Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q57416161 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241120235752.0 | ||
| 008 | 241120nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q57416161 | ||
| 024 | ‡a 0000-0002-0952-5909 ‡2 orcid | ||
| 024 | ‡a 27167943300 ‡2 scopus | ||
| 035 | ‡a (OCoLC)Q57416161 | ||
| 100 | 0 | ‡a Gang Li ‡9 sq ‡9 es ‡9 ast | |
| 400 | 0 | ‡a Gang Li ‡c researcher ORCID id 0000-0002-0952-5909 ‡9 en | |
| 400 | 0 | ‡a Gang Li ‡c onderzoeker ‡9 nl | |
| 670 | ‡a Author's Atomic-Scale Mapping of Layer-by-Layer Hydrogen Etching and Passivation of SiC | ||
| 670 | ‡a Author's Atomic-Scale Mapping of Layer-by-Layer Hydrogen Etching and Passivation of SiC(0001) Substrates | ||
| 670 | ‡a Author's Bismuthene on a SiC substrate: A candidate for a high-temperature quantum spin Hall material. | ||
| 670 | ‡a Author's Can NbO Keep <i>nbo</i> Topology under Electrons? –Unveiling Novel Aspects of Niobium Monoxide at the Atomic Scale | ||
| 670 | ‡a Author's Efficient Perturbation Theory for Quantum Lattice Models | ||
| 670 | ‡a Author's Efficient treatment of the high-frequency tail of the self-energy function and its relevance for multiorbital models | ||
| 670 | ‡a Author's Electronic structures and unusually robust bandgap in an ultrahigh-mobility layered oxide semiconductor, BiOSe | ||
| 670 | ‡a Author's Elemental Topological Insulator with Tunable Fermi Level: Strainedα-Sn on InSb | ||
| 670 | ‡a Author's Elemental Topological Insulator with Tunable Fermi Level: Strainedα-Sn on InSb(001) | ||
| 670 | ‡a Author's Fluctuation-induced topological quantum phase transitions in quantum spin-Hall and anomalous-Hall insulators | ||
| 670 | ‡a Author's Interacting weak topological insulators and their transition to Dirac semimetal phases | ||
| 670 | ‡a Author's Magnetic order in a frustrated two-dimensional atom lattice at a semiconductor surface | ||
| 670 | ‡a Author's Magnetic Weyl semimetal phase in a Kagomé crystal | ||
| 670 | ‡a Author's Momentum structure of the self-energy and its parametrization for the two-dimensional Hubbard model | ||
| 670 | ‡a Author's Observation of topological states residing at step edges of WTe2. | ||
| 670 | ‡a Author's Quantum Anomalous Hall State in Ferromagnetic SrRuO3 | ||
| 670 | ‡a Author's Quantum Anomalous Hall State in Ferromagnetic SrRuO3 (111) Bilayers | ||
| 670 | ‡a Author's Topological Dirac semimetal phase in Pd and Pt oxides | ||
| 670 | ‡a Author's Topological nature and the multiple Dirac cones hidden in Bismuth high-Tc superconductors | ||
