VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q64005972  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241221010850.0
008     241221nneanz||abbn n and d
035 ‎‡a  (WKP)Q64005972‏
024 ‎‡a  0000-0003-0292-0946‏ ‎‡2  orcid‏
024 ‎‡a  7005720156‏ ‎‡2  scopus‏
035 ‎‡a  (OCoLC)Q64005972‏
100 0 ‎‡a  Lidwien AM Smit‏ ‎‡9  sq‏ ‎‡9  es‏ ‎‡9  ast‏
375 ‎‡a  2‏ ‎‡2  iso5218‏
400 0 ‎‡a  Lidwien AM Smit‏ ‎‡c  Dutch scholar‏ ‎‡9  en‏
400 0 ‎‡a  Lidwien Smit‏ ‎‡c  wetenschapper‏ ‎‡9  nl‏
670 ‎‡a  Author's 17q21 variants modify the association between early respiratory infections and asthma‏
670 ‎‡a  Author's A cross-sectional study of lung function and respiratory symptoms among chemical workers producing diacetyl for food flavourings‏
670 ‎‡a  Author's Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏
670 ‎‡a  Author's Abundance and diversity of the fecal resistome in slaughter pigs and broilers in nine European countries‏
670 ‎‡a  Author's Acute respiratory effects of livestock-related air pollution in a panel of COPD patients‏
670 ‎‡a  Author's Agricultural seed dust as a potential cause of organic dust toxic syndrome‏
670 ‎‡a  Author's Air pollution from livestock farms, and asthma, allergic rhinitis and COPD among neighbouring residents‏
670 ‎‡a  Author's Air Pollution from Livestock Farms is Associated with Airway Obstruction in Neighboring Residents‏
670 ‎‡a  Author's Association of antimicrobial usage with faecal abundance of aph(3')-III, ermB, sul2 and tetW resistance genes in veal calves in three European countries‏
670 ‎‡a  Author's Associations between antimicrobial use and the faecal resistome on broiler farms from nine European countries‏
670 ‎‡a  Author's Associations between pneumonia and residential distance to livestock farms over a five-year period in a large population-based study‏
670 ‎‡a  Author's Associations between proximity to livestock farms, primary health care visits and self-reported symptoms‏
670 ‎‡a  Author's Atopy and new-onset asthma in young Danish farmers and CD14, TLR2, and TLR4 genetic polymorphisms: a nested case-control study.‏
670 ‎‡a  Author's Attitude toward livestock farming does not influence the earlier observed association between proximity to goat farms and self-reported pneumonia‏
670 ‎‡a  Author's Author Correction: Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏
670 ‎‡a  Author's Bronchiolitis obliterans syndrome in chemical workers producing diacetyl for food flavorings.‏
670 ‎‡a  Author's CD14and Toll-like Receptor Gene Polymorphisms, Country Living, and Asthma in Adults‏
670 ‎‡a  Author's Clinical and Pathological Findings in SARS-CoV-2 Disease Outbreaks in Farmed Mink (Neovison vison)‏
670 ‎‡a  Author's Comorbidity and coexisting symptoms and infections presented in general practice by COPD patients: Does livestock density in the residential environment play a role?‏
670 ‎‡a  Author's Contact dermatitis in the construction industry: the role of filaggrin loss-of-function mutations.‏
670 ‎‡a  Author's Contact dermatitis is an unrecognized problem in the construction industry: Comparison of four different assessment methods‏
670 ‎‡a  Author's Description and determinants of the faecal resistome and microbiome of farmers and slaughterhouse workers: A metagenome-wide cross-sectional study‏
670 ‎‡a  Author's Detection of Coxiella burnetii in Ambient Air after a Large Q Fever Outbreak‏
670 ‎‡a  Author's Determinants of epoxy allergy in the construction industry: a case-control study‏
670 ‎‡a  Author's Do young adults with childhood asthma avoid occupational exposures at first hire?‏
670 ‎‡a  Author's Doctor-diagnosed health problems in a region with a high density of concentrated animal feeding operations: a cross-sectional study‏
670 ‎‡a  Author's Endotoxin and particulate matter emitted by livestock farms and respiratory health effects in neighboring residents‏
670 ‎‡a  Author's Endotoxin exposure and symptoms in wastewater treatment workers‏
670 ‎‡a  Author's Endotoxin exposure, CD14 and wheeze among farmers: a gene--environment interaction‏
670 ‎‡a  Author's Endotoxin exposure in sewage treatment workers: investigation of exposure variability and comparison of analytical techniques‏
670 ‎‡a  Author's Evaluation of Patients with Community-Acquired Pneumonia Caused by Zoonotic Pathogens in an Area with a High Density of Animal Farms‏
670 ‎‡a  Author's Ex vivo cytokine release reflects sensitivity to occupational endotoxin exposure.‏
670 ‎‡a  Author's Exhaled nitric oxide in endotoxin-exposed adults: effect modification by smoking and atopy‏
