VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q66732113  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241120235922.0
008     241120nneanz||abbn n and d
035 ‎‡a  (WKP)Q66732113‏
035 ‎‡a  (OCoLC)Q66732113‏
100 0 ‎‡a  David I Watkins‏ ‎‡9  en‏ ‎‡9  nl‏ ‎‡9  ast‏
375 ‎‡a  1‏ ‎‡2  iso5218‏
400 0 ‎‡a  ডেভিড আই ওয়াটকিন্স‏ ‎‡9  bn‏
670 ‎‡a  Author's A dominant role for CD8+-T-lymphocyte selection in simian immunodeficiency virus sequence variation‏
670 ‎‡a  Author's A human inferred germline antibody binds to an immunodominant epitope and neutralizes Zika virus‏
670 ‎‡a  Author's A nonfucosylated variant of the anti-HIV-1 monoclonal antibody b12 has enhanced FcγRIIIa-mediated antiviral activity in vitro but does not improve protection against mucosal SHIV challenge in macaques‏
670 ‎‡a  Author's A shared MHC supertype motif emerges by convergent evolution in macaques and mice, but is totally absent in human MHC molecules‏
670 ‎‡a  Author's A trivalent recombinant Ad5 gag/pol/nef vaccine fails to protect rhesus macaques from infection or control virus replication after a limiting-dose heterologous SIV challenge‏
670 ‎‡a  Author's Acute HIV infection with rapid progression to AIDS.‏
670 ‎‡a  Author's Acute phase cytotoxic T lymphocyte escape is a hallmark of simian immunodeficiency virus infection‏
670 ‎‡a  Author's AIDS virus specific CD8+ T lymphocytes against an immunodominant cryptic epitope select for viral escape‏
670 ‎‡a  Author's Analysis of pigtail macaque major histocompatibility complex class I molecules presenting immunodominant simian immunodeficiency virus epitopes‏
670 ‎‡a  Author's Attenuation of simian immunodeficiency virus SIVmac239 infection by prophylactic immunization with dna and recombinant adenoviral vaccine vectors expressing Gag‏
670 ‎‡a  Author's Automated generation and evaluation of specific MHC binding predictive tools: ARB matrix applications.‏
670 ‎‡a  Author's Broadly neutralizing human anti-HIV antibody 2G12 is effective in protection against mucosal SHIV challenge even at low serum neutralizing titers‏
670 ‎‡a  Author's Broadly neutralizing monoclonal antibodies 2F5 and 4E10 directed against the human immunodeficiency virus type 1 gp41 membrane-proximal external region protect against mucosal challenge by simian-human immunodeficiency virus SHIVBa-L‏
670 ‎‡a  Author's CD8 + T Cell Recognition of Cryptic Epitopes Is a Ubiquitous Feature of AIDS Virus Infection‏
670 ‎‡a  Author's CD8+ gamma-delta TCR+ and CD4+ T cells produce IFN-γ at 5-7 days after yellow fever vaccination in Indian rhesus macaques, before the induction of classical antigen-specific T cell responses‏
670 ‎‡a  Author's CD8+ T cell escape mutations in simian immunodeficiency virus SIVmac239 cause fitness defects in vivo, and many revert after transmission‏
670 ‎‡a  Author's CD8+ T cell recognition of cryptic epitopes is a ubiquitous feature of AIDS virus infection‏
670 ‎‡a  Author's CD8+ T cells from SIV elite controller macaques recognize Mamu-B*08-bound epitopes and select for widespread viral variation‏
670 ‎‡a  Author's CD8+ T-lymphocyte response to major immunodominant epitopes after vaginal exposure to simian immunodeficiency virus: too late and too little‏
670 ‎‡a  Author's Cellular Immune Responses against Simian T-Lymphotropic Virus Type 1 Target Tax in Infected Baboons‏
670 ‎‡a  Author's Characterization of the peptide-binding specificity of Mamu-A*11 results in the identification of SIV-derived epitopes and interspecies cross-reactivity‏
670 ‎‡a  Author's Characterization of the peptide-binding specificity of Mamu-B*17 and identification of Mamu-B*17-restricted epitopes derived from simian immunodeficiency virus proteins‏
670 ‎‡a  Author's Chinese origin rhesus macaque major histocompatibility complex class I molecules promiscuously present epitopes from SIV associated with molecules of Indian origin; implications for immunodominance and viral escape‏
670 ‎‡a  Author's Comparison of vaccine strategies using recombinant env-gag-pol MVA with or without an oligomeric Env protein boost in the SHIV rhesus macaque model‏
670 ‎‡a  Author's Compartmentalization of simian immunodeficiency virus replication within secondary lymphoid tissues of rhesus macaques is linked to disease stage and inversely related to localization of virus-specific CTL.‏
670 ‎‡a  Author's Comprehensive immunological evaluation reveals surprisingly few differences between elite controller and progressor Mamu-B*17-positive simian immunodeficiency virus-infected rhesus macaques‏
670 ‎‡a  Author's Consequences of cytotoxic T-lymphocyte escape: common escape mutations in simian immunodeficiency virus are poorly recognized in naive hosts‏
670 ‎‡a  Author's Cytotoxic capacity of SIV-specific CD8‏
670 ‎‡a  Author's Cytotoxic capacity of SIV-specific CD8(+) T cells against primary autologous targets correlates with immune control in SIV-infected rhesus macaques‏
670 ‎‡a  Author's Cytotoxic T lymphocyte-based control of simian immunodeficiency virus replication in a preclinical AIDS vaccine trial‏
670 ‎‡a  Author's Cytotoxic T-lymphocyte escape monitoring in simian immunodeficiency virus vaccine challenge studies‏
670 ‎‡a  Author's Dengue Virus Evades AAV-Mediated Neutralizing Antibody Prophylaxis in Rhesus Monkeys‏
670 ‎‡a  Author's Dengue virus-specific CD4+ and CD8+ T lymphocytes target NS1, NS3 and NS5 in infected Indian rhesus macaques‏
670 ‎‡a  Author's Differences between T cell epitopes recognized after immunization and after infection‏
670 ‎‡a  Author's Differential antigen presentation kinetics of CD8+ T-cell epitopes derived from the same viral protein‏
670 ‎‡a  Author's DNA/Ad5 vaccination with SIV epitopes induced epitope-specific CD4⁺ T cells, but few subdominant epitope-specific CD8⁺ T cells‏
670 ‎‡a  Author's Dominance of CD8 responses specific for epitopes bound by a single major histocompatibility complex class I molecule during the acute phase of viral infection‏
670 ‎‡a  Author's Effective simian immunodeficiency virus-specific CD8+ T cells lack an easily detectable, shared characteristic‏
670 ‎‡a  Author's Effects of cytotoxic T lymphocytes‏
670 ‎‡a  Author's Effects of cytotoxic T lymphocytes (CTL) directed against a single simian immunodeficiency virus (SIV) Gag CTL epitope on the course of SIVmac239 infection‏
670 ‎‡a  Author's Efficacy of multivalent adenovirus-based vaccine against simian immunodeficiency virus challenge‏
670 ‎‡a  Author's Escape from CD8‏
670 ‎‡a  Author's Escape from CD8(+) T cell responses in Mamu-B*00801(+) macaques differentiates progressors from elite controllers‏
670 ‎‡a  Author's Escape in one of two cytotoxic T-lymphocyte epitopes bound by a high-frequency major histocompatibility complex class I molecule, Mamu-A*02: a paradigm for virus evolution and persistence?‏
670 ‎‡a  Author's Expression of the major histocompatibility complex class I molecule Mamu-A*01 is associated with control of simian immunodeficiency virus SIVmac239 replication‏
670 ‎‡a  Author's Extraepitopic compensatory substitutions partially restore fitness to simian immunodeficiency virus variants that escape from an immunodominant cytotoxic-T-lymphocyte response‏
670 ‎‡a  Author's Fetal demise and failed antibody therapy during Zika virus infection of pregnant macaques.‏
670 ‎‡a  Author's Gag- and Nef-specific CD4+ T cells recognize and inhibit SIV replication in infected macrophages early after infection‏