| 670 | ‡a Author's Topological origin of the type-II Dirac fermions in PtSe2 | ||
| 670 | ‡a Author's Triangular Spin-Orbit-Coupled Lattice with Strong Coulomb Correlations: Sn Atoms on a SiC | ||
| 670 | ‡a Author's Triangular Spin-Orbit-Coupled Lattice with Strong Coulomb Correlations: Sn Atoms on a SiC(0001) Substrate | ||
| 909 | ‡a (scopus) 27167943300 ‡9 1 | ||
| 909 | ‡a (orcid) 0000000209525909 ‡9 1 | ||
| 919 | ‡a topologicalnatureandthemultiplediracconeshiddeninbismuthhightcsuperconductors ‡A Topological nature and the multiple Dirac cones hidden in Bismuth high-Tc superconductors ‡9 1 | ||
| 919 | ‡a quantumanomaloushallstateinferromagneticsrruo3 ‡A Quantum Anomalous Hall State in Ferromagnetic SrRuO3 ‡9 1 | ||
| 919 | ‡a observationoftopologicalstatesresidingatstepedgesofwte2 ‡A Observation of topological states residing at step edges of WTe2. ‡9 1 | ||
| 919 | ‡a interactingweaktopologicalinsulatorsandtheirtransitiontodiracsemimetalphases ‡A Interacting weak topological insulators and their transition to Dirac semimetal phases ‡9 1 | ||
| 919 | ‡a electronicstructuresandunusuallyrobustbandgapinanultrahighmobilitylayeredoxidesemiconductorbiose ‡A Electronic structures and unusually robust bandgap in an ultrahigh-mobility layered oxide semiconductor, BiOSe ‡9 1 | ||
| 919 | ‡a bismutheneonasicsubstrateacandidateforahightemperaturequantumspinhallmaterial ‡A Bismuthene on a SiC substrate: A candidate for a high-temperature quantum spin Hall material. ‡9 1 | ||
| 919 | ‡a atomicscalemappingoflayerbylayerhydrogenetchingandpassivationofsic ‡A Atomic-Scale Mapping of Layer-by-Layer Hydrogen Etching and Passivation of SiC ‡9 1 | ||
| 919 | ‡a atomicscalemappingoflayerbylayerhydrogenetchingandpassivationofsic0001substrates ‡A Atomic-Scale Mapping of Layer-by-Layer Hydrogen Etching and Passivation of SiC(0001) Substrates ‡9 1 | ||
| 919 | ‡a efficientperturbationtheoryforquantumlatticemodels ‡A Efficient Perturbation Theory for Quantum Lattice Models ‡9 1 | ||
| 919 | ‡a cannbokeep1nbo1topologyunderelectronsunveilingnovelaspectsofniobiummonoxideattheatomicscale ‡A Can NbO Keep <i>nbo</i> Topology under Electrons? –Unveiling Novel Aspects of Niobium Monoxide at the Atomic Scale ‡9 1 | ||
| 919 | ‡a elementaltopologicalinsulatorwithtunablefermilevelstrainedαsnoninsb ‡A Elemental Topological Insulator with Tunable Fermi Level: Strainedα-Sn on InSb ‡9 1 | ||
| 919 | ‡a efficienttreatmentofthehighfrequencytailoftheselfenergyfunctionanditsrelevanceformultiorbitalmodels ‡A Efficient treatment of the high-frequency tail of the self-energy function and its relevance for multiorbital models ‡9 1 | ||