670 ‎‡a  Author's Exposure-response analysis of allergy and respiratory symptoms in endotoxin-exposed adults.‏
670 ‎‡a  Author's Extended-spectrum β-lactamase- and pAmpC-producing Enterobacteriaceae among the general population in a livestock-dense area.‏
670 ‎‡a  Author's Farm dust resistomes and bacterial microbiomes in European poultry and pig farms‏
670 ‎‡a  Author's Farmers' knowledge and expectations of antimicrobial use and resistance are strongly related to usage in Dutch livestock sectors‏
670 ‎‡a  Author's Fecal Carriage of Extended-Spectrum-β-Lactamase/AmpC-Producing Escherichia coli in Horses‏
670 ‎‡a  Author's Gender differences in lung function recovery after cessation of occupational endotoxin exposure: a complex story‏
670 ‎‡a  Author's Gene-environment interactions in the study of asthma in the postgenomewide association studies era.‏
670 ‎‡a  Author's Genetic and environmental factors of asthma and allergy: Results of the EGEA study‏
670 ‎‡a  Author's Go slow to go fast: A plea for sustained scientific rigor in air pollution research during the COVID-19 pandemic‏
670 ‎‡a  Author's Hay fever and asthma symptoms in conventional and organic farmers in The Netherlands‏
670 ‎‡a  Author's Health conditions in rural areas with high livestock density: Analysis of seven consecutive years‏
670 ‎‡a  Author's Health effects of occupational endotoxin exposure: a review and relevance to veterinary practice‏
670 ‎‡a  Author's Healthcare utilisation prior to the diagnosis of inflammatory bowel diseases and the influence of livestock exposure: A longitudinal case-control study.‏
670 ‎‡a  Author's Healthy worker survivor analysis in an occupational cohort study of Dutch agricultural workers‏
670 ‎‡a  Author's Hepatitis E virus seroprevalence among the general population in a livestock-dense area in the Netherlands: a cross-sectional population-based serological survey‏
670 ‎‡a  Author's Home Assessment of Indoor Microbiome (HAIM) in Relation to Lower Respiratory Tract Infections among Under-Five Children in Ibadan, Nigeria: The Study Protocol‏
670 ‎‡a  Author's Human leukocyte antigen class II variants and adult-onset asthma: does occupational allergen exposure play a role?‏
670 ‎‡a  Author's IgG to various beta-glucans in a human adult population‏
670 ‎‡a  Author's Impacts of Intensive Livestock Production on Human Health in Densely Populated Regions‏
670 ‎‡a  Author's Increased respiratory symptoms in COPD patients living in the vicinity of livestock farms‏
670 ‎‡a  Author's Increased risk of pneumonia in residents living near poultry farms: does the upper respiratory tract microbiota play a role?‏
670 ‎‡a  Author's Influence of different cleaning practices on endotoxin exposure at sewage treatment plants‏
670 ‎‡a  Author's Lack of a Distinct Gradient in Biomarker Responses in Small Mammals Collected at Different Distances from a Highway‏
670 ‎‡a  Author's Livestock-associated risk factors for pneumonia in an area of intensive animal farming in the Netherlands‏
670 ‎‡a  Author's Long-term carriage of extended-spectrum β-lactamase-producing Escherichia coli and Klebsiella pneumoniae in the general population in the Netherlands‏
670 ‎‡a  Author's Loss of function of transient receptor potential vanilloid 1 (TRPV1) genetic variant is associated with lower risk of active childhood asthma‏
670 ‎‡a  Author's Mobility assessment of a rural population in the Netherlands using GPS measurements‏
670 ‎‡a  Author's Morbidity Rates in an Area with High Livestock Density: A Registry-Based Study Including Different Groups of Patients with Respiratory Health Problems‏
670 ‎‡a  Author's MRSA in persons not living or working on a farm in a livestock-dense area: prevalence and risk factors‏
670 ‎‡a  Author's Neurological symptoms among Sri Lankan farmers occupationally exposed to acetylcholinesterase-inhibiting insecticides.‏
670 ‎‡a  Author's Occupational and environmental exposure to SARS-CoV-2 in and around infected mink farms‏
670 ‎‡a  Author's Occupational endotoxin exposure in association with atopic sensitization and respiratory health in adults: Results of a 5-year follow-up‏
670 ‎‡a  Author's Occupational endotoxin exposure reduces the risk of atopic sensitization but increases the risk of bronchial hyperresponsiveness‏
670 ‎‡a  Author's Occupational Exposure and Carriage of Antimicrobial Resistance Genes (tetW, ermB) in Pig Slaughterhouse Workers‏
670 ‎‡a  Author's Occupational exposure to indoor air pollution among bakery workers in Ethiopia; A comparison of electric and biomass cookstoves.‏