670 ‎‡a  Author's Gag-specific CD8+ T lymphocytes recognize infected cells before AIDS-virus integration and viral protein expression‏
670 ‎‡a  Author's GagCM9-specific CD8+ T cells expressing limited public TCR clonotypes do not suppress SIV replication in vivo‏
670 ‎‡a  Author's Genomic epidemiology reveals multiple introductions of Zika virus into the United States‏
670 ‎‡a  Author's Highlights of the 15th Conference on Retroviruses and Opportunistic Infections. Basic HIV vaccine development.‏
670 ‎‡a  Author's Highly potent HIV-specific antibody neutralization in vitro translates into effective protection against mucosal SHIV challenge in vivo‏
670 ‎‡a  Author's HIV and SIV CTL escape: implications for vaccine design‏
670 ‎‡a  Author's HIV pathogenesis: the first cut is the deepest.‏
670 ‎‡a  Author's HIV vaccine design: insights from live attenuated SIV vaccines‏
670 ‎‡a  Author's Identification of seventeen new simian immunodeficiency virus-derived CD8+ T cell epitopes restricted by the high frequency molecule, Mamu-A*02, and potential escape from CTL recognition‏
670 ‎‡a  Author's Immunization of rhesus macaques with a DNA prime/modified vaccinia virus Ankara boost regimen induces broad simian immunodeficiency virus‏
670 ‎‡a  Author's Immunization of rhesus macaques with a DNA prime/modified vaccinia virus Ankara boost regimen induces broad simian immunodeficiency virus (SIV)-specific T-cell responses and reduces initial viral replication but does not prevent disease progression f‏
670 ‎‡a  Author's Immunogenicity of hybrid DNA vaccines expressing hepatitis B core particles carrying human and simian immunodeficiency virus epitopes in mice and rhesus macaques.‏
670 ‎‡a  Author's Immunogenicity of seven new recombinant yellow fever viruses 17D expressing fragments of SIVmac239 Gag, Nef, and Vif in Indian rhesus macaques‏
670 ‎‡a  Author's Impact of MHC class I diversity on immune control of immunodeficiency virus replication‏
670 ‎‡a  Author's Improved genetic stability of recombinant yellow fever 17D virus expressing a lentiviral Gag gene fragment‏
670 ‎‡a  Author's Induction of anti-simian immunodeficiency virus cellular and humoral immune responses in rhesus macaques by peptide immunogens: correlation of CTL activity and reduction of cell-associated but not plasma virus load following challenge‏
670 ‎‡a  Author's Infection with "escaped" virus variants impairs control of simian immunodeficiency virus SIVmac239 replication in Mamu-B*08-positive macaques‏
670 ‎‡a  Author's Is an HIV vaccine possible?‏
670 ‎‡a  Author's Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium‏
670 ‎‡a  Author's Long-term control of simian immunodeficiency virus replication with central memory CD4+ T-cell preservation after nonsterile protection by a cytotoxic T-lymphocyte-based vaccine‏
670 ‎‡a  Author's Macaques vaccinated with live-attenuated SIV control replication of heterologous virus‏
670 ‎‡a  Author's Macaques vaccinated with simian immunodeficiency virus SIVmac239Delta nef delay acquisition and control replication after repeated low-dose heterologous SIV challenge‏
670 ‎‡a  Author's Major histocompatibility complex class I alleles associated with slow simian immunodeficiency virus disease progression bind epitopes recognized by dominant acute-phase cytotoxic-T-lymphocyte responses‏
670 ‎‡a  Author's Mamu-B*08-positive macaques control simian immunodeficiency virus replication‏
670 ‎‡a  Author's MHC polymorphism: AIDS susceptibility in non-human primates‏
670 ‎‡a  Author's Multiple introductions of Zika virus into the United States revealed through genomic epidemiology‏
670 ‎‡a  Author's Multispecific vaccine-induced mucosal cytotoxic T lymphocytes reduce acute-phase viral replication but fail in long-term control of simian immunodeficiency virus SIVmac239.‏
670 ‎‡a  Author's Nef Is Dispensable for Resistance of Simian Immunodeficiency Virus-Infected Macrophages to CD8+ T Cell Killing‏
670 ‎‡a  Author's Nomenclature report on the major histocompatibility complex genes and alleles of Great Ape, Old and New World monkey species‏
670 ‎‡a  Author's Nonhuman primate models and the failure of the Merck HIV-1 vaccine in humans‏
670 ‎‡a  Author's Not all cytokine-producing CD8+ T cells suppress simian immunodeficiency virus replication‏
670 ‎‡a  Author's Novel translation products from simian immunodeficiency virus SIVmac239 Env-encoding mRNA contain both Rev and cryptic T-cell epitopes‏
670 ‎‡a  Author's Ontogeny of the B- and T-cell response in a primary Zika virus infection of a dengue-naïve individual during the 2016 outbreak in Miami, FL.‏
670 ‎‡a  Author's Patterns of CD8+ immunodominance may influence the ability of Mamu-B*08-positive macaques to naturally control simian immunodeficiency virus SIVmac239 replication‏
670 ‎‡a  Author's Pol-specific CD8+ T cells recognize simian immunodeficiency virus-infected cells prior to Nef-mediated major histocompatibility complex class I downregulation‏
670 ‎‡a  Author's Polymorphisms in eight host genes associated with control of HIV replication do not mediate elite control of viral replication in SIV-infected Indian rhesus macaques‏
670 ‎‡a  Author's Potent Plasmablast-Derived Antibodies Elicited by the National Institutes of Health Dengue Vaccine‏
670 ‎‡a  Author's Premature induction of an immunosuppressive regulatory T cell response during acute simian immunodeficiency virus infection‏
670 ‎‡a  Author's Prevention of disease induced by a partially heterologous AIDS virus in rhesus monkeys by using an adjuvanted multicomponent protein vaccine‏
670 ‎‡a  Author's Prior Dengue virus exposure shapes T cell immunity to Zika virus in humans‏
670 ‎‡a  Author's Protection against high-dose highly pathogenic mucosal SIV challenge at very low serum neutralizing titers of the antibody-like molecule CD4-IgG2.‏
670 ‎‡a  Author's Public clonotype usage identifies protective Gag-specific CD8+ T cell responses in SIV infection‏
670 ‎‡a  Author's Public health. A sound rationale needed for phase III HIV-1 vaccine trials‏
670 ‎‡a  Author's Pyrosequencing reveals restricted patterns of CD8+ T cell escape-associated compensatory mutations in simian immunodeficiency virus‏
670 ‎‡a  Author's Rapid viral escape at an immunodominant simian-human immunodeficiency virus cytotoxic T-lymphocyte epitope exacts a dramatic fitness cost‏
670 ‎‡a  Author's Rare Control of SIVmac239 Infection in a Vaccinated Rhesus Macaque‏
670 ‎‡a  Author's Recognition of escape variants in ELISPOT does not always predict CD8+ T-cell recognition of simian immunodeficiency virus-infected cells expressing the same variant sequences‏
670 ‎‡a  Author's Recombinant Yellow Fever Vaccine Virus 17D Expressing Simian Immunodeficiency Virus SIVmac239 Gag Induces SIV-Specific CD8+ T-Cell Responses in Rhesus Macaques‏
670 ‎‡a  Author's Reduction of CD4+ T cells in vivo does not affect virus load in macaque elite controllers‏
670 ‎‡a  Author's Relevance of studying T cell responses in SIV-infected rhesus macaques‏
670 ‎‡a  Author's Repeated low-dose mucosal simian immunodeficiency virus SIVmac239 challenge results in the same viral and immunological kinetics as high-dose challenge: a model for the evaluation of vaccine efficacy in nonhuman primates‏
670 ‎‡a  Author's Reversion of CTL escape–variant immunodeficiency viruses in vivo‏