| 919 | ‡a magneticweylsemimetalphaseinakagomecrystal ‡A Magnetic Weyl semimetal phase in a Kagomé crystal ‡9 1 | ||
| 919 | ‡a magneticorderinafrustrated2dimensionalatomlatticeatasemiconductorsurface ‡A Magnetic order in a frustrated two-dimensional atom lattice at a semiconductor surface ‡9 1 | ||
| 919 | ‡a momentumstructureoftheselfenergyanditsparametrizationforthe2dimensionalhubbardmodel ‡A Momentum structure of the self-energy and its parametrization for the two-dimensional Hubbard model ‡9 1 | ||
| 919 | ‡a quantumanomaloushallstateinferromagneticsrruo3111bilayers ‡A Quantum Anomalous Hall State in Ferromagnetic SrRuO3 (111) Bilayers ‡9 1 | ||
| 919 | ‡a topologicaldiracsemimetalphaseinpdandptoxides ‡A Topological Dirac semimetal phase in Pd and Pt oxides ‡9 1 | ||
| 919 | ‡a fluctuationinducedtopologicalquantumphasetransitionsinquantumspinhallandanomaloushallinsulators ‡A Fluctuation-induced topological quantum phase transitions in quantum spin-Hall and anomalous-Hall insulators ‡9 1 | ||
| 919 | ‡a triangularspinorbitcoupledlatticewithstrongcoulombcorrelationssnatomsonasic0001substrate ‡A Triangular Spin-Orbit-Coupled Lattice with Strong Coulomb Correlations: Sn Atoms on a SiC(0001) Substrate ‡9 1 | ||
| 919 | ‡a triangularspinorbitcoupledlatticewithstrongcoulombcorrelationssnatomsonasic ‡A Triangular Spin-Orbit-Coupled Lattice with Strong Coulomb Correlations: Sn Atoms on a SiC ‡9 1 | ||
| 919 | ‡a topologicaloriginofthetype2diracfermionsinptse2 ‡A Topological origin of the type-II Dirac fermions in PtSe2 ‡9 1 | ||
| 919 | ‡a elementaltopologicalinsulatorwithtunablefermilevelstrainedαsnoninsb001 ‡A Elemental Topological Insulator with Tunable Fermi Level: Strainedα-Sn on InSb(001) ‡9 1 | ||
| 996 | ‡2 DNB|1126666505 | ||
| 996 | ‡2 DNB|1302307045 | ||
| 996 | ‡2 DNB|143056778 | ||
| 996 | ‡2 CYT|AC000207485 | ||
| 996 | ‡2 CAOONL|ncf11883479 | ||
| 996 | ‡2 CAOONL|ncf11878913 | ||
| 996 | ‡2 DNB|104133737X | ||
| 996 | ‡2 LC|n 92804752 | ||
| 996 | ‡2 DNB|137812914 | ||
| 996 | ‡2 CYT|AC000042564 | ||
| 996 | ‡2 DNB|112193935X | ||
| 996 | ‡2 ISNI|0000000444409887 | ||
| 996 | ‡2 ISNI|0000000064111675 | ||
| 996 | ‡2 LNB|LNC10-000202150 | ||
| 996 | ‡2 ISNI|0000000114534909 | ||
| 996 | ‡2 NUKAT|n 2009095943 | ||
| 996 | ‡2 RERO|A017579134 | ||
| 996 | ‡2 DNB|1038155274 | ||
| 996 | ‡2 ISNI|0000000505102679 | ||
| 996 | ‡2 CYT|AC000636291 | ||
| 996 | ‡2 SUDOC|185547435 | ||
| 996 | ‡2 BIBSYS|90802613 | ||
| 996 | ‡2 ISNI|0000000382267595 | ||