670 ‎‡a  Author's Odour annoyance in the neighbourhood of livestock farming - perceived health and health care seeking behaviour‏
670 ‎‡a  Author's P-396: Partial Least Squares Regression of Serum Levels of Environmental Contaminants and Reproductive Markers in Males from Greenland, Poland and Ukraine‏
670 ‎‡a  Author's Panel studies of air pollution in patients with COPD: Systematic review and meta-analysis‏
670 ‎‡a  Author's Patients with overlapping diagnoses of asthma and COPD: is livestock exposure a risk factor for comorbidity and coexisting symptoms and infections?‏
670 ‎‡a  Author's Pesticide poisoning in the developing world--a minimum pesticides list‏
670 ‎‡a  Author's Phthalates, perfluoroalkyl acids, metals and organochlorines and reproductive function: a multipollutant assessment in Greenlandic, Polish and Ukrainian men.‏
670 ‎‡a  Author's Pneumonia risk of people living close to goat and poultry farms – Taking GPS derived mobility patterns into account‏
670 ‎‡a  Author's Prenatal exposure to environmental chemical contaminants and asthma and eczema in school-age children.‏
670 ‎‡a  Author's Prevalence and risk factors for colonization of Clostridium difficile among adults living near livestock farms in the Netherlands‏
670 ‎‡a  Author's Prevalence of non-specific health symptoms in livestock dense areas: Looking beyond respiratory conditions‏
670 ‎‡a  Author's Proximity to livestock farms and exposure to livestock-related particulate matter are associated with lower probability of medication dispensing for obstructive airway diseases‏
670 ‎‡a  Author's Q fever and pneumonia in an area with a high livestock density: a large population-based study‏
670 ‎‡a  Author's Remarkable spatial variation in the seroprevalence of Coxiella burnetii after a large Q fever epidemic‏
670 ‎‡a  Author's Residential proximity to livestock farms is associated with a lower prevalence of atopy.‏
670 ‎‡a  Author's Respiratory health effects in agricultural workers: are some more susceptible than others?‏
670 ‎‡a  Author's Respiratory health effects of exposure to low levels of airborne endotoxin - a systematic review‏
670 ‎‡a  Author's Risk Factors for Antimicrobial Resistance in Turkey Farms: A Cross-Sectional Study in Three European Countries‏
670 ‎‡a  Author's Risk of exacerbations in COPD and asthma patients living in the neighbourhood of livestock farms: Observational study using longitudinal data‏
670 ‎‡a  Author's Risk of pneumonia among residents living near goat and poultry farms during 2014-2016‏
670 ‎‡a  Author's Sensitisation to common allergens and respiratory symptoms in endotoxin exposed workers: a pooled analysis.‏
670 ‎‡a  Author's Serologic Screening of Severe Acute Respiratory Syndrome Coronavirus 2 Infection in Cats and Dogs during First Coronavirus Disease Wave, the Netherlands‏
670 ‎‡a  Author's Serum concentrations of polybrominated diphenyl ethers (PBDEs) and a polybrominated biphenyl (PBB) in men from Greenland, Poland and Ukraine‏
670 ‎‡a  Author's Skin symptoms in the construction industry: occurrence and determinants‏
670 ‎‡a  Author's Spirometry, questionnaire and electronic medical record based COPD in a population survey: Comparing prevalence, level of agreement and associations with potential risk factors‏
670 ‎‡a  Author's Stability of individual LPS-induced ex vivo cytokine release in a whole blood assay over a five-year interval‏
670 ‎‡a  Author's The antimicrobial resistome in relation to antimicrobial use and biosecurity in pig farming, a metagenome-wide association study in nine European countries‏
670 ‎‡a  Author's The relation between modeled odor exposure from livestock farming and odor annoyance among neighboring residents.‏
670 ‎‡a  Author's Transient receptor potential genes, smoking, occupational exposures and cough in adults‏
670 ‎‡a  Author's Transmission of SARS-CoV-2 on mink farms between humans and mink and back to humans‏
670 ‎‡a  Author's Validation of a questionnaire on hand hygiene in the construction industry.‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/processed/NTA|311470882‏
670 ‎‡a  wikidata authority control‏ ‎‡u  https://viaf.org/viaf/284969857‏
909 ‎‡a  (scopus) 7005720156‏ ‎‡9  1‏
909 ‎‡a  (orcid) 0000000302920946‏ ‎‡9  1‏
919 ‎‡a  fecalcarriageofextendedspectrumβlactamaseampcproducingescherichiacoliinhorses‏ ‎‡A  Fecal Carriage of Extended-Spectrum-β-Lactamase/AmpC-Producing Escherichia coli in Horses‏ ‎‡9  1‏
919 ‎‡a  geneenvironmentinteractionsinthestudyofasthmainthepostgenomewideassociationstudiesera‏ ‎‡A  Gene-environment interactions in the study of asthma in the postgenomewide association studies era.‏ ‎‡9  1‏