670 ‎‡a  Author's Rhesus Macaques Vaccinated with , , and Manifest Early Control of SIVmac239 Replication‏
670 ‎‡a  Author's Robust, vaccine-induced CD8(+) T lymphocyte response against an out-of-frame epitope‏
670 ‎‡a  Author's Simian immunodeficiency virus-specific CD4+ T cells from successful vaccinees target the SIV Gag capsid‏
670 ‎‡a  Author's Simian T Lymphotropic Virus 1 Infection of Papio anubis: tax Sequence Heterogeneity and T Cell Recognition‏
670 ‎‡a  Author's Subdominant CD8+ T-cell responses are involved in durable control of AIDS virus replication‏
670 ‎‡a  Author's Synchronous infection of SIV and HIV in vitro for virology, immunology and vaccine-related studies‏
670 ‎‡a  Author's T-cell correlates of vaccine efficacy after a heterologous simian immunodeficiency virus challenge‏
670 ‎‡a  Author's Tat(28-35)SL8-specific CD8+ T lymphocytes are more effective than Gag(181-189)CM9-specific CD8+ T lymphocytes at suppressing simian immunodeficiency virus replication in a functional in vitro assay‏
670 ‎‡a  Author's Tat-vaccinated macaques do not control simian immunodeficiency virus SIVmac239 replication‏
670 ‎‡a  Author's The antiviral efficacy of simian immunodeficiency virus-specific CD8+ T cells is unrelated to epitope specificity and is abrogated by viral escape‏
670 ‎‡a  Author's The high-frequency major histocompatibility complex class I allele Mamu-B*17 is associated with control of simian immunodeficiency virus SIVmac239 replication‏
670 ‎‡a  Author's The hope for an HIV vaccine based on induction of CD8+ T lymphocytes--a review‏
670 ‎‡a  Author's The live-attenuated yellow fever vaccine 17D induces broad and potent T cell responses against several viral proteins in Indian rhesus macaques--implications for recombinant vaccine design‏
670 ‎‡a  Author's The major histocompatibility complex class II alleles Mamu-DRB1*1003 and -DRB1*0306 are enriched in a cohort of simian immunodeficiency virus-infected rhesus macaque elite controllers‏
670 ‎‡a  Author's The majority of freshly sorted simian immunodeficiency virus (SIV)-specific CD8(+) T cells cannot suppress viral replication in SIV-infected macrophages‏
670 ‎‡a  Author's The pigtail macaque MHC class I allele Mane-A*10 presents an immundominant SIV Gag epitope: identification, tetramer development and implications of immune escape and reversion.‏
670 ‎‡a  Author's The role of MHC class I allele Mamu-A*07 during SIV(mac)239 infection‏
670 ‎‡a  Author's The role of MHC class I gene products in SIV infection of macaques‏
670 ‎‡a  Author's The TRIM5{alpha} genotype of rhesus macaques affects acquisition of simian immunodeficiency virus SIVsmE660 infection after repeated limiting-dose intrarectal challenge‏
670 ‎‡a  Author's Two MHC class I molecules associated with elite control of immunodeficiency virus replication, Mamu-B*08 and HLA-B*2705, bind peptides with sequence similarity‏
670 ‎‡a  Author's Understanding animal models of elite control: windows on effective immune responses against immunodeficiency viruses‏
670 ‎‡a  Author's Unexpected diversity of cellular immune responses against Nef and Vif in HIV-1-infected patients who spontaneously control viral replication‏
670 ‎‡a  Author's Unparalleled complexity of the MHC class I region in rhesus macaques‏
670 ‎‡a  Author's Update on progress in HIV vaccine development.‏
670 ‎‡a  Author's Use of a Recombinant Gamma-2 Herpesvirus Vaccine Vector against Dengue Virus in Rhesus Monkeys‏
670 ‎‡a  Author's Vaccination with Gag, Vif, and Nef gene fragments affords partial control of viral replication after mucosal challenge with SIVmac239‏
670 ‎‡a  Author's Vaccine-induced CD8+ T cells control AIDS virus replication‏
670 ‎‡a  Author's Vaccine-induced cellular immune responses reduce plasma viral concentrations after repeated low-dose challenge with pathogenic simian immunodeficiency virus SIVmac239‏
670 ‎‡a  Author's Vaccine-induced cellular responses control simian immunodeficiency virus replication after heterologous challenge‏
670 ‎‡a  Author's Vaccine-Induced Simian Immunodeficiency Virus-Specific CD8+ T-Cell Responses Focused on a Single Nef Epitope Select for Escape Variants Shortly after Infection‏
670 ‎‡a  Author's Viremia control following antiretroviral treatment and therapeutic immunizationduring primary SIV251 infection of macaques‏
670 ‎‡a  Author's Wanted: correlates of vaccine-induced protection against simian immunodeficiency virus‏
670 ‎‡a  Author's What Is the Predictive Value of Animal Models for Vaccine Efficacy in Humans? Rigorous Simian Immunodeficiency Virus Vaccine Trials Can Be Instructive‏
670 ‎‡a  Author's Within-host evolution of CD8+-TL epitopes encoded by overlapping and non-overlapping reading frames of simian immunodeficiency virus‏
670 ‎‡a  Author's Zika in the Americas, year 2: What have we learned? What gaps remain? A report from the Global Virus Network‏
670 ‎‡a  Author's Zika Virus-Immune Plasmas from Symptomatic and Asymptomatic Individuals Enhance Zika Pathogenesis in Adult and Pregnant Mice‏
912 ‎‡a  genomicepidemiologyrevealsmultipleintroductionsofzikavirusintotheunitedstates‏ ‎‡A  Genomic epidemiology reveals multiple introductions of Zika virus into the United States‏ ‎‡9  1‏
912 ‎‡a  multipleintroductionsofzikavirusintotheunitedstatesrevealedthroughgenomicepidemiology‏ ‎‡A  Multiple introductions of Zika virus into the United States revealed through genomic epidemiology‏ ‎‡9  1‏
919 ‎‡a  highlightsofthe15conferenceonretrovirusesandopportunisticinfectionsbasichivvaccinedevelopment‏ ‎‡A  Highlights of the 15th Conference on Retroviruses and Opportunistic Infections. Basic HIV vaccine development.‏ ‎‡9  1‏
919 ‎‡a  dominantroleforcd8+tlymphocyteselectioninsimianimmunodeficiencyvirussequencevariation‏ ‎‡A  A dominant role for CD8+-T-lymphocyte selection in simian immunodeficiency virus sequence variation‏ ‎‡9  1‏
919 ‎‡a  humaninferredgermlineantibodybindstoanimmunodominantepitopeandneutralizeszikavirus‏ ‎‡A  A human inferred germline antibody binds to an immunodominant epitope and neutralizes Zika virus‏ ‎‡9  1‏
919 ‎‡a  nonfucosylatedvariantoftheantihiv1monoclonalantibodyb12hasenhancedfcγriiiamediatedantiviralactivityinvitrobutdoesnotimproveprotectionagainstmucosalshivchallengeinmacaques‏ ‎‡A  A nonfucosylated variant of the anti-HIV-1 monoclonal antibody b12 has enhanced FcγRIIIa-mediated antiviral activity in vitro but does not improve protection against mucosal SHIV challenge in macaques‏ ‎‡9  1‏
919 ‎‡a  sharedmhcsupertypemotifemergesbyconvergentevolutioninmacaquesandmicebutistotallyabsentinhumanmhcmolecules‏ ‎‡A  A shared MHC supertype motif emerges by convergent evolution in macaques and mice, but is totally absent in human MHC molecules‏ ‎‡9  1‏
919 ‎‡a  trivalentrecombinantad5gagpolnefvaccinefailstoprotectrhesusmacaquesfrominfectionorcontrolvirusreplicationafteralimitingdoseheterologoussivchallenge‏ ‎‡A  A trivalent recombinant Ad5 gag/pol/nef vaccine fails to protect rhesus macaques from infection or control virus replication after a limiting-dose heterologous SIV challenge‏ ‎‡9  1‏
919 ‎‡a  acutehivinfectionwithrapidprogressiontoaids‏ ‎‡A  Acute HIV infection with rapid progression to AIDS.‏ ‎‡9  1‏
919 ‎‡a  acutephasecytotoxictlymphocyteescapeisahallmarkofsimianimmunodeficiencyvirusinfection‏ ‎‡A  Acute phase cytotoxic T lymphocyte escape is a hallmark of simian immunodeficiency virus infection‏ ‎‡9  1‏