| 996 | ‡2 DNB|1044496886 | ||
| 996 | ‡2 DNB|1078793611 | ||
| 996 | ‡2 ISNI|000000006350360X | ||
| 996 | ‡2 ISNI|0000000063538204 | ||
| 996 | ‡2 LC|nr2001024925 | ||
| 996 | ‡2 LC|n 2014012218 | ||
| 996 | ‡2 DNB|1126608599 | ||
| 996 | ‡2 NII|DA00920610 | ||
| 996 | ‡2 DNB|173885489 | ||
| 996 | ‡2 DNB|1194436560 | ||
| 996 | ‡2 DNB|1020701722 | ||
| 996 | ‡2 LC|n 78066087 | ||
| 996 | ‡2 ISNI|0000000084419474 | ||
| 996 | ‡2 PLWABN|9812423397005606 | ||
| 996 | ‡2 DNB|1021375810 | ||
| 996 | ‡2 DNB|1166812901 | ||
| 996 | ‡2 DNB|1239184662 | ||
| 996 | ‡2 LC|n 80019487 | ||
| 996 | ‡2 DNB|1136617930 | ||
| 996 | ‡2 DNB|1251789293 | ||
| 996 | ‡2 BNF|14420293 | ||
| 996 | ‡2 ISNI|0000000112285865 | ||
| 996 | ‡2 BNF|14197889 | ||
| 996 | ‡2 NUKAT|nx2023262954 | ||
| 996 | ‡2 ISNI|0000000071464612 | ||
| 996 | ‡2 DNB|1339688093 | ||
| 996 | ‡2 SUDOC|085863688 | ||
| 996 | ‡2 SZ|1014599997 | ||
| 996 | ‡2 CYT|AC000465516 | ||
| 996 | ‡2 SZ|113188597X | ||
| 996 | ‡2 DNB|1272550982 | ||
| 996 | ‡2 ISNI|0000000085010662 | ||
| 996 | ‡2 NSK|000695691 | ||
| 996 | ‡2 ISNI|0000000075096597 | ||
| 996 | ‡2 ISNI|0000000066607981 | ||
| 996 | ‡2 ISNI|0000000064254115 | ||
| 996 | ‡2 LC|nr 94036893 | ||
| 996 | ‡2 DNB|1274392209 | ||
| 996 | ‡2 DNB|1194506348 | ||
| 996 | ‡2 DNB|1076410081 | ||
| 996 | ‡2 NUKAT|nx2022556982 | ||
| 996 | ‡2 ISNI|0000000496793972 | ||
| 996 | ‡2 DNB|1051539439 | ||
| 996 | ‡2 CAOONL|ncf13678930 | ||
| 996 | ‡2 PLWABN|9810568425705606 | ||
| 996 | ‡2 LC|ns2013002275 | ||
| 996 | ‡2 BNF|13604637 | ||
| 996 | ‡2 NTA|364183853 | ||
| 996 | ‡2 DNB|1321204671 | ||
| 996 | ‡2 NUKAT|n 2015186899 | ||
| 996 | ‡2 ISNI|0000000456672404 | ||
| 996 | ‡2 DNB|124250897X | ||
| 996 | ‡2 LC|no2020060429 | ||
| 996 | ‡2 ISNI|0000000049177318 | ||
| 996 | ‡2 CAOONL|ncf10989813 | ||
| 996 | ‡2 ISNI|0000000063830010 | ||
| 996 | ‡2 ISNI|0000000050932050 | ||
| 996 | ‡2 J9U|987007364524205171 | ||
| 996 | ‡2 ISNI|0000000064158027 | ||
| 996 | ‡2 DNB|129225436X | ||
| 996 | ‡2 LC|n 2015006936 | ||
| 996 | ‡2 LC|nr 93019936 | ||
| 996 | ‡2 DNB|1073129306 | ||
| 996 | ‡2 DNB|113188597X | ||
| 996 | ‡2 DNB|1160334153 | ||
| 996 | ‡2 DNB|1185227296 | ||
| 996 | ‡2 DNB|1089695489 | ||
| 996 | ‡2 LC|n 2008025350 | ||
| 996 | ‡2 LC|nr2003034957 | ||
| 996 | ‡2 PTBNP|1813537 | ||
| 996 | ‡2 DNB|1295128381 | ||
| 996 | ‡2 DNB|1022652907 | ||
| 996 | ‡2 DBC|87097919051854 | ||
| 996 | ‡2 CAOONL|ncf10289374 | ||
| 996 | ‡2 DNB|1149186917 | ||
| 996 | ‡2 LC|n 2015048025 | ||
| 996 | ‡2 PLWABN|9812079819605606 | ||