919 ‎‡a  geneticandenvironmentalfactorsofasthmaandallergyresultsoftheegeastudy‏ ‎‡A  Genetic and environmental factors of asthma and allergy: Results of the EGEA study‏ ‎‡9  1‏
919 ‎‡a  5slowto5fastapleaforsustainedscientificrigorinairpollutionresearchduringthecovid19pandemic‏ ‎‡A  Go slow to go fast: A plea for sustained scientific rigor in air pollution research during the COVID-19 pandemic‏ ‎‡9  1‏
919 ‎‡a  hayfeverandasthmasymptomsinconventionalandorganicfarmersinthenetherlands‏ ‎‡A  Hay fever and asthma symptoms in conventional and organic farmers in The Netherlands‏ ‎‡9  1‏
919 ‎‡a  healthconditionsinruralareaswithhighlivestockdensityanalysisof7consecutiveyears‏ ‎‡A  Health conditions in rural areas with high livestock density: Analysis of seven consecutive years‏ ‎‡9  1‏
919 ‎‡a  healtheffectsofoccupationalendotoxinexposureareviewandrelevancetoveterinarypractice‏ ‎‡A  Health effects of occupational endotoxin exposure: a review and relevance to veterinary practice‏ ‎‡9  1‏
919 ‎‡a  healthcareutilisationpriortothediagnosisofinflammatoryboweldiseasesandtheinfluenceoflivestockexposurealongitudinalcasecontrolstudy‏ ‎‡A  Healthcare utilisation prior to the diagnosis of inflammatory bowel diseases and the influence of livestock exposure: A longitudinal case-control study.‏ ‎‡9  1‏
919 ‎‡a  healthyworkersurvivoranalysisinanoccupationalcohortstudyofdutchagriculturalworkers‏ ‎‡A  Healthy worker survivor analysis in an occupational cohort study of Dutch agricultural workers‏ ‎‡9  1‏
919 ‎‡a  hepatitisevirusseroprevalenceamongthegeneralpopulationinalivestockdenseareainthenetherlandsacrosssectionalpopulationbasedserologicalsurvey‏ ‎‡A  Hepatitis E virus seroprevalence among the general population in a livestock-dense area in the Netherlands: a cross-sectional population-based serological survey‏ ‎‡9  1‏
919 ‎‡a  homeassessmentofindoormicrobiomehaiminrelationtolowerrespiratorytractinfectionsamongunder5childreninibadannigeriathestudyprotocol‏ ‎‡A  Home Assessment of Indoor Microbiome (HAIM) in Relation to Lower Respiratory Tract Infections among Under-Five Children in Ibadan, Nigeria: The Study Protocol‏ ‎‡9  1‏
919 ‎‡a  humanleukocyteantigenclass2variantsandadultonsetasthmadoesoccupationalallergenexposureplayarole‏ ‎‡A  Human leukocyte antigen class II variants and adult-onset asthma: does occupational allergen exposure play a role?‏ ‎‡9  1‏
919 ‎‡a  iggtovariousbetaglucansinahumanadultpopulation‏ ‎‡A  IgG to various beta-glucans in a human adult population‏ ‎‡9  1‏
919 ‎‡a  impactsofintensivelivestockproductiononhumanhealthindenselypopulatedregions‏ ‎‡A  Impacts of Intensive Livestock Production on Human Health in Densely Populated Regions‏ ‎‡9  1‏
919 ‎‡a  increasedrespiratorysymptomsincopdpatientslivinginthevicinityoflivestockfarms‏ ‎‡A  Increased respiratory symptoms in COPD patients living in the vicinity of livestock farms‏ ‎‡9  1‏
919 ‎‡a  increasedriskofpneumoniainresidentslivingnearpoultryfarmsdoestheupperrespiratorytractmicrobiotaplayarole‏ ‎‡A  Increased risk of pneumonia in residents living near poultry farms: does the upper respiratory tract microbiota play a role?‏ ‎‡9  1‏
919 ‎‡a  influenceofdifferentcleaningpracticesonendotoxinexposureatsewagetreatmentplants‏ ‎‡A  Influence of different cleaning practices on endotoxin exposure at sewage treatment plants‏ ‎‡9  1‏
919 ‎‡a  lackofadistinctgradientinbiomarkerresponsesinsmallmammalscollectedatdifferentdistancesfromahighway‏ ‎‡A  Lack of a Distinct Gradient in Biomarker Responses in Small Mammals Collected at Different Distances from a Highway‏ ‎‡9  1‏
919 ‎‡a  livestockassociatedriskfactorsforpneumoniainanareaofintensiveanimalfarminginthenetherlands‏ ‎‡A  Livestock-associated risk factors for pneumonia in an area of intensive animal farming in the Netherlands‏ ‎‡9  1‏
919 ‎‡a  longtermcarriageofextendedspectrumβlactamaseproducingescherichiacoliandklebsiellapneumoniaeinthegeneralpopulationinthenetherlands‏ ‎‡A  Long-term carriage of extended-spectrum β-lactamase-producing Escherichia coli and Klebsiella pneumoniae in the general population in the Netherlands‏ ‎‡9  1‏
919 ‎‡a  lossoffunctionoftransientreceptorpotentialvanilloid1trpv1geneticvariantisassociatedwithlowerriskofactivechildhoodasthma‏ ‎‡A  Loss of function of transient receptor potential vanilloid 1 (TRPV1) genetic variant is associated with lower risk of active childhood asthma‏ ‎‡9  1‏
919 ‎‡a  mobilityassessmentofaruralpopulationinthenetherlandsusinggpsmeasurements‏ ‎‡A  Mobility assessment of a rural population in the Netherlands using GPS measurements‏ ‎‡9  1‏