919 ‎‡a  aidsvirusspecificcd8+tlymphocytesagainstanimmunodominantcrypticepitopeselectforviralescape‏ ‎‡A  AIDS virus specific CD8+ T lymphocytes against an immunodominant cryptic epitope select for viral escape‏ ‎‡9  1‏
919 ‎‡a  analysisofpigtailmacaquemajorhistocompatibilitycomplexclass1moleculespresentingimmunodominantsimianimmunodeficiencyvirusepitopes‏ ‎‡A  Analysis of pigtail macaque major histocompatibility complex class I molecules presenting immunodominant simian immunodeficiency virus epitopes‏ ‎‡9  1‏
919 ‎‡a  attenuationofsimianimmunodeficiencyvirussivmac239infectionbyprophylacticimmunizationwithdnaandrecombinantadenoviralvaccinevectorsexpressinggag‏ ‎‡A  Attenuation of simian immunodeficiency virus SIVmac239 infection by prophylactic immunization with dna and recombinant adenoviral vaccine vectors expressing Gag‏ ‎‡9  1‏
919 ‎‡a  automatedgenerationandevaluationofspecificmhcbindingpredictivetoolsarbmatrixapplications‏ ‎‡A  Automated generation and evaluation of specific MHC binding predictive tools: ARB matrix applications.‏ ‎‡9  1‏
919 ‎‡a  broadlyneutralizinghumanantihivantibody2g12iseffectiveinprotectionagainstmucosalshivchallengeevenatlowserumneutralizingtiters‏ ‎‡A  Broadly neutralizing human anti-HIV antibody 2G12 is effective in protection against mucosal SHIV challenge even at low serum neutralizing titers‏ ‎‡9  1‏
919 ‎‡a  broadlyneutralizingmonoclonalantibodies2f5and4e10directedagainstthehumanimmunodeficiencyvirustype1gp41membraneproximalexternalregionprotectagainstmucosalchallengebysimianhumanimmunodeficiencyvirusshivba50‏ ‎‡A  Broadly neutralizing monoclonal antibodies 2F5 and 4E10 directed against the human immunodeficiency virus type 1 gp41 membrane-proximal external region protect against mucosal challenge by simian-human immunodeficiency virus SHIVBa-L‏ ‎‡9  1‏
919 ‎‡a  cd8+tcellrecognitionofcrypticepitopesisaubiquitousfeatureofaidsvirusinfection‏ ‎‡A  CD8 + T Cell Recognition of Cryptic Epitopes Is a Ubiquitous Feature of AIDS Virus Infection‏ ‎‡9  2‏
919 ‎‡a  cd8+gammadeltatcr+andcd4+tcellsproduceifnγat57daysafteryellowfevervaccinationinindianrhesusmacaquesbeforetheinductionofclassicalantigenspecifictcellresponses‏ ‎‡A  CD8+ gamma-delta TCR+ and CD4+ T cells produce IFN-γ at 5-7 days after yellow fever vaccination in Indian rhesus macaques, before the induction of classical antigen-specific T cell responses‏ ‎‡9  1‏
919 ‎‡a  cd8+tcellescapemutationsinsimianimmunodeficiencyvirussivmac239causefitnessdefectsinvivoandmanyrevertaftertransmission‏ ‎‡A  CD8+ T cell escape mutations in simian immunodeficiency virus SIVmac239 cause fitness defects in vivo, and many revert after transmission‏ ‎‡9  1‏
919 ‎‡a  cd8+tcellsfromsivelitecontrollermacaquesrecognizemamub08boundepitopesandselectforwidespreadviralvariation‏ ‎‡A  CD8+ T cells from SIV elite controller macaques recognize Mamu-B*08-bound epitopes and select for widespread viral variation‏ ‎‡9  1‏
919 ‎‡a  cd8+tlymphocyteresponsetomajorimmunodominantepitopesaftervaginalexposuretosimianimmunodeficiencyvirustoolateandtoolittle‏ ‎‡A  CD8+ T-lymphocyte response to major immunodominant epitopes after vaginal exposure to simian immunodeficiency virus: too late and too little‏ ‎‡9  1‏
919 ‎‡a  cellularimmuneresponsesagainstsimiantlymphotropicvirustype1targettaxininfectedbaboons‏ ‎‡A  Cellular Immune Responses against Simian T-Lymphotropic Virus Type 1 Target Tax in Infected Baboons‏ ‎‡9  1‏
919 ‎‡a  characterizationofthepeptidebindingspecificityofmamua11resultsintheidentificationofsivderivedepitopesandinterspeciescrossreactivity‏ ‎‡A  Characterization of the peptide-binding specificity of Mamu-A*11 results in the identification of SIV-derived epitopes and interspecies cross-reactivity‏ ‎‡9  1‏
919 ‎‡a  characterizationofthepeptidebindingspecificityofmamub17andidentificationofmamub17restrictedepitopesderivedfromsimianimmunodeficiencyvirusproteins‏ ‎‡A  Characterization of the peptide-binding specificity of Mamu-B*17 and identification of Mamu-B*17-restricted epitopes derived from simian immunodeficiency virus proteins‏ ‎‡9  1‏
919 ‎‡a  chineseoriginrhesusmacaquemajorhistocompatibilitycomplexclass1moleculespromiscuouslypresentepitopesfromsivassociatedwithmoleculesofindianoriginimplicationsforimmunodominanceandviralescape‏ ‎‡A  Chinese origin rhesus macaque major histocompatibility complex class I molecules promiscuously present epitopes from SIV associated with molecules of Indian origin; implications for immunodominance and viral escape‏ ‎‡9  1‏
919 ‎‡a  comparisonofvaccinestrategiesusingrecombinantenvgagpolmvawithorwithoutanoligomericenvproteinboostintheshivrhesusmacaquemodel‏ ‎‡A  Comparison of vaccine strategies using recombinant env-gag-pol MVA with or without an oligomeric Env protein boost in the SHIV rhesus macaque model‏ ‎‡9  1‏
919 ‎‡a  compartmentalizationofsimianimmunodeficiencyvirusreplicationwithinsecondarylymphoidtissuesofrhesusmacaquesislinkedtodiseasestageandinverselyrelatedtolocalizationofvirusspecificctl‏ ‎‡A  Compartmentalization of simian immunodeficiency virus replication within secondary lymphoid tissues of rhesus macaques is linked to disease stage and inversely related to localization of virus-specific CTL.‏ ‎‡9  1‏
919 ‎‡a  comprehensiveimmunologicalevaluationrevealssurprisinglyfewdifferencesbetweenelitecontrollerandprogressormamub17positivesimianimmunodeficiencyvirusinfectedrhesusmacaques‏ ‎‡A  Comprehensive immunological evaluation reveals surprisingly few differences between elite controller and progressor Mamu-B*17-positive simian immunodeficiency virus-infected rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  consequencesofcytotoxictlymphocyteescapecommonescapemutationsinsimianimmunodeficiencyvirusarepoorlyrecognizedinnaivehosts‏ ‎‡A  Consequences of cytotoxic T-lymphocyte escape: common escape mutations in simian immunodeficiency virus are poorly recognized in naive hosts‏ ‎‡9  1‏
919 ‎‡a  cytotoxiccapacityofsivspecificcd8‏ ‎‡A  Cytotoxic capacity of SIV-specific CD8‏ ‎‡9  1‏
919 ‎‡a  cytotoxiccapacityofsivspecificcd8+tcellsagainstprimaryautologoustargetscorrelateswithimmunecontrolinsivinfectedrhesusmacaques‏ ‎‡A  Cytotoxic capacity of SIV-specific CD8(+) T cells against primary autologous targets correlates with immune control in SIV-infected rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  cytotoxictlymphocytebasedcontrolofsimianimmunodeficiencyvirusreplicationinapreclinicalaidsvaccinetrial‏ ‎‡A  Cytotoxic T lymphocyte-based control of simian immunodeficiency virus replication in a preclinical AIDS vaccine trial‏ ‎‡9  1‏
919 ‎‡a  cytotoxictlymphocyteescapemonitoringinsimianimmunodeficiencyvirusvaccinechallengestudies‏ ‎‡A  Cytotoxic T-lymphocyte escape monitoring in simian immunodeficiency virus vaccine challenge studies‏ ‎‡9  1‏
919 ‎‡a  denguevirusevadesaavmediatedneutralizingantibodyprophylaxisinrhesusmonkeys‏ ‎‡A  Dengue Virus Evades AAV-Mediated Neutralizing Antibody Prophylaxis in Rhesus Monkeys‏ ‎‡9  1‏
919 ‎‡a  denguevirusspecificcd4+andcd8+tlymphocytestargetns1ns3andns5ininfectedindianrhesusmacaques‏ ‎‡A  Dengue virus-specific CD4+ and CD8+ T lymphocytes target NS1, NS3 and NS5 in infected Indian rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  differencesbetweentcellepitopesrecognizedafterimmunizationandafterinfection‏ ‎‡A  Differences between T cell epitopes recognized after immunization and after infection‏ ‎‡9  1‏
