicroscopyfor3dimensionalmicrobiomechanicalanalysisofbiomaterialsandtissueconstructs‏ ‎‡A  Simultaneous mechanical loading and confocal reflection microscopy for three-dimensional microbiomechanical analysis of biomaterials and tissue constructs.‏ ‎‡9  1‏
919 ‎‡a  reflectedscatterometryfornoninvasiveinterrogationofbacterialcolonies‏ ‎‡A  Reflected scatterometry for noninvasive interrogation of bacterial colonies.‏ ‎‡9  1‏
919 ‎‡a  rapidpurificationoftransfectedporcinemusclecells‏ ‎‡A  Rapid purification of transfected porcine muscle cells‏ ‎‡9  1‏
946 ‎‡a  b‏ ‎‡9  1‏
996 ‎‡2  LC|n 97014123‏
996 ‎‡2  NUKAT|n 2014000252‏
996 ‎‡2  BIBSYS|4017642‏
996 ‎‡2  NLA|000035713765‏
996 ‎‡2  NUKAT|n 2003047760‏
996 ‎‡2  BIBSYS|90299465‏
996 ‎‡2  LC|n 2007070751‏
996 ‎‡2  RERO|A027147231‏
996 ‎‡2  B2Q|0000132809‏
996 ‎‡2  JPG|500446110‏
996 ‎‡2  NUKAT|n 2015098599‏
996 ‎‡2  CAOONL|ncf10543925‏
996 ‎‡2  DNB|132326078‏
996 ‎‡2  BIBSYS|50659‏
996 ‎‡2  BNF|12308937‏
996 ‎‡2  PLWABN|9810638931005606‏
996 ‎‡2  LC|n 85803901‏
996 ‎‡2  ISNI|0000000021991094‏
996 ‎‡2  LC|n 98003362‏
996 ‎‡2  LC|no2009168605‏
996 ‎‡2  LC|n 92803132‏
996 ‎‡2  LC|n 84122808‏
996 ‎‡2  ISNI|0000000374099966‏
996 ‎‡2  NTA|357303458‏
996 ‎‡2  LC|n 85118110‏
996 ‎‡2  ISNI|0000000066404199‏
996 ‎‡2  LC|n 2020013119‏
996 ‎‡2  N6I|vtls001388428‏
996 ‎‡2  DNB|120800977‏
996 ‎‡2  J9U|987007458637505171‏
996 ‎‡2  BNF|13497223‏
996 ‎‡2  BIBSYS|90726598‏
996 ‎‡2  LC|n 50048983‏
996 ‎‡2  LC|n 93096616‏
996 ‎‡2  NKC|mzk2014852619‏
996 ‎‡2  DNB|126844887‏
996 ‎‡2  LIH|LNB:B_n_Y_p_;=CJ‏
996 ‎‡2  ISNI|0000000053306493‏
996 ‎‡2  NUKAT|n 97026817‏
996 ‎‡2  LC|no2004089348‏
996 ‎‡2  N6I|vtls002703872‏
996 ‎‡2  SIMACOB|251416675‏
996 ‎‡2  ISNI|0000000028526160‏
996 ‎‡2  SUDOC|095120130‏
996 ‎‡2  CAOONL|ncf10035781‏
996 ‎‡2  LIH|LNB:_l__e__m_;=CI‏
996 ‎‡2  CAOONL|ncf10131380‏
996 ‎‡2  NTA|071091122‏
996 ‎‡2  LC|nr2002045166‏
996 ‎‡2  SUDOC|081381123‏
996 ‎‡2  BIBSYS|90360861‏
996 ‎‡2  ISNI|0000000081865751‏
996 ‎‡2  J9U|987007362200005171‏
996 ‎‡2  LC|no2011177514‏