| 996 | ‡2 J9U|987007281259105171 | ||
| 996 | ‡2 ISNI|0000000120515552 | ||
| 996 | ‡2 DNB|118764306 | ||
| 996 | ‡2 CYT|AC000656567 | ||
| 996 | ‡2 LC|n 2016030979 | ||
| 996 | ‡2 ISNI|0000000100237815 | ||
| 996 | ‡2 ISNI|0000000063355694 | ||
| 996 | ‡2 CYT|AC000007827 | ||
| 996 | ‡2 LC|n 85824448 | ||
| 996 | ‡2 PLWABN|9812746097805606 | ||
| 996 | ‡2 DNB|1256014885 | ||
| 996 | ‡2 ISNI|0000000047142787 | ||
| 996 | ‡2 DNB|1240486847 | ||
| 996 | ‡2 CYT|AC000216258 | ||
| 996 | ‡2 CYT|AC000216259 | ||
| 996 | ‡2 SUDOC|223713716 | ||
| 996 | ‡2 DNB|116155551X | ||
| 996 | ‡2 CYT|AC000216256 | ||
| 996 | ‡2 ISNI|0000000063924957 | ||
| 996 | ‡2 ISNI|0000000044330248 | ||
| 996 | ‡2 DNB|143217380 | ||
| 996 | ‡2 NII|DA07624263 | ||
| 996 | ‡2 DNB|1190230968 | ||
| 996 | ‡2 RERO|A003519057 | ||
| 996 | ‡2 DNB|1216118981 | ||
| 996 | ‡2 DNB|1077636334 | ||
| 996 | ‡2 NTA|140572384 | ||
| 996 | ‡2 BNF|12424954 | ||
| 996 | ‡2 DNB|1054663688 | ||
| 996 | ‡2 DNB|1238385060 | ||
| 996 | ‡2 SUDOC|275076776 | ||
| 996 | ‡2 DNB|1060126281 | ||
| 996 | ‡2 SUDOC|191755273 | ||
| 996 | ‡2 LC|n 2014016390 | ||
| 996 | ‡2 PLWABN|9810547908505606 | ||
| 996 | ‡2 ISNI|0000000064282810 | ||
| 996 | ‡2 PLWABN|9812080184005606 | ||
| 996 | ‡2 LC|no2020060098 | ||
| 996 | ‡2 DNB|1026218292 | ||
| 996 | ‡2 RERO|A003518944 | ||
| 996 | ‡2 LC|nr 94018409 | ||
| 996 | ‡2 J9U|987007381280005171 | ||
| 996 | ‡2 ISNI|000000006335232X | ||
| 996 | ‡2 LC|n 88137436 | ||
| 996 | ‡2 BNF|14524943 | ||
| 996 | ‡2 CYT|AC000635739 | ||
| 996 | ‡2 LC|n 83198012 | ||
| 996 | ‡2 LC|no2005096253 | ||
| 996 | ‡2 DNB|1306292182 | ||
| 996 | ‡2 ISNI|0000000063297359 | ||
| 996 | ‡2 CYT|AC000648871 | ||
| 996 | ‡2 ISNI|0000000063761609 | ||
| 996 | ‡2 PLWABN|9810605985305606 | ||
| 996 | ‡2 ISNI|0000000078425157 | ||
| 996 | ‡2 NSK|000594260 | ||
| 996 | ‡2 LC|nr2003013446 | ||
| 996 | ‡2 ISNI|0000000080450001 | ||
| 996 | ‡2 DNB|1026374987 | ||
| 996 | ‡2 CYT|AC000345055 | ||
| 996 | ‡2 SELIBR|9nk7gmnr726l22sm | ||
| 996 | ‡2 BNF|14423843 | ||
| 996 | ‡2 DNB|126996173X | ||
| 996 | ‡2 ISNI|0000000063947323 | ||
| 996 | ‡2 LC|no2006118324 | ||
| 996 | ‡2 DNB|1336726504 | ||
| 996 | ‡2 LC|n 2004054140 | ||
| 996 | ‡2 DNB|1280658606 | ||
| 996 | ‡2 LC|n 88016086 | ||
| 996 | ‡2 PLWABN|9810591857605606 | ||
| 996 | ‡2 LC|n 2019051668 | ||
| 996 | ‡2 DNB|1014599997 | ||
| 996 | ‡2 NTA|101889682 | ||
| 996 | ‡2 LC|no2015086878 | ||
| 996 | ‡2 CAOONL|ncf11429656 | ||
| 996 | ‡2 ISNI|000000006375728X | ||
| 996 | ‡2 DNB|1293290025 | ||
| 996 | ‡2 DNB|1330996186 | ||