919 ‎‡a  differentialantigenpresentationkineticsofcd8+tcellepitopesderivedfromthesameviralprotein‏ ‎‡A  Differential antigen presentation kinetics of CD8+ T-cell epitopes derived from the same viral protein‏ ‎‡9  1‏
919 ‎‡a  dnaad5vaccinationwithsivepitopesinducedepitopespecificcd4+tcellsbutfewsubdominantepitopespecificcd8+tcells‏ ‎‡A  DNA/Ad5 vaccination with SIV epitopes induced epitope-specific CD4⁺ T cells, but few subdominant epitope-specific CD8⁺ T cells‏ ‎‡9  1‏
919 ‎‡a  dominanceofcd8responsesspecificforepitopesboundbyasinglemajorhistocompatibilitycomplexclass1moleculeduringtheacutephaseofviralinfection‏ ‎‡A  Dominance of CD8 responses specific for epitopes bound by a single major histocompatibility complex class I molecule during the acute phase of viral infection‏ ‎‡9  1‏
919 ‎‡a  effectivesimianimmunodeficiencyvirusspecificcd8+tcellslackaneasilydetectablesharedcharacteristic‏ ‎‡A  Effective simian immunodeficiency virus-specific CD8+ T cells lack an easily detectable, shared characteristic‏ ‎‡9  1‏
919 ‎‡a  effectsofcytotoxictlymphocytes‏ ‎‡A  Effects of cytotoxic T lymphocytes‏ ‎‡9  1‏
919 ‎‡a  effectsofcytotoxictlymphocytesctldirectedagainstasinglesimianimmunodeficiencyvirussivgagctlepitopeonthecourseofsivmac239infection‏ ‎‡A  Effects of cytotoxic T lymphocytes (CTL) directed against a single simian immunodeficiency virus (SIV) Gag CTL epitope on the course of SIVmac239 infection‏ ‎‡9  1‏
919 ‎‡a  efficacyofmultivalentadenovirusbasedvaccineagainstsimianimmunodeficiencyviruschallenge‏ ‎‡A  Efficacy of multivalent adenovirus-based vaccine against simian immunodeficiency virus challenge‏ ‎‡9  1‏
919 ‎‡a  escapefromcd8‏ ‎‡A  Escape from CD8‏ ‎‡9  1‏
919 ‎‡a  escapefromcd8+tcellresponsesinmamub00801+macaquesdifferentiatesprogressorsfromelitecontrollers‏ ‎‡A  Escape from CD8(+) T cell responses in Mamu-B*00801(+) macaques differentiates progressors from elite controllers‏ ‎‡9  1‏
919 ‎‡a  escapein1of2cytotoxictlymphocyteepitopesboundbyahighfrequencymajorhistocompatibilitycomplexclass1moleculemamua02aparadigmforvirusevolutionandpersistence‏ ‎‡A  Escape in one of two cytotoxic T-lymphocyte epitopes bound by a high-frequency major histocompatibility complex class I molecule, Mamu-A*02: a paradigm for virus evolution and persistence?‏ ‎‡9  1‏
919 ‎‡a  expressionofthemajorhistocompatibilitycomplexclass1moleculemamua01isassociatedwithcontrolofsimianimmunodeficiencyvirussivmac239replication‏ ‎‡A  Expression of the major histocompatibility complex class I molecule Mamu-A*01 is associated with control of simian immunodeficiency virus SIVmac239 replication‏ ‎‡9  1‏
919 ‎‡a  extraepitopiccompensatorysubstitutionspartiallyrestorefitnesstosimianimmunodeficiencyvirusvariantsthatescapefromanimmunodominantcytotoxictlymphocyteresponse‏ ‎‡A  Extraepitopic compensatory substitutions partially restore fitness to simian immunodeficiency virus variants that escape from an immunodominant cytotoxic-T-lymphocyte response‏ ‎‡9  1‏
919 ‎‡a  fetaldemiseandfailedantibodytherapyduringzikavirusinfectionofpregnantmacaques‏ ‎‡A  Fetal demise and failed antibody therapy during Zika virus infection of pregnant macaques.‏ ‎‡9  1‏
919 ‎‡a  gagandnefspecificcd4+tcellsrecognizeandinhibitsivreplicationininfectedmacrophagesearlyafterinfection‏ ‎‡A  Gag- and Nef-specific CD4+ T cells recognize and inhibit SIV replication in infected macrophages early after infection‏ ‎‡9  1‏
919 ‎‡a  gagspecificcd8+tlymphocytesrecognizeinfectedcellsbeforeaidsvirusintegrationandviralproteinexpression‏ ‎‡A  Gag-specific CD8+ T lymphocytes recognize infected cells before AIDS-virus integration and viral protein expression‏ ‎‡9  1‏
919 ‎‡a  gagcm9specificcd8+tcellsexpressinglimitedpublictcrclonotypesdonotsuppresssivreplicationinvivo‏ ‎‡A  GagCM9-specific CD8+ T cells expressing limited public TCR clonotypes do not suppress SIV replication in vivo‏ ‎‡9  1‏
919 ‎‡a  highlypotenthivspecificantibodyneutralizationinvitrotranslatesintoeffectiveprotectionagainstmucosalshivchallengeinvivo‏ ‎‡A  Highly potent HIV-specific antibody neutralization in vitro translates into effective protection against mucosal SHIV challenge in vivo‏ ‎‡9  1‏
919 ‎‡a  hivandsivctlescapeimplicationsforvaccinedesign‏ ‎‡A  HIV and SIV CTL escape: implications for vaccine design‏ ‎‡9  1‏
919 ‎‡a  hivpathogenesisthe1cutisthedeepest‏ ‎‡A  HIV pathogenesis: the first cut is the deepest.‏ ‎‡9  1‏
919 ‎‡a  hivvaccinedesigninsightsfromliveattenuatedsivvaccines‏ ‎‡A  HIV vaccine design: insights from live attenuated SIV vaccines‏ ‎‡9  1‏
919 ‎‡a  identificationof17newsimianimmunodeficiencyvirusderivedcd8+tcellepitopesrestrictedbythehighfrequencymoleculemamua02andpotentialescapefromctlrecognition‏ ‎‡A  Identification of seventeen new simian immunodeficiency virus-derived CD8+ T cell epitopes restricted by the high frequency molecule, Mamu-A*02, and potential escape from CTL recognition‏ ‎‡9  1‏
919 ‎‡a  immunizationofrhesusmacaqueswithadnaprimemodifiedvacciniavirusankaraboostregimeninducesbroadsimianimmunodeficiencyvirus‏ ‎‡A  Immunization of rhesus macaques with a DNA prime/modified vaccinia virus Ankara boost regimen induces broad simian immunodeficiency virus‏ ‎‡9  1‏
919 ‎‡a  immunizationofrhesusmacaqueswithadnaprimemodifiedvacciniavirusankaraboostregimeninducesbroadsimianimmunodeficiencyvirussivspecifictcellresponsesandreducesinitialviralreplicationbutdoesnotpreventdiseaseprogressionf‏ ‎‡A  Immunization of rhesus macaques with a DNA prime/modified vaccinia virus Ankara boost regimen induces broad simian immunodeficiency virus (SIV)-specific T-cell responses and reduces initial viral replication but does not prevent disease progression f‏ ‎‡9  1‏
919 ‎‡a  immunogenicityofhybriddnavaccinesexpressinghepatitisbcoreparticlescarryinghumanandsimianimmunodeficiencyvirusepitopesinmiceandrhesusmacaques‏ ‎‡A  Immunogenicity of hybrid DNA vaccines expressing hepatitis B core particles carrying human and simian immunodeficiency virus epitopes in mice and rhesus macaques.‏ ‎‡9  1‏
919 ‎‡a  immunogenicityof7newrecombinantyellowfeverviruses17dexpressingfragmentsofsivmac239gagnefandvifinindianrhesusmacaques‏ ‎‡A  Immunogenicity of seven new recombinant yellow fever viruses 17D expressing fragments of SIVmac239 Gag, Nef, and Vif in Indian rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  impactofmhcclass1diversityonimmunecontrolofimmunodeficiencyvirusreplication‏ ‎‡A  Impact of MHC class I diversity on immune control of immunodeficiency virus replication‏ ‎‡9  1‏
919 ‎‡a  improvedgeneticstabilityofrecombinantyellowfever17dvirusexpressingalentiviralgaggenefragment‏ ‎‡A  Improved genetic stability of recombinant yellow fever 17D virus expressing a lentiviral Gag gene fragment‏ ‎‡9  1‏
919 ‎‡a  inductionofantisimianimmunodeficiencyviruscellularandhumoralimmuneresponsesinrhesusmacaquesbypeptideimmunogenscorrelationofctlactivityandreductionofcellassociatedbutnotplasmavirusloadfollowingchallenge‏ ‎‡A  Induction of anti-simian immunodeficiency virus cellular and humoral immune responses in rhesus macaques by peptide immunogens: correlation of CTL activity and reduction of cell-associated but not plasma virus load following challenge‏ ‎‡9  1‏
919 ‎‡a  infectionwithescapedvirusvariantsimpairscontrolofsimianimmunodeficiencyvirussivmac239replicationinmamub08positivemacaques‏ ‎‡A  Infection with "escaped" virus variants impairs control of simian immunodeficiency virus SIVmac239 replication in Mamu-B*08-positive macaques‏ ‎‡9  1‏