919 ‎‡a  morbidityratesinanareawithhighlivestockdensityaregistrybasedstudyincludingdifferentgroupsofpatientswithrespiratoryhealthproblems‏ ‎‡A  Morbidity Rates in an Area with High Livestock Density: A Registry-Based Study Including Different Groups of Patients with Respiratory Health Problems‏ ‎‡9  1‏
919 ‎‡a  mrsainpersonsnotlivingorworkingonafarminalivestockdenseareaprevalenceandriskfactors‏ ‎‡A  MRSA in persons not living or working on a farm in a livestock-dense area: prevalence and risk factors‏ ‎‡9  1‏
919 ‎‡a  neurologicalsymptomsamongsrilankanfarmersoccupationallyexposedtoacetylcholinesteraseinhibitinginsecticides‏ ‎‡A  Neurological symptoms among Sri Lankan farmers occupationally exposed to acetylcholinesterase-inhibiting insecticides.‏ ‎‡9  1‏
919 ‎‡a  occupationalandenvironmentalexposuretosarscov2inandaroundinfectedminkfarms‏ ‎‡A  Occupational and environmental exposure to SARS-CoV-2 in and around infected mink farms‏ ‎‡9  1‏
919 ‎‡a  occupationalendotoxinexposureinassociationwithatopicsensitizationandrespiratoryhealthinadultsresultsofa5yearfollowup‏ ‎‡A  Occupational endotoxin exposure in association with atopic sensitization and respiratory health in adults: Results of a 5-year follow-up‏ ‎‡9  1‏
919 ‎‡a  associationsbetweenpneumoniaandresidentialdistancetolivestockfarmsovera5yearperiodinalargepopulationbasedstudy‏ ‎‡A  Associations between pneumonia and residential distance to livestock farms over a five-year period in a large population-based study‏ ‎‡9  1‏
919 ‎‡a  occupationalendotoxinexposurereducestheriskofatopicsensitizationbutincreasestheriskofbronchialhyperresponsiveness‏ ‎‡A  Occupational endotoxin exposure reduces the risk of atopic sensitization but increases the risk of bronchial hyperresponsiveness‏ ‎‡9  1‏
919 ‎‡a  occupationalexposureandcarriageofantimicrobialresistancegenestetwermbinpigslaughterhouseworkers‏ ‎‡A  Occupational Exposure and Carriage of Antimicrobial Resistance Genes (tetW, ermB) in Pig Slaughterhouse Workers‏ ‎‡9  1‏
919 ‎‡a  associationsbetweenantimicrobialuseandthefaecalresistomeonbroilerfarmsfrom9europeancountries‏ ‎‡A  Associations between antimicrobial use and the faecal resistome on broiler farms from nine European countries‏ ‎‡9  1‏
919 ‎‡a  occupationalexposuretoindoorairpollutionamongbakeryworkersinethiopiaacomparisonofelectricandbiomasscookstoves‏ ‎‡A  Occupational exposure to indoor air pollution among bakery workers in Ethiopia; A comparison of electric and biomass cookstoves.‏ ‎‡9  1‏
919 ‎‡a  odourannoyanceintheneighbourhoodoflivestockfarmingperceivedhealthandhealthcareseekingbehaviour‏ ‎‡A  Odour annoyance in the neighbourhood of livestock farming - perceived health and health care seeking behaviour‏ ‎‡9  1‏
919 ‎‡a  associationofantimicrobialusagewithfaecalabundanceofaph33ermbsul2andtetwresistancegenesinvealcalvesin3europeancountries‏ ‎‡A  Association of antimicrobial usage with faecal abundance of aph(3')-III, ermB, sul2 and tetW resistance genes in veal calves in three European countries‏ ‎‡9  1‏
919 ‎‡a  p396partialleastsquaresregressionofserumlevelsofenvironmentalcontaminantsandreproductivemarkersinmalesfromgreenlandpolandandukraine‏ ‎‡A  P-396: Partial Least Squares Regression of Serum Levels of Environmental Contaminants and Reproductive Markers in Males from Greenland, Poland and Ukraine‏ ‎‡9  1‏
919 ‎‡a  panelstudiesofairpollutioninpatientswithcopdsystematicreviewandmetaanalysis‏ ‎‡A  Panel studies of air pollution in patients with COPD: Systematic review and meta-analysis‏ ‎‡9  1‏
919 ‎‡a  airpollutionfromlivestockfarmsisassociatedwithairwayobstructioninneighboringresidents‏ ‎‡A  Air Pollution from Livestock Farms is Associated with Airway Obstruction in Neighboring Residents‏ ‎‡9  1‏
919 ‎‡a  patientswithoverlappingdiagnosesofasthmaandcopdislivestockexposureariskfactorforcomorbidityandcoexistingsymptomsandinfections‏ ‎‡A  Patients with overlapping diagnoses of asthma and COPD: is livestock exposure a risk factor for comorbidity and coexisting symptoms and infections?‏ ‎‡9  1‏
919 ‎‡a  pesticidepoisoninginthedevelopingworldaminimumpesticideslist‏ ‎‡A  Pesticide poisoning in the developing world--a minimum pesticides list‏ ‎‡9  1‏
919 ‎‡a  airpollutionfromlivestockfarmsandasthmaallergicrhinitisandcopdamongneighbouringresidents‏ ‎‡A  Air pollution from livestock farms, and asthma, allergic rhinitis and COPD among neighbouring residents‏ ‎‡9  1‏
919 ‎‡a  phthalatesperfluoroalkylacidsmetalsandorganochlorinesandreproductivefunctionamultipollutantassessmentingreenlandicpolishandukrainianmen‏ ‎‡A  Phthalates, perfluoroalkyl acids, metals and organochlorines and reproductive function: a multipollutant assessment in Greenlandic, Polish and Ukrainian men.‏ ‎‡9  1‏