996 ‎‡2  LC|n 88237447‏
996 ‎‡2  NLA|000035789962‏
996 ‎‡2  NUKAT|n 2008134201‏
996 ‎‡2  SIMACOB|62535523‏
996 ‎‡2  BIBSYS|4017289‏
996 ‎‡2  ISNI|000000011585527X‏
996 ‎‡2  NII|DA10773512‏
996 ‎‡2  SUDOC|184339359‏
996 ‎‡2  J9U|987007368663405171‏
996 ‎‡2  ISNI|000000002826528X‏
996 ‎‡2  ICCU|UFIV094431‏
996 ‎‡2  BIBSYS|2098987‏
996 ‎‡2  J9U|987007378755305171‏
996 ‎‡2  LC|n 2011182990‏
996 ‎‡2  RERO|A003752096‏
996 ‎‡2  NII|DA07484812‏
996 ‎‡2  BAV|495_108661‏
996 ‎‡2  RERO|A009441546‏
996 ‎‡2  NTA|104069996‏
996 ‎‡2  BNC|981058519261306706‏
996 ‎‡2  NDL|00454403‏
996 ‎‡2  LC|n 79057963‏
996 ‎‡2  PTBNP|84853‏
996 ‎‡2  LC|nb 98025165‏
996 ‎‡2  BNE|XX5626791‏
996 ‎‡2  ISNI|0000000052055522‏
996 ‎‡2  LC|no2017137621‏
996 ‎‡2  ISNI|0000000031336552‏
996 ‎‡2  J9U|987007403216805171‏
996 ‎‡2  LC|n 83128804‏
996 ‎‡2  DNB|1241682569‏
996 ‎‡2  NII|DA1166726X‏
996 ‎‡2  ISNI|0000000358993001‏
996 ‎‡2  ISNI|0000000024651140‏
996 ‎‡2  DNB|1043115196‏
996 ‎‡2  JPG|500067123‏
996 ‎‡2  BNC|981061009056706706‏
996 ‎‡2  LC|n 85803831‏
996 ‎‡2  NDL|00515828‏
996 ‎‡2  NTA|341354279‏
996 ‎‡2  LC|n 85104818‏
996 ‎‡2  ISNI|0000000032420000‏
996 ‎‡2  DNB|1127755129‏
996 ‎‡2  ISNI|0000000021809678‏
996 ‎‡2  BIBSYS|90302660‏
996 ‎‡2  RERO|A017431374‏
996 ‎‡2  BNF|16931346‏
996 ‎‡2  DNB|173512011‏
996 ‎‡2  LC|n 80080477‏
996 ‎‡2  CAOONL|ncf10923862‏
996 ‎‡2  LC|no 99036312‏
996 ‎‡2  NTA|074390619‏
996 ‎‡2  SUDOC|078712203‏
996 ‎‡2  LC|n 2016010440‏
996 ‎‡2  LC|n 78071250‏
996 ‎‡2  BIBSYS|90505756‏
996 ‎‡2  ISNI|0000000498708217‏
996 ‎‡2  SUDOC|230553915‏
996 ‎‡2  LC|no2002078489‏
996 ‎‡2  ISNI|0000000032435149‏
996 ‎‡2  N6I|vtls002279119‏
996 ‎‡2  BNCHL|10000000000000000126497‏
996 ‎‡2  J9U|987007388502305171‏
996 ‎‡2  ISNI|0000000356082829‏
996 ‎‡2  DNB|1077887566‏
996 ‎‡2  ISNI|0000000081330896‏
996 ‎‡2  LC|n 89665517‏
996 ‎‡2  ISNI|0000000082966167‏
996 ‎‡2  ISNI|0000000410112591‏
996 ‎‡2  NUKAT|n 2012040361‏
996 ‎‡2  ICCU|CUBV121301‏
996 ‎‡2  LC|n 83009155‏
996 ‎‡2  ISNI|0000000023500826‏
996 ‎‡2  J9U|987007359546505171‏