919 ‎‡a  isanhivvaccinepossible‏ ‎‡A  Is an HIV vaccine possible?‏ ‎‡9  1‏
919 ‎‡a  localizedpopulationsofcd8mhcclass1tetramersivspecifictcellsinlymphoidfolliclesandgenitalepithelium‏ ‎‡A  Localized populations of CD8 MHC class I tetramer SIV-specific T cells in lymphoid follicles and genital epithelium‏ ‎‡9  1‏
919 ‎‡a  longtermcontrolofsimianimmunodeficiencyvirusreplicationwithcentralmemorycd4+tcellpreservationafternonsterileprotectionbyacytotoxictlymphocytebasedvaccine‏ ‎‡A  Long-term control of simian immunodeficiency virus replication with central memory CD4+ T-cell preservation after nonsterile protection by a cytotoxic T-lymphocyte-based vaccine‏ ‎‡9  1‏
919 ‎‡a  macaquesvaccinatedwithliveattenuatedsivcontrolreplicationofheterologousvirus‏ ‎‡A  Macaques vaccinated with live-attenuated SIV control replication of heterologous virus‏ ‎‡9  1‏
919 ‎‡a  macaquesvaccinatedwithsimianimmunodeficiencyvirussivmac239deltanefdelayacquisitionandcontrolreplicationafterrepeatedlowdoseheterologoussivchallenge‏ ‎‡A  Macaques vaccinated with simian immunodeficiency virus SIVmac239Delta nef delay acquisition and control replication after repeated low-dose heterologous SIV challenge‏ ‎‡9  1‏
919 ‎‡a  majorhistocompatibilitycomplexclass1allelesassociatedwithslowsimianimmunodeficiencyvirusdiseaseprogressionbindepitopesrecognizedbydominantacutephasecytotoxictlymphocyteresponses‏ ‎‡A  Major histocompatibility complex class I alleles associated with slow simian immunodeficiency virus disease progression bind epitopes recognized by dominant acute-phase cytotoxic-T-lymphocyte responses‏ ‎‡9  1‏
919 ‎‡a  mamub08positivemacaquescontrolsimianimmunodeficiencyvirusreplication‏ ‎‡A  Mamu-B*08-positive macaques control simian immunodeficiency virus replication‏ ‎‡9  1‏
919 ‎‡a  mhcpolymorphismaidssusceptibilityinnonhumanprimates‏ ‎‡A  MHC polymorphism: AIDS susceptibility in non-human primates‏ ‎‡9  1‏
919 ‎‡a  multispecificvaccineinducedmucosalcytotoxictlymphocytesreduceacutephaseviralreplicationbutfailinlongtermcontrolofsimianimmunodeficiencyvirussivmac239‏ ‎‡A  Multispecific vaccine-induced mucosal cytotoxic T lymphocytes reduce acute-phase viral replication but fail in long-term control of simian immunodeficiency virus SIVmac239.‏ ‎‡9  1‏
919 ‎‡a  nefisdispensableforresistanceofsimianimmunodeficiencyvirusinfectedmacrophagestocd8+tcellkilling‏ ‎‡A  Nef Is Dispensable for Resistance of Simian Immunodeficiency Virus-Infected Macrophages to CD8+ T Cell Killing‏ ‎‡9  1‏
919 ‎‡a  nomenclaturereportonthemajorhistocompatibilitycomplexgenesandallelesofgreatapeoldandnewworldmonkeyspecies‏ ‎‡A  Nomenclature report on the major histocompatibility complex genes and alleles of Great Ape, Old and New World monkey species‏ ‎‡9  1‏
919 ‎‡a  nonhumanprimatemodelsandthefailureofthemerckhiv1vaccineinhumans‏ ‎‡A  Nonhuman primate models and the failure of the Merck HIV-1 vaccine in humans‏ ‎‡9  1‏
919 ‎‡a  notallcytokineproducingcd8+tcellssuppresssimianimmunodeficiencyvirusreplication‏ ‎‡A  Not all cytokine-producing CD8+ T cells suppress simian immunodeficiency virus replication‏ ‎‡9  1‏
919 ‎‡a  noveltranslationproductsfromsimianimmunodeficiencyvirussivmac239envencodingmrnacontainbothrevandcryptictcellepitopes‏ ‎‡A  Novel translation products from simian immunodeficiency virus SIVmac239 Env-encoding mRNA contain both Rev and cryptic T-cell epitopes‏ ‎‡9  1‏
919 ‎‡a  ontogenyofthebandtcellresponseinaprimaryzikavirusinfectionofadenguenaiveindividualduringthe2016outbreakinmiamifl‏ ‎‡A  Ontogeny of the B- and T-cell response in a primary Zika virus infection of a dengue-naïve individual during the 2016 outbreak in Miami, FL.‏ ‎‡9  1‏
919 ‎‡a  patternsofcd8+immunodominancemayinfluencetheabilityofmamub08positivemacaquestonaturallycontrolsimianimmunodeficiencyvirussivmac239replication‏ ‎‡A  Patterns of CD8+ immunodominance may influence the ability of Mamu-B*08-positive macaques to naturally control simian immunodeficiency virus SIVmac239 replication‏ ‎‡9  1‏
919 ‎‡a  polspecificcd8+tcellsrecognizesimianimmunodeficiencyvirusinfectedcellspriortonefmediatedmajorhistocompatibilitycomplexclass1downregulation‏ ‎‡A  Pol-specific CD8+ T cells recognize simian immunodeficiency virus-infected cells prior to Nef-mediated major histocompatibility complex class I downregulation‏ ‎‡9  1‏
919 ‎‡a  polymorphismsin8hostgenesassociatedwithcontrolofhivreplicationdonotmediateelitecontrolofviralreplicationinsivinfectedindianrhesusmacaques‏ ‎‡A  Polymorphisms in eight host genes associated with control of HIV replication do not mediate elite control of viral replication in SIV-infected Indian rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  potentplasmablastderivedantibodieselicitedbythenationalinstitutesofhealthdenguevaccine‏ ‎‡A  Potent Plasmablast-Derived Antibodies Elicited by the National Institutes of Health Dengue Vaccine‏ ‎‡9  1‏
919 ‎‡a  prematureinductionofanimmunosuppressiveregulatorytcellresponseduringacutesimianimmunodeficiencyvirusinfection‏ ‎‡A  Premature induction of an immunosuppressive regulatory T cell response during acute simian immunodeficiency virus infection‏ ‎‡9  1‏
919 ‎‡a  preventionofdiseaseinducedbyapartiallyheterologousaidsvirusinrhesusmonkeysbyusinganadjuvantedmulticomponentproteinvaccine‏ ‎‡A  Prevention of disease induced by a partially heterologous AIDS virus in rhesus monkeys by using an adjuvanted multicomponent protein vaccine‏ ‎‡9  1‏
919 ‎‡a  priordenguevirusexposureshapestcellimmunitytozikavirusinhumans‏ ‎‡A  Prior Dengue virus exposure shapes T cell immunity to Zika virus in humans‏ ‎‡9  1‏
919 ‎‡a  protectionagainsthighdosehighlypathogenicmucosalsivchallengeatverylowserumneutralizingtitersoftheantibodylikemoleculecd4igg2‏ ‎‡A  Protection against high-dose highly pathogenic mucosal SIV challenge at very low serum neutralizing titers of the antibody-like molecule CD4-IgG2.‏ ‎‡9  1‏
919 ‎‡a  publicclonotypeusageidentifiesprotectivegagspecificcd8+tcellresponsesinsivinfection‏ ‎‡A  Public clonotype usage identifies protective Gag-specific CD8+ T cell responses in SIV infection‏ ‎‡9  1‏
919 ‎‡a  publichealthasoundrationaleneededforphase3hiv1vaccinetrials‏ ‎‡A  Public health. A sound rationale needed for phase III HIV-1 vaccine trials‏ ‎‡9  1‏
919 ‎‡a  pyrosequencingrevealsrestrictedpatternsofcd8+tcellescapeassociatedcompensatorymutationsinsimianimmunodeficiencyvirus‏ ‎‡A  Pyrosequencing reveals restricted patterns of CD8+ T cell escape-associated compensatory mutations in simian immunodeficiency virus‏ ‎‡9  1‏
919 ‎‡a  rapidviralescapeatanimmunodominantsimianhumanimmunodeficiencyviruscytotoxictlymphocyteepitopeexactsadramaticfitnesscost‏ ‎‡A  Rapid viral escape at an immunodominant simian-human immunodeficiency virus cytotoxic T-lymphocyte epitope exacts a dramatic fitness cost‏ ‎‡9  1‏
919 ‎‡a  rarecontrolofsivmac239infectioninavaccinatedrhesusmacaque‏ ‎‡A  Rare Control of SIVmac239 Infection in a Vaccinated Rhesus Macaque‏ ‎‡9  1‏
919 ‎‡a  recognitionofescapevariantsinelispotdoesnotalwayspredictcd8+tcellrecognitionofsimianimmunodeficiencyvirusinfectedcellsexpressingthesamevariantsequences‏ ‎‡A  Recognition of escape variants in ELISPOT does not always predict CD8+ T-cell recognition of simian immunodeficiency virus-infected cells expressing the same variant sequences‏ ‎‡9  1‏