919 ‎‡a  pneumoniariskofpeoplelivingclosetogoatandpoultryfarmstakinggpsderivedmobilitypatternsintoaccount‏ ‎‡A  Pneumonia risk of people living close to goat and poultry farms – Taking GPS derived mobility patterns into account‏ ‎‡9  1‏
919 ‎‡a  agriculturalseeddustasapotentialcauseoforganicdusttoxicsyndrome‏ ‎‡A  Agricultural seed dust as a potential cause of organic dust toxic syndrome‏ ‎‡9  1‏
919 ‎‡a  prenatalexposuretoenvironmentalchemicalcontaminantsandasthmaandeczemainschoolagechildren‏ ‎‡A  Prenatal exposure to environmental chemical contaminants and asthma and eczema in school-age children.‏ ‎‡9  1‏
919 ‎‡a  prevalenceandriskfactorsforcolonizationofclostridiumdifficileamongadultslivingnearlivestockfarmsinthenetherlands‏ ‎‡A  Prevalence and risk factors for colonization of Clostridium difficile among adults living near livestock farms in the Netherlands‏ ‎‡9  1‏
919 ‎‡a  acuterespiratoryeffectsoflivestockrelatedairpollutioninapanelofcopdpatients‏ ‎‡A  Acute respiratory effects of livestock-related air pollution in a panel of COPD patients‏ ‎‡9  1‏
919 ‎‡a  prevalenceofnonspecifichealthsymptomsinlivestockdenseareaslookingbeyondrespiratoryconditions‏ ‎‡A  Prevalence of non-specific health symptoms in livestock dense areas: Looking beyond respiratory conditions‏ ‎‡9  1‏
919 ‎‡a  proximitytolivestockfarmsandexposuretolivestockrelatedparticulatematterareassociatedwithlowerprobabilityofmedicationdispensingforobstructiveairwaydiseases‏ ‎‡A  Proximity to livestock farms and exposure to livestock-related particulate matter are associated with lower probability of medication dispensing for obstructive airway diseases‏ ‎‡9  1‏
919 ‎‡a  abundanceanddiversityofthefecalresistomeinslaughterpigsandbroilersin9europeancountries‏ ‎‡A  Abundance and diversity of the fecal resistome in slaughter pigs and broilers in nine European countries‏ ‎‡9  1‏
919 ‎‡a  qfeverandpneumoniainanareawithahighlivestockdensityalargepopulationbasedstudy‏ ‎‡A  Q fever and pneumonia in an area with a high livestock density: a large population-based study‏ ‎‡9  1‏
919 ‎‡a  remarkablespatialvariationintheseroprevalenceofcoxiellaburnetiiafteralargeqfeverepidemic‏ ‎‡A  Remarkable spatial variation in the seroprevalence of Coxiella burnetii after a large Q fever epidemic‏ ‎‡9  1‏
919 ‎‡a  residentialproximitytolivestockfarmsisassociatedwithalowerprevalenceofatopy‏ ‎‡A  Residential proximity to livestock farms is associated with a lower prevalence of atopy.‏ ‎‡9  1‏
919 ‎‡a  respiratoryhealtheffectsinagriculturalworkersaresomemoresusceptiblethanothers‏ ‎‡A  Respiratory health effects in agricultural workers: are some more susceptible than others?‏ ‎‡9  1‏
919 ‎‡a  respiratoryhealtheffectsofexposuretolowlevelsofairborneendotoxinasystematicreview‏ ‎‡A  Respiratory health effects of exposure to low levels of airborne endotoxin - a systematic review‏ ‎‡9  1‏
919 ‎‡a  riskfactorsforantimicrobialresistanceinturkeyfarmsacrosssectionalstudyin3europeancountries‏ ‎‡A  Risk Factors for Antimicrobial Resistance in Turkey Farms: A Cross-Sectional Study in Three European Countries‏ ‎‡9  1‏
919 ‎‡a  riskofexacerbationsincopdandasthmapatientslivingintheneighbourhoodoflivestockfarmsobservationalstudyusinglongitudinaldata‏ ‎‡A  Risk of exacerbations in COPD and asthma patients living in the neighbourhood of livestock farms: Observational study using longitudinal data‏ ‎‡9  1‏
919 ‎‡a  riskofpneumoniaamongresidentslivingneargoatandpoultryfarmsduring2014‏ ‎‡A  Risk of pneumonia among residents living near goat and poultry farms during 2014-2016‏ ‎‡9  1‏
919 ‎‡a  sensitisationtocommonallergensandrespiratorysymptomsinendotoxinexposedworkersapooledanalysis‏ ‎‡A  Sensitisation to common allergens and respiratory symptoms in endotoxin exposed workers: a pooled analysis.‏ ‎‡9  1‏
919 ‎‡a  serologicscreeningofsevereacuterespiratorysyndromecoronavirus2infectionincatsanddogsduring1coronavirusdiseasewavethenetherlands‏ ‎‡A  Serologic Screening of Severe Acute Respiratory Syndrome Coronavirus 2 Infection in Cats and Dogs during First Coronavirus Disease Wave, the Netherlands‏ ‎‡9  1‏
919 ‎‡a  serumconcentrationsofpolybrominateddiphenyletherspbdesandapolybrominatedbiphenylpbbinmenfromgreenlandpolandandukraine‏ ‎‡A  Serum concentrations of polybrominated diphenyl ethers (PBDEs) and a polybrominated biphenyl (PBB) in men from Greenland, Poland and Ukraine‏ ‎‡9  1‏
919 ‎‡a  skinsymptomsintheconstructionindustryoccurrenceanddeterminants‏ ‎‡A  Skin symptoms in the construction industry: occurrence and determinants‏ ‎‡9  1‏