996 ‎‡2  B2Q|0000491249‏
996 ‎‡2  ISNI|0000000113203681‏
996 ‎‡2  NTA|067688527‏
996 ‎‡2  NTA|073165727‏
996 ‎‡2  CAOONL|ncf11576026‏
996 ‎‡2  LC|n 2014048249‏
996 ‎‡2  J9U|987007364770905171‏
996 ‎‡2  DE633|pe30071746‏
996 ‎‡2  ISNI|0000000383162189‏
996 ‎‡2  LC|n 80010428‏
996 ‎‡2  LC|no2001032144‏
996 ‎‡2  LC|n 87808736‏
996 ‎‡2  ISNI|0000000117423374‏
996 ‎‡2  ISNI|0000000382062645‏
996 ‎‡2  ISNI|0000000453021163‏
996 ‎‡2  NTA|079382320‏
996 ‎‡2  LIH|LNB:B279;=_o__l_‏
996 ‎‡2  BIBSYS|90323585‏
996 ‎‡2  LC|no 00065067‏
996 ‎‡2  SUDOC|029110114‏
996 ‎‡2  SUDOC|156866498‏
996 ‎‡2  NKC|xx0020898‏
996 ‎‡2  DNB|123734665‏
996 ‎‡2  LC|n 2002110139‏
996 ‎‡2  BNF|14614471‏
996 ‎‡2  NUKAT|n 2012074301‏
996 ‎‡2  SUDOC|085853593‏
996 ‎‡2  ISNI|0000000029854190‏
996 ‎‡2  RERO|A025713136‏
996 ‎‡2  ISNI|0000000047339395‏
996 ‎‡2  LC|n 2012005338‏
996 ‎‡2  NSK|000112674‏
996 ‎‡2  LC|no2001006494‏
996 ‎‡2  SUDOC|111159229‏
996 ‎‡2  NLA|000067507516‏
996 ‎‡2  BIBSYS|5030100‏
996 ‎‡2  NYNYRILM|20080‏
996 ‎‡2  LC|n 79012813‏
996 ‎‡2  LC|n 87833091‏
996 ‎‡2  ISNI|0000000041154736‏
996 ‎‡2  J9U|987007267158805171‏
996 ‎‡2  PLWABN|9810677454105606‏
996 ‎‡2  J9U|987007430432405171‏
996 ‎‡2  PLWABN|9810656285605606‏
996 ‎‡2  ISNI|0000000490288078‏
996 ‎‡2  BIBSYS|90120563‏
996 ‎‡2  LC|no2014157152‏
996 ‎‡2  SUDOC|243476345‏
996 ‎‡2  LC|n 2022045897‏
996 ‎‡2  LC|n 2022045896‏
996 ‎‡2  N6I|vtls000025015‏
996 ‎‡2  ISNI|0000000027440736‏
996 ‎‡2  LC|n 2005046495‏
996 ‎‡2  CAOONL|ncf11392837‏
996 ‎‡2  CAOONL|ncf10125222‏
996 ‎‡2  DNB|1089147546‏
996 ‎‡2  SUDOC|060801328‏
996 ‎‡2  NTA|073856487‏
996 ‎‡2  RERO|A003752103‏
996 ‎‡2  ISNI|0000000053299203‏
996 ‎‡2  RERO|A003752106‏
996 ‎‡2  RERO|A003752105‏
996 ‎‡2  ISNI|0000000021498603‏
996 ‎‡2  NDL|00454412‏
996 ‎‡2  ISNI|0000000077437252‏
996 ‎‡2  SUDOC|264452585‏
996 ‎‡2  RERO|A006362757‏
996 ‎‡2  SUDOC|199676356‏
996 ‎‡2  NII|DA08169898‏
996 ‎‡2  NII|DA09754951‏
996 ‎‡2  BNF|17077244‏
996 ‎‡2  BIBSYS|90222950‏
996 ‎‡2  CAOONL|ncf10253735‏
996 ‎‡2  ISNI|0000000030910698‏