919 ‎‡a  recombinantyellowfevervaccinevirus17dexpressingsimianimmunodeficiencyvirussivmac239gaginducessivspecificcd8+tcellresponsesinrhesusmacaques‏ ‎‡A  Recombinant Yellow Fever Vaccine Virus 17D Expressing Simian Immunodeficiency Virus SIVmac239 Gag Induces SIV-Specific CD8+ T-Cell Responses in Rhesus Macaques‏ ‎‡9  1‏
919 ‎‡a  reductionofcd4+tcellsinvivodoesnotaffectvirusloadinmacaqueelitecontrollers‏ ‎‡A  Reduction of CD4+ T cells in vivo does not affect virus load in macaque elite controllers‏ ‎‡9  1‏
919 ‎‡a  relevanceofstudyingtcellresponsesinsivinfectedrhesusmacaques‏ ‎‡A  Relevance of studying T cell responses in SIV-infected rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  repeatedlowdosemucosalsimianimmunodeficiencyvirussivmac239challengeresultsinthesameviralandimmunologicalkineticsashighdosechallengeamodelfortheevaluationofvaccineefficacyinnonhumanprimates‏ ‎‡A  Repeated low-dose mucosal simian immunodeficiency virus SIVmac239 challenge results in the same viral and immunological kinetics as high-dose challenge: a model for the evaluation of vaccine efficacy in nonhuman primates‏ ‎‡9  1‏
919 ‎‡a  reversionofctlescapevariantimmunodeficiencyvirusesinvivo‏ ‎‡A  Reversion of CTL escape–variant immunodeficiency viruses in vivo‏ ‎‡9  1‏
919 ‎‡a  rhesusmacaquesvaccinatedwithandmanifestearlycontrolofsivmac239replication‏ ‎‡A  Rhesus Macaques Vaccinated with , , and Manifest Early Control of SIVmac239 Replication‏ ‎‡9  1‏
919 ‎‡a  robustvaccineinducedcd8+tlymphocyteresponseagainstanoutofframeepitope‏ ‎‡A  Robust, vaccine-induced CD8(+) T lymphocyte response against an out-of-frame epitope‏ ‎‡9  1‏
919 ‎‡a  simianimmunodeficiencyvirusspecificcd4+tcellsfromsuccessfulvaccineestargetthesivgagcapsid‏ ‎‡A  Simian immunodeficiency virus-specific CD4+ T cells from successful vaccinees target the SIV Gag capsid‏ ‎‡9  1‏
919 ‎‡a  simiantlymphotropicvirus1infectionofpapioanubistaxsequenceheterogeneityandtcellrecognition‏ ‎‡A  Simian T Lymphotropic Virus 1 Infection of Papio anubis: tax Sequence Heterogeneity and T Cell Recognition‏ ‎‡9  1‏
919 ‎‡a  subdominantcd8+tcellresponsesareinvolvedindurablecontrolofaidsvirusreplication‏ ‎‡A  Subdominant CD8+ T-cell responses are involved in durable control of AIDS virus replication‏ ‎‡9  1‏
919 ‎‡a  synchronousinfectionofsivandhivinvitroforvirologyimmunologyandvaccinerelatedstudies‏ ‎‡A  Synchronous infection of SIV and HIV in vitro for virology, immunology and vaccine-related studies‏ ‎‡9  1‏
919 ‎‡a  tcellcorrelatesofvaccineefficacyafteraheterologoussimianimmunodeficiencyviruschallenge‏ ‎‡A  T-cell correlates of vaccine efficacy after a heterologous simian immunodeficiency virus challenge‏ ‎‡9  1‏
919 ‎‡a  tat2835sl8specificcd8+tlymphocytesaremoreeffectivethangag181189cm9specificcd8+tlymphocytesatsuppressingsimianimmunodeficiencyvirusreplicationinafunctionalinvitroassay‏ ‎‡A  Tat(28-35)SL8-specific CD8+ T lymphocytes are more effective than Gag(181-189)CM9-specific CD8+ T lymphocytes at suppressing simian immunodeficiency virus replication in a functional in vitro assay‏ ‎‡9  1‏
919 ‎‡a  tatvaccinatedmacaquesdonotcontrolsimianimmunodeficiencyvirussivmac239replication‏ ‎‡A  Tat-vaccinated macaques do not control simian immunodeficiency virus SIVmac239 replication‏ ‎‡9  1‏
919 ‎‡a  antiviralefficacyofsimianimmunodeficiencyvirusspecificcd8+tcellsisunrelatedtoepitopespecificityandisabrogatedbyviralescape‏ ‎‡A  The antiviral efficacy of simian immunodeficiency virus-specific CD8+ T cells is unrelated to epitope specificity and is abrogated by viral escape‏ ‎‡9  1‏
919 ‎‡a  highfrequencymajorhistocompatibilitycomplexclass1allelemamub17isassociatedwithcontrolofsimianimmunodeficiencyvirussivmac239replication‏ ‎‡A  The high-frequency major histocompatibility complex class I allele Mamu-B*17 is associated with control of simian immunodeficiency virus SIVmac239 replication‏ ‎‡9  1‏
919 ‎‡a  hopeforanhivvaccinebasedoninductionofcd8+tlymphocytesareview‏ ‎‡A  The hope for an HIV vaccine based on induction of CD8+ T lymphocytes--a review‏ ‎‡9  1‏
919 ‎‡a  liveattenuatedyellowfevervaccine17dinducesbroadandpotenttcellresponsesagainstseveralviralproteinsinindianrhesusmacaquesimplicationsforrecombinantvaccinedesign‏ ‎‡A  The live-attenuated yellow fever vaccine 17D induces broad and potent T cell responses against several viral proteins in Indian rhesus macaques--implications for recombinant vaccine design‏ ‎‡9  1‏
919 ‎‡a  majorhistocompatibilitycomplexclass2allelesmamudrb11003anddrb10306areenrichedinacohortofsimianimmunodeficiencyvirusinfectedrhesusmacaqueelitecontrollers‏ ‎‡A  The major histocompatibility complex class II alleles Mamu-DRB1*1003 and -DRB1*0306 are enriched in a cohort of simian immunodeficiency virus-infected rhesus macaque elite controllers‏ ‎‡9  1‏
919 ‎‡a  majorityoffreshlysortedsimianimmunodeficiencyvirussivspecificcd8+tcellscannotsuppressviralreplicationinsivinfectedmacrophages‏ ‎‡A  The majority of freshly sorted simian immunodeficiency virus (SIV)-specific CD8(+) T cells cannot suppress viral replication in SIV-infected macrophages‏ ‎‡9  1‏
919 ‎‡a  pigtailmacaquemhcclass1allelemanea10presentsanimmundominantsivgagepitopeidentificationtetramerdevelopmentandimplicationsofimmuneescapeandreversion‏ ‎‡A  The pigtail macaque MHC class I allele Mane-A*10 presents an immundominant SIV Gag epitope: identification, tetramer development and implications of immune escape and reversion.‏ ‎‡9  1‏
919 ‎‡a  roleofmhcclass1allelemamua07duringsivmac239infection‏ ‎‡A  The role of MHC class I allele Mamu-A*07 during SIV(mac)239 infection‏ ‎‡9  1‏
919 ‎‡a  roleofmhcclass1geneproductsinsivinfectionofmacaques‏ ‎‡A  The role of MHC class I gene products in SIV infection of macaques‏ ‎‡9  1‏
919 ‎‡a  trim5alphagenotypeofrhesusmacaquesaffectsacquisitionofsimianimmunodeficiencyvirussivsme660infectionafterrepeatedlimitingdoseintrarectalchallenge‏ ‎‡A  The TRIM5{alpha} genotype of rhesus macaques affects acquisition of simian immunodeficiency virus SIVsmE660 infection after repeated limiting-dose intrarectal challenge‏ ‎‡9  1‏
919 ‎‡a  2mhcclass1moleculesassociatedwithelitecontrolofimmunodeficiencyvirusreplicationmamub08andhlab2705bindpeptideswithsequencesimilarity‏ ‎‡A  Two MHC class I molecules associated with elite control of immunodeficiency virus replication, Mamu-B*08 and HLA-B*2705, bind peptides with sequence similarity‏ ‎‡9  1‏
919 ‎‡a  understandinganimalmodelsofelitecontrolwindowsoneffectiveimmuneresponsesagainstimmunodeficiencyviruses‏ ‎‡A  Understanding animal models of elite control: windows on effective immune responses against immunodeficiency viruses‏ ‎‡9  1‏
919 ‎‡a  unexpecteddiversityofcellularimmuneresponsesagainstnefandvifinhiv1infectedpatientswhospontaneouslycontrolviralreplication‏ ‎‡A  Unexpected diversity of cellular immune responses against Nef and Vif in HIV-1-infected patients who spontaneously control viral replication‏ ‎‡9  1‏
919 ‎‡a  unparalleledcomplexityofthemhcclass1regioninrhesusmacaques‏ ‎‡A  Unparalleled complexity of the MHC class I region in rhesus macaques‏ ‎‡9  1‏
919 ‎‡a  updateonprogressinhivvaccinedevelopment‏ ‎‡A  Update on progress in HIV vaccine development.‏ ‎‡9  1‏
919 ‎‡a  useofarecombinantgamma2herpesvirusvaccinevectoragainstdenguevirusinrhesusmonkeys‏ ‎‡A  Use of a Recombinant Gamma-2 Herpesvirus Vaccine Vector against Dengue Virus in Rhesus Monkeys‏ ‎‡9  1‏
919 ‎‡a  vaccinationwithgagvifandnefgenefragmentsaffordspartialcontrolofviralreplicationaftermucosalchallengewithsivmac239‏ ‎‡A  Vaccination with Gag, Vif, and Nef gene fragments affords partial control of viral replication after mucosal challenge with SIVmac239‏ ‎‡9  1‏