919 ‎‡a  spirometryquestionnaireandelectronicmedicalrecordbasedcopdinapopulationsurveycomparingprevalencelevelofagreementandassociationswithpotentialriskfactors‏ ‎‡A  Spirometry, questionnaire and electronic medical record based COPD in a population survey: Comparing prevalence, level of agreement and associations with potential risk factors‏ ‎‡9  1‏
919 ‎‡a  stabilityofindividuallpsinducedexvivocytokinereleaseinawholebloodassayovera5yearinterval‏ ‎‡A  Stability of individual LPS-induced ex vivo cytokine release in a whole blood assay over a five-year interval‏ ‎‡9  1‏
919 ‎‡a  antimicrobialresistomeinrelationtoantimicrobialuseandbiosecurityinpigfarmingametagenomewideassociationstudyin9europeancountries‏ ‎‡A  The antimicrobial resistome in relation to antimicrobial use and biosecurity in pig farming, a metagenome-wide association study in nine European countries‏ ‎‡9  1‏
919 ‎‡a  relationbetweenmodeledodorexposurefromlivestockfarmingandodorannoyanceamongneighboringresidents‏ ‎‡A  The relation between modeled odor exposure from livestock farming and odor annoyance among neighboring residents.‏ ‎‡9  1‏
919 ‎‡a  transientreceptorpotentialgenessmokingoccupationalexposuresandcoughinadults‏ ‎‡A  Transient receptor potential genes, smoking, occupational exposures and cough in adults‏ ‎‡9  1‏
919 ‎‡a  transmissionofsarscov2onminkfarmsbetweenhumansandminkandbacktohumans‏ ‎‡A  Transmission of SARS-CoV-2 on mink farms between humans and mink and back to humans‏ ‎‡9  1‏
919 ‎‡a  validationofaquestionnaireonhandhygieneintheconstructionindustry‏ ‎‡A  Validation of a questionnaire on hand hygiene in the construction industry.‏ ‎‡9  1‏
919 ‎‡a  abundanceanddiversityofthefaecalresistomeinslaughterpigsandbroilersin9europeancountries‏ ‎‡A  Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏ ‎‡9  1‏
919 ‎‡a  genderdifferencesinlungfunctionrecoveryaftercessationofoccupationalendotoxinexposure‏ ‎‡A  Gender differences in lung function recovery after cessation of occupational endotoxin exposure: a complex story‏ ‎‡9  1‏
919 ‎‡a  crosssectionalstudyoflungfunctionandrespiratorysymptomsamongchemicalworkersproducingdiacetylforfoodflavourings‏ ‎‡A  A cross-sectional study of lung function and respiratory symptoms among chemical workers producing diacetyl for food flavourings‏ ‎‡9  1‏
919 ‎‡a  17q21variantsmodifytheassociationbetweenearlyrespiratoryinfectionsandasthma‏ ‎‡A  17q21 variants modify the association between early respiratory infections and asthma‏ ‎‡9  1‏
919 ‎‡a  associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms‏ ‎‡A  Associations between proximity to livestock farms, primary health care visits and self-reported symptoms‏ ‎‡9  1‏
919 ‎‡a  atopyandnewonsetasthmainyoungdanishfarmersandcd14tlr2andtlr4geneticpolymorphismsanestedcasecontrolstudy‏ ‎‡A  Atopy and new-onset asthma in young Danish farmers and CD14, TLR2, and TLR4 genetic polymorphisms: a nested case-control study.‏ ‎‡9  1‏
919 ‎‡a  attitudetowardlivestockfarmingdoesnotinfluencetheearlierobservedassociationbetweenproximitytogoatfarmsandselfreportedpneumonia‏ ‎‡A  Attitude toward livestock farming does not influence the earlier observed association between proximity to goat farms and self-reported pneumonia‏ ‎‡9  1‏
919 ‎‡a  authorcorrectionabundanceanddiversityofthefaecalresistomeinslaughterpigsandbroilersin9europeancountries‏ ‎‡A  Author Correction: Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏ ‎‡9  1‏
919 ‎‡a  bronchiolitisobliteranssyndromeinchemicalworkersproducingdiacetylforfoodflavorings‏ ‎‡A  Bronchiolitis obliterans syndrome in chemical workers producing diacetyl for food flavorings.‏ ‎‡9  1‏
919 ‎‡a  cd14andtolllikereceptorgenepolymorphismscountrylivingandasthmainadults‏ ‎‡A  CD14and Toll-like Receptor Gene Polymorphisms, Country Living, and Asthma in Adults‏ ‎‡9  1‏
919 ‎‡a  clinicalandpathologicalfindingsinsarscov2diseaseoutbreaksinfarmedminkneovisonvison‏ ‎‡A  Clinical and Pathological Findings in SARS-CoV-2 Disease Outbreaks in Farmed Mink (Neovison vison)‏ ‎‡9  1‏
919 ‎‡a  comorbidityandcoexistingsymptomsandinfectionspresentedingeneralpracticebycopdpatientsdoeslivestockdensityintheresidentialenvironmentplayarole‏ ‎‡A  Comorbidity and coexisting symptoms and infections presented in general practice by COPD patients: Does livestock density in the residential environment play a role?‏ ‎‡9  1‏
919 ‎‡a  contactdermatitisintheconstructionindustrytheroleoffilaggrinlossoffunctionmutations‏ ‎‡A  Contact dermatitis in the construction industry: the role of filaggrin loss-of-function mutations.‏ ‎‡9  1‏