| 996 | ‡2 BIBSYS|90879698 | ||
| 996 | ‡2 NII|DA11107334 | ||
| 996 | ‡2 LC|nr 88004863 | ||
| 996 | ‡2 LC|n 79041355 | ||
| 996 | ‡2 DNB|1190305100 | ||
| 996 | ‡2 ISNI|0000000063100843 | ||
| 996 | ‡2 LC|n 2006093501 | ||
| 996 | ‡2 NUKAT|n 2022017154 | ||
| 996 | ‡2 ISNI|0000000063428267 | ||
| 996 | ‡2 ISNI|000000011073193X | ||
| 996 | ‡2 DNB|1317866940 | ||
| 996 | ‡2 BIBSYS|90380057 | ||
| 996 | ‡2 ISNI|0000000051696387 | ||
| 996 | ‡2 NTA|148837085 | ||
| 996 | ‡2 LC|nr 89011363 | ||
| 996 | ‡2 NII|DA07703847 | ||
| 996 | ‡2 ISNI|0000000039233961 | ||
| 996 | ‡2 DNB|1268838942 | ||
| 996 | ‡2 DNB|1229353518 | ||
| 996 | ‡2 LC|n 2016181010 | ||
| 996 | ‡2 SUDOC|077717597 | ||
| 996 | ‡2 BNC|981058529212406706 | ||
| 996 | ‡2 DNB|1273075129 | ||
| 996 | ‡2 ISNI|000000008311007X | ||
| 996 | ‡2 DNB|123439248 | ||
| 996 | ‡2 BIBSYS|90336093 | ||
| 996 | ‡2 DNB|1013557085 | ||
| 996 | ‡2 BNF|15104335 | ||
| 996 | ‡2 NTA|421655291 | ||
| 996 | ‡2 DNB|1207574775 | ||
| 996 | ‡2 ISNI|0000000121174518 | ||
| 996 | ‡2 DNB|1043852875 | ||
| 996 | ‡2 DNB|1078958297 | ||
| 996 | ‡2 ISNI|0000000394634620 | ||
| 996 | ‡2 LC|no2021057165 | ||
| 996 | ‡2 DNB|141384131 | ||
| 996 | ‡2 DNB|1277318816 | ||
| 996 | ‡2 NSK|000732812 | ||
| 996 | ‡2 DNB|1068939842 | ||
| 996 | ‡2 LC|nr2003034970 | ||
| 996 | ‡2 ISNI|0000000036575704 | ||
| 996 | ‡2 LC|n 2019007988 | ||
| 996 | ‡2 DNB|1292627883 | ||
| 996 | ‡2 J9U|987007304790705171 | ||
| 996 | ‡2 DNB|1137583835 | ||
| 996 | ‡2 SUDOC|169737586 | ||
| 996 | ‡2 DNB|1070534048 | ||
| 996 | ‡2 DNB|1193660920 | ||
| 996 | ‡2 DNB|1077173687 | ||
| 996 | ‡2 DNB|139046569 | ||
| 996 | ‡2 NII|DA12479028 | ||
| 996 | ‡2 PLWABN|9810530146505606 | ||
| 996 | ‡2 SUDOC|280498748 | ||
| 996 | ‡2 NTA|152295577 | ||
| 996 | ‡2 ISNI|000000006374661X | ||
| 996 | ‡2 SZ|141475439 | ||
| 996 | ‡2 CYT|AC000207747 | ||
| 996 | ‡2 DNB|1228384908 | ||
| 996 | ‡2 ISNI|000000038817367X | ||
| 996 | ‡2 DNB|1295228513 | ||
| 996 | ‡2 DNB|1060561271 | ||
| 996 | ‡2 KRNLK|KAC201000842 | ||
| 996 | ‡2 ISNI|0000000071281875 | ||
| 996 | ‡2 BNF|14435957 | ||
| 996 | ‡2 DBC|87097969932134 | ||
| 996 | ‡2 DNB|1310693226 | ||
| 996 | ‡2 CYT|AC000217532 | ||
| 996 | ‡2 ISNI|0000000063702545 | ||
| 996 | ‡2 DNB|1099467802 | ||
| 996 | ‡2 SUDOC|236819011 | ||
| 996 | ‡2 ISNI|0000000063679963 | ||
| 996 | ‡2 NTA|240107527 | ||
| 996 | ‡2 DNB|1046378309 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 | ||
| 998 | ‡a Gang, Li ‡2 DNB|141384131 ‡3 exact name | ||
| 998 | ‡a Gang, Li ‡2 DBC|87097969197655 ‡3 exact name |