919 ‎‡a  vaccineinducedcd8+tcellscontrolaidsvirusreplication‏ ‎‡A  Vaccine-induced CD8+ T cells control AIDS virus replication‏ ‎‡9  1‏
919 ‎‡a  vaccineinducedcellularimmuneresponsesreduceplasmaviralconcentrationsafterrepeatedlowdosechallengewithpathogenicsimianimmunodeficiencyvirussivmac239‏ ‎‡A  Vaccine-induced cellular immune responses reduce plasma viral concentrations after repeated low-dose challenge with pathogenic simian immunodeficiency virus SIVmac239‏ ‎‡9  1‏
919 ‎‡a  vaccineinducedcellularresponsescontrolsimianimmunodeficiencyvirusreplicationafterheterologouschallenge‏ ‎‡A  Vaccine-induced cellular responses control simian immunodeficiency virus replication after heterologous challenge‏ ‎‡9  1‏
919 ‎‡a  vaccineinducedsimianimmunodeficiencyvirusspecificcd8+tcellresponsesfocusedonasinglenefepitopeselectforescapevariantsshortlyafterinfection‏ ‎‡A  Vaccine-Induced Simian Immunodeficiency Virus-Specific CD8+ T-Cell Responses Focused on a Single Nef Epitope Select for Escape Variants Shortly after Infection‏ ‎‡9  1‏
919 ‎‡a  viremiacontrolfollowingantiretroviraltreatmentandtherapeuticimmunizationduringprimarysiv251infectionofmacaques‏ ‎‡A  Viremia control following antiretroviral treatment and therapeutic immunizationduring primary SIV251 infection of macaques‏ ‎‡9  1‏
919 ‎‡a  wantedcorrelatesofvaccineinducedprotectionagainstsimianimmunodeficiencyvirus‏ ‎‡A  Wanted: correlates of vaccine-induced protection against simian immunodeficiency virus‏ ‎‡9  1‏
919 ‎‡a  whatisthepredictivevalueofanimalmodelsforvaccineefficacyinhumansrigoroussimianimmunodeficiencyvirusvaccinetrialscanbeinstructive‏ ‎‡A  What Is the Predictive Value of Animal Models for Vaccine Efficacy in Humans? Rigorous Simian Immunodeficiency Virus Vaccine Trials Can Be Instructive‏ ‎‡9  1‏
919 ‎‡a  withinhostevolutionofcd8+tlepitopesencodedbyoverlappingandnonoverlappingreadingframesofsimianimmunodeficiencyvirus‏ ‎‡A  Within-host evolution of CD8+-TL epitopes encoded by overlapping and non-overlapping reading frames of simian immunodeficiency virus‏ ‎‡9  1‏
919 ‎‡a  zikaintheamericasyear2whathavewelearnedwhatgapsremainareportfromtheglobalvirusnetwork‏ ‎‡A  Zika in the Americas, year 2: What have we learned? What gaps remain? A report from the Global Virus Network‏ ‎‡9  1‏
919 ‎‡a  zikavirusimmuneplasmasfromsymptomaticandasymptomaticindividualsenhancezikapathogenesisinadultandpregnantmice‏ ‎‡A  Zika Virus-Immune Plasmas from Symptomatic and Asymptomatic Individuals Enhance Zika Pathogenesis in Adult and Pregnant Mice‏ ‎‡9  1‏
946 ‎‡a  b‏ ‎‡9  1‏
996 ‎‡2  LC|n 90689958‏
996 ‎‡2  ISNI|0000000368892159‏
996 ‎‡2  DNB|1189770997‏
996 ‎‡2  BIBSYS|1512647516762‏
996 ‎‡2  CAOONL|ncf11030567‏
996 ‎‡2  NII|DA01081245‏
996 ‎‡2  NTA|135394597‏
996 ‎‡2  BNF|12262943‏
996 ‎‡2  LC|nb2018022371‏
996 ‎‡2  LC|n 81017988‏
996 ‎‡2  RERO|A003959766‏
996 ‎‡2  RERO|A003959763‏
996 ‎‡2  LC|nb2018001099‏
996 ‎‡2  ISNI|0000000044316235‏
996 ‎‡2  DNB|139967877‏
996 ‎‡2  ISNI|0000000046599734‏
996 ‎‡2  BNF|15816709‏
996 ‎‡2  SUDOC|272964484‏
996 ‎‡2  LC|n 2013031877‏
996 ‎‡2  DNB|140906169‏
996 ‎‡2  ISNI|0000000080163547‏
996 ‎‡2  J9U|987007447370205171‏
996 ‎‡2  BIBSYS|9027822‏
996 ‎‡2  LC|n 82070096‏
996 ‎‡2  SUDOC|232942889‏
996 ‎‡2  J9U|987007449590405171‏
996 ‎‡2  LC|no2020146045‏
996 ‎‡2  LC|n 87834284‏
996 ‎‡2  RERO|A003977916‏
996 ‎‡2  BIBSYS|1542227323571‏
996 ‎‡2  ISNI|0000000355999301‏
996 ‎‡2  ISNI|0000000045267607‏
996 ‎‡2  LC|n 2007084063‏
996 ‎‡2  LC|no 96066801‏
996 ‎‡2  SUDOC|183326857‏
996 ‎‡2  DNB|134697987‏
996 ‎‡2  LC|n 94004521‏
996 ‎‡2  ISNI|0000000113469973‏
996 ‎‡2  BIBSYS|11058699‏
996 ‎‡2  LC|no2012010505‏
996 ‎‡2  NUKAT|n 2020069454‏
996 ‎‡2  ICCU|SBNV082793‏
996 ‎‡2  LIH|LNB:CMY_r_;=B_x_‏
996 ‎‡2  NSK|000636010‏
996 ‎‡2  ICCU|PUVV148072‏
996 ‎‡2  NUKAT|n 2018265436‏
996 ‎‡2  BIBSYS|4086783‏
996 ‎‡2  DBC|87097992458768‏
996 ‎‡2  ISNI|0000000041636014‏
996 ‎‡2  BNF|12362505‏
996 ‎‡2  NKC|jo20241241924‏
996 ‎‡2  DNB|1057444251‏
996 ‎‡2  B2Q|0000826939‏
996 ‎‡2  LC|n 96116867‏
996 ‎‡2  NUKAT|n 2010117978‏
996 ‎‡2  DNB|1349755788‏
996 ‎‡2  ISNI|0000000140663800‏
996 ‎‡2  CAOONL|ncf11922657‏
996 ‎‡2  J9U|987008729359005171‏
996 ‎‡2  BNF|16223127‏
996 ‎‡2  KRNLK|KAC200806765‏
996 ‎‡2  ISNI|0000000084142268‏
996 ‎‡2  LC|n 91129854‏
996 ‎‡2  CAOONL|ncf10951097‏
996 ‎‡2  NII|DA06410694‏
996 ‎‡2  NLA|000035837703‏
996 ‎‡2  BIBSYS|5015536‏
996 ‎‡2  BNF|12420622‏
996 ‎‡2  DNB|1160635811‏
996 ‎‡2  J9U|987007417940605171‏
996 ‎‡2  NII|DA13532159‏
996 ‎‡2  LC|no2016163804‏
996 ‎‡2  LIH|LNB:C_u__s__t_;=C_p_‏
996 ‎‡2  ISNI|0000000083665438‏
996 ‎‡2  RERO|A027273512‏
996 ‎‡2  PLWABN|9810615475305606‏
996 ‎‡2  ISNI|0000000027684458‏
996 ‎‡2  DNB|1332733638‏
996 ‎‡2  BIBSYS|90808466‏
996 ‎‡2  DNB|172443598‏
996 ‎‡2  LC|no2010164646‏
996 ‎‡2  SUDOC|191743402‏
996 ‎‡2  SUDOC|192421832‏
996 ‎‡2  NKC|xx0142698‏
996 ‎‡2  LC|n 2011001149‏
996 ‎‡2  DNB|135900131‏
996 ‎‡2  BIBSYS|99064130‏
996 ‎‡2  RERO|A012405752‏
996 ‎‡2  NUKAT|n 2014048912‏
996 ‎‡2  SUDOC|250166607‏
996 ‎‡2  BIBSYS|90311096‏
996 ‎‡2  LC|nb2011023268‏
996 ‎‡2  NII|DA11529095‏
996 ‎‡2  SUDOC|184482186‏
996 ‎‡2  LC|no2008038225‏
996 ‎‡2  SUDOC|053446682‏
996 ‎‡2  CAOONL|ncf11902222‏
996 ‎‡2  ISNI|0000000034517156‏
996 ‎‡2  ISNI|0000000110565126‏
996 ‎‡2  NTA|071941711‏
996 ‎‡2  SUDOC|234578769‏
996 ‎‡2  LNB|LNC10-000176013‏
996 ‎‡2  ISNI|0000000499992168‏
996 ‎‡2  DNB|1123816476‏
996 ‎‡2  DNB|113990387X‏
996 ‎‡2  ISNI|0000000502696571‏
996 ‎‡2  LC|no2016161666‏
996 ‎‡2  CAOONL|ncf10165017‏
996 ‎‡2  SUDOC|249674564‏
996 ‎‡2  LC|n 2019001282‏
996 ‎‡2  ISNI|0000000114671049‏
996 ‎‡2  BIBSYS|90322363‏
996 ‎‡2  LC|n 2006091685‏
996 ‎‡2  ISNI|0000000486521543‏
996 ‎‡2  LC|no2019061338‏
996 ‎‡2  B2Q|0001534105‏
996 ‎‡2  NTA|074904671‏
996 ‎‡2  DNB|1178742024‏
996 ‎‡2  LC|no2007012078‏
996 ‎‡2  ISNI|0000000028931238‏
996 ‎‡2  NTA|097157880‏
996 ‎‡2  BNF|12072572‏
996 ‎‡2  ISNI|0000000053470293‏
996 ‎‡2  BNF|13574342‏
996 ‎‡2  DNB|1157180426‏
996 ‎‡2  ISNI|0000000081670735‏
996 ‎‡2  BNC|981058612368106706‏
996 ‎‡2  LC|n 86080094‏
996 ‎‡2  LC|nr2006007980‏
996 ‎‡2  ISNI|0000000024846386‏
996 ‎‡2  SUDOC|16095732X‏
996 ‎‡2  JPG|500071584‏
996 ‎‡2  NLA|000035663205‏
996 ‎‡2  RERO|A021995701‏
996 ‎‡2  NTA|253190630‏
996 ‎‡2  SUDOC|029009367‏
996 ‎‡2  LC|n 90639878‏
996 ‎‡2  BNF|17815512‏
996 ‎‡2  LC|n 95055123‏
996 ‎‡2  BNF|14546482‏
996 ‎‡2  LC|n 2016065699‏
996 ‎‡2  J9U|987007456580005171‏
996 ‎‡2  N6I|vtls000276318‏
996 ‎‡2  ISNI|0000000076818336‏
996 ‎‡2  LC|no2010150441‏
996 ‎‡2  ISNI|0000000384205806‏
996 ‎‡2  ISNI|0000000055006312‏
996 ‎‡2  CAOONL|ncf11471008‏
996 ‎‡2  ISNI|0000000366168482‏
996 ‎‡2  ISNI|0000000114755920‏
996 ‎‡2  LC|no2011149461‏
996 ‎‡2  RERO|A027273495‏
996 ‎‡2  LC|no 95027634‏
996 ‎‡2  RERO|A027273648‏
996 ‎‡2  NKC|jx20100609006‏
996 ‎‡2  NTA|073545406‏
996 ‎‡2  LC|no2019020125‏
996 ‎‡2  NII|DA01602789‏
996 ‎‡2  NDL|01122346‏
996 ‎‡2  J9U|987007281046605171‏
996 ‎‡2  DNB|1061013545‏
996 ‎‡2  NII|DA12066210‏
996 ‎‡2  SUDOC|067637051‏
996 ‎‡2  DBC|87097969076645‏
996 ‎‡2  BLBNB|000477154‏
996 ‎‡2  NII|DA05665113‏
996 ‎‡2  LC|n 2019026629‏
996 ‎‡2  LC|n 85029760‏
996 ‎‡2  LC|n 2017040761‏
996 ‎‡2  NUKAT|n 2003096572‏
996 ‎‡2  ISNI|0000000101824974‏
996 ‎‡2  BNF|14024866‏
996 ‎‡2  LC|nb2010004848‏
996 ‎‡2  LC|n 85230210‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