919 ‎‡a  contactdermatitisisanunrecognizedproblemintheconstructionindustrycomparisonof4differentassessmentmethods‏ ‎‡A  Contact dermatitis is an unrecognized problem in the construction industry: Comparison of four different assessment methods‏ ‎‡9  1‏
919 ‎‡a  descriptionanddeterminantsofthefaecalresistomeandmicrobiomeoffarmersandslaughterhouseworkersametagenomewidecrosssectionalstudy‏ ‎‡A  Description and determinants of the faecal resistome and microbiome of farmers and slaughterhouse workers: A metagenome-wide cross-sectional study‏ ‎‡9  1‏
919 ‎‡a  detectionofcoxiellaburnetiiinambientairafteralargeqfeveroutbreak‏ ‎‡A  Detection of Coxiella burnetii in Ambient Air after a Large Q Fever Outbreak‏ ‎‡9  1‏
919 ‎‡a  determinantsofepoxyallergyintheconstructionindustryacasecontrolstudy‏ ‎‡A  Determinants of epoxy allergy in the construction industry: a case-control study‏ ‎‡9  1‏
919 ‎‡a  doyoungadultswithchildhoodasthmaavoidoccupationalexposuresat1hire‏ ‎‡A  Do young adults with childhood asthma avoid occupational exposures at first hire?‏ ‎‡9  1‏
919 ‎‡a  doctordiagnosedhealthproblemsinaregionwithahighdensityofconcentratedanimalfeedingoperationsacrosssectionalstudy‏ ‎‡A  Doctor-diagnosed health problems in a region with a high density of concentrated animal feeding operations: a cross-sectional study‏ ‎‡9  1‏
919 ‎‡a  endotoxinandparticulatematteremittedbylivestockfarmsandrespiratoryhealtheffectsinneighboringresidents‏ ‎‡A  Endotoxin and particulate matter emitted by livestock farms and respiratory health effects in neighboring residents‏ ‎‡9  1‏
919 ‎‡a  endotoxinexposureandsymptomsinwastewatertreatmentworkers‏ ‎‡A  Endotoxin exposure and symptoms in wastewater treatment workers‏ ‎‡9  1‏
919 ‎‡a  endotoxinexposurecd14andwheezeamongfarmersageneenvironmentinteraction‏ ‎‡A  Endotoxin exposure, CD14 and wheeze among farmers: a gene--environment interaction‏ ‎‡9  1‏
919 ‎‡a  endotoxinexposureinsewagetreatmentworkersinvestigationofexposurevariabilityandcomparisonofanalyticaltechniques‏ ‎‡A  Endotoxin exposure in sewage treatment workers: investigation of exposure variability and comparison of analytical techniques‏ ‎‡9  1‏
919 ‎‡a  evaluationofpatientswithcommunityacquiredpneumoniacausedbyzoonoticpathogensinanareawithahighdensityofanimalfarms‏ ‎‡A  Evaluation of Patients with Community-Acquired Pneumonia Caused by Zoonotic Pathogens in an Area with a High Density of Animal Farms‏ ‎‡9  1‏
919 ‎‡a  exvivocytokinereleasereflectssensitivitytooccupationalendotoxinexposure‏ ‎‡A  Ex vivo cytokine release reflects sensitivity to occupational endotoxin exposure.‏ ‎‡9  1‏
919 ‎‡a  exhalednitricoxideinendotoxinexposedadultseffectmodificationbysmokingandatopy‏ ‎‡A  Exhaled nitric oxide in endotoxin-exposed adults: effect modification by smoking and atopy‏ ‎‡9  1‏
919 ‎‡a  exposureresponseanalysisofallergyandrespiratorysymptomsinendotoxinexposedadults‏ ‎‡A  Exposure-response analysis of allergy and respiratory symptoms in endotoxin-exposed adults.‏ ‎‡9  1‏
919 ‎‡a  extendedspectrumβlactamaseandpampcproducingenterobacteriaceaeamongthegeneralpopulationinalivestockdensearea‏ ‎‡A  Extended-spectrum β-lactamase- and pAmpC-producing Enterobacteriaceae among the general population in a livestock-dense area.‏ ‎‡9  1‏
919 ‎‡a  farmdustresistomesandbacterialmicrobiomesineuropeanpoultryandpigfarms‏ ‎‡A  Farm dust resistomes and bacterial microbiomes in European poultry and pig farms‏ ‎‡9  1‏
919 ‎‡a  farmersknowledgeandexpectationsofantimicrobialuseandresistancearestronglyrelatedtousageindutchlivestocksectors‏ ‎‡A  Farmers' knowledge and expectations of antimicrobial use and resistance are strongly related to usage in Dutch livestock sectors‏ ‎‡9  1‏
943 ‎‡a  201x‏ ‎‡A  2016‏ ‎‡9  1‏
946 ‎‡a  a‏ ‎‡9  1‏
996 ‎‡2  NTA|298298295‏
996 ‎‡2  NTA|408557737‏
996 ‎‡2  ISNI|000000039394458X‏
996 ‎‡2  NTA|181583372‏
996 ‎‡2  ISNI|0000000388945422‏
996 ‎‡2  ISNI|0000000396394202‏
996 ‎‡2  NTA|323265170‏
996 ‎‡2  NTA|073512559‏
996 ‎‡2  ISNI|0000000394122641‏
996 ‎‡2  NTA|325852405‏
996 ‎‡2  NTA|068183453‏
996 ‎‡2  NTA|421551690‏
996 ‎‡2  NTA|190184078‏
996 ‎‡2  NTA|175175608‏
996 ‎‡2  NTA|298678578‏
996 ‎‡2  NTA|117355232‏
996 ‎‡2  NTA|074487337‏
996 ‎‡2  NTA|12439535X‏
996 ‎‡2  ISNI|0000000392446503‏
996 ‎‡2  ISNI|0000000392614917‏
996 ‎‡2  ISNI|0000000394007467‏
996 ‎‡2  ISNI|0000000387785105‏
996 ‎‡2  ISNI|0000000389535548‏
996 ‎‡2  ISNI|0000000390106433‏
996 ‎‡2  NTA|073745235‏
996 ‎‡2  ISNI|0000000390764831‏
996 ‎‡2  ISNI|000000039546546X‏
996 ‎‡2  NTA|241724333‏
996 ‎‡2  NTA|068791119‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏
998 ‎‡a  Smit, Lidwien‏ ‎‡q  (Lidwientje Anne-Marie),‏ ‎‡2  NTA|311470882‏ ‎‡3  suggested‏