996 ‎‡2  CAOONL|ncf10112314‏
996 ‎‡2  BIBSYS|8075401‏
996 ‎‡2  CAOONL|ncf10021106‏
996 ‎‡2  NLA|000035902220‏
996 ‎‡2  RERO|A000071842‏
996 ‎‡2  J9U|987007430679905171‏
996 ‎‡2  BIBSYS|1460961538593‏
996 ‎‡2  ISNI|0000000436772440‏
996 ‎‡2  BNE|XX1091212‏
996 ‎‡2  BNF|12555011‏
996 ‎‡2  LC|no2009004108‏
996 ‎‡2  DNB|1158812027‏
996 ‎‡2  N6I|vtls001243716‏
996 ‎‡2  ISNI|000000038439503X‏
996 ‎‡2  NTA|135594200‏
996 ‎‡2  NTA|089580761‏
996 ‎‡2  LC|n 86072835‏
996 ‎‡2  J9U|987007355259205171‏
996 ‎‡2  NTA|07391049X‏
996 ‎‡2  LC|n 82226929‏
996 ‎‡2  BIBSYS|7003462‏
996 ‎‡2  ISNI|0000000023659204‏
996 ‎‡2  SUDOC|034839976‏
996 ‎‡2  DNB|135192412‏
996 ‎‡2  NUKAT|n 2014079718‏
996 ‎‡2  ISNI|0000000382938133‏
996 ‎‡2  ISNI|0000000024667572‏
996 ‎‡2  LC|no2008182433‏
996 ‎‡2  BIBSYS|90712302‏
996 ‎‡2  LC|n 95055064‏
996 ‎‡2  J9U|987007583814905171‏
996 ‎‡2  LC|n 79038747‏
996 ‎‡2  ISNI|0000000083691636‏
996 ‎‡2  LC|n 86070213‏
996 ‎‡2  BNF|13621930‏
996 ‎‡2  JPG|500055100‏
996 ‎‡2  LNB|LNC10-000170382‏
996 ‎‡2  NTA|224289527‏
996 ‎‡2  LC|no2014162817‏
996 ‎‡2  ISNI|0000000436125382‏
996 ‎‡2  BNF|12193687‏
996 ‎‡2  NUKAT|n 2005125349‏
996 ‎‡2  RERO|A012374242‏
996 ‎‡2  J9U|987007359552205171‏
996 ‎‡2  LC|n 85066812‏
996 ‎‡2  BNF|12080451‏
996 ‎‡2  NTA|070624356‏
996 ‎‡2  DNB|1190109409‏
997 ‎‡a  1901 0 flourished 0000 0‏ ‎‡9  1‏
998 ‎‡a  Robinson, J. Paul‏ ‎‡2  LC|n 92121862‏ ‎‡3  suggested‏
998 ‎‡a  Robinson, J. Paul,‏ ‎‡2  SUDOC|052550591‏ ‎‡3  suggested‏
998 ‎‡a  Robinson, J. Paul‏ ‎‡2  LNB|LNC10-000061228‏ ‎‡3  suggested‏
998 ‎‡a  Robinson, J. Paul‏ ‎‡2  BIBSYS|90804285‏ ‎‡3  viafid‏
998 ‎‡a  Robinson‏ ‎‡b  J. Paul‏ ‎‡2  BNF|13563195‏ ‎‡3  suggested‏
998 ‎‡a  Robinson, J. Paul.‏ ‎‡2  NUKAT|n 2003090509‏ ‎‡3  suggested‏ ‎‡3  viafid‏
998 ‎‡a  Robinson, J. Paul‏ ‎‡2  PLWABN|9810655576605606‏ ‎‡3  viafid‏
998 ‎‡a  Robinson, J. Paul‏ ‎‡2  J9U|987007427794205171‏ ‎‡3  suggested‏
998 ‎‡a  Robinson, J.Paul‏ ‎‡2  ISNI|0000000116216074‏ ‎‡3  suggested‏
998 ‎‡a  Robinson, J. Paul‏ ‎‡2  ISNI|0000000116216074‏ ‎‡3  suggested‏