VIAF

Virtual International Authority File

Search

Leader     00000nz a2200037n 45 0
001     WKP|Q79199143  (VIAF cluster)  (Authority/Source Record)
003     WKP
005     20241121000331.0
008     241121nneanz||abbn n and d
035 ‎‡a  (WKP)Q79199143‏
024 ‎‡a  0000-0002-6732-2499‏ ‎‡2  orcid‏
035 ‎‡a  (OCoLC)Q79199143‏
100 0 ‎‡a  Xiaohong Zhang‏ ‎‡c  researcher ORCID ID=0000-0002-6732-2499‏ ‎‡9  en‏
670 ‎‡a  Author's 6,12-Dihydro-6,12-diboradibenzo[def,mno]chrysene: A Doubly Boron-Doped Polycyclic Aromatic Hydrocarbon for Organic Light Emitting Diodes by a One-Pot Synthesis‏
670 ‎‡a  Author's A bipolar transporter as an efficient green fluorescent emitter and host for red phosphors in multi- and single-layer organic light-emitting diodes.‏
670 ‎‡a  Author's A Microchannel-Confined Crystallization Strategy Enables Blade Coating of Perovskite Single Crystal Arrays for Device Integration‏
670 ‎‡a  Author's A multifunctional phosphine oxide-diphenylamine hybrid compound as a high performance deep-blue fluorescent emitter and green phosphorescent host‏
670 ‎‡a  Author's A novel colorimetric and fluorescent anion chemosensor based on the flavone quasi-crown ether-metal complex.‏
670 ‎‡a  Author's A silicon/zinc 2,9,16,23-tetraaminophthalocyanine coaxial core–shell nanowire array as an efficient solar hydrogen generation photocatalyst‏
670 ‎‡a  Author's Achieving highly efficient simple-emission layer fluorescence/phosphorescence hybrid white organic light-emitting devices via effective confinement of triplets‏
670 ‎‡a  Author's Ambient Electrosynthesis of Ammonia: Electrode Porosity and Composition Engineering‏
670 ‎‡a  Author's An efficient chloride-selective fluorescent chemosensor based on 2,9-bis(4'-hydroxyphenyl)phenanthroline Cu(II) complex‏
670 ‎‡a  Author's An organic nanowire-metal nanoparticle hybrid for the highly enhanced fluorescence detection of dopamine‏
670 ‎‡a  Author's Avoiding Energy Loss on TADF Emitters: Controlling the Dual Conformations of D-A Structure Molecules Based on the Pseudoplanar Segments.‏
670 ‎‡a  Author's Biodegradable π-Conjugated Oligomer Nanoparticles with High Photothermal Conversion Efficiency for Cancer Theranostics‏
670 ‎‡a  Author's Bulk preparation of Si-SiOx hierarchical structures: high-density radially oriented amorphous silica nanowires on a single-crystal silicon nanocore‏
670 ‎‡a  Author's Centimeter-Long Single-Crystalline Si Nanowires.‏
670 ‎‡a  Author's Control of Dual Conformations: Developing Thermally Activated Delayed Fluorescence Emitters for Highly Efficient Single-Emitter White Organic Light-Emitting Diodes‏
670 ‎‡a  Author's Controlled synthesis of oriented 1D ZnO nanostructures on transparent conductive substrates‏
670 ‎‡a  Author's Coumarin-Based Thermally Activated Delayed Fluorescence Emitters with High External Quantum Efficiency and Low Efficiency Roll-off in the Devices.‏
670 ‎‡a  Author's Direct evidence of molecular aggregation and degradation mechanism of organic light-emitting diodes under joule heating: an STM and photoluminescence study‏
670 ‎‡a  Author's Dual-Band, High-Performance Phototransistors from Hybrid Perovskite and Organic Crystal Array for Secure Communication Applications‏
670 ‎‡a  Author's Dual-Targeted Multifunctional Nanoparticles for Magnetic Resonance Imaging Guided Cancer Diagnosis and Therapy‏
670 ‎‡a  Author's Efficient Orange-Red Thermally Activated Delayed Fluorescence Emitters Feasible for Both Thermal Evaporation and Solution Process‏
670 ‎‡a  Author's Efficient visible light photocatalyst fabricated by depositing plasmonic Ag nanoparticles on conductive polymer-protected Si nanowire arrays for photoelectrochemical hydrogen generation.‏
670 ‎‡a  Author's EQE Climbing Over 6% at High Brightness of 14350 cd/m2 in Deep-Blue OLEDs Based on Hybridized Local and Charge-Transfer Fluorescence.‏
670 ‎‡a  Author's Excellent photocatalysis of HF-treated silicon nanowires‏
670 ‎‡a  Author's Fabrication and structure characterization of te butterfly nanostructures‏
670 ‎‡a  Author's Fluorescence turn on of coumarin derivatives by metal cations: a new signaling mechanism based on C=N isomerization.‏
670 ‎‡a  Author's High-Performance, Simplified Fluorescence and Phosphorescence Hybrid White Organic Light-Emitting Devices Allowing Complete Triplet Harvesting.‏
670 ‎‡a  Author's Highly efficient and stable Si nanowires array embedded into transparent polymer for visible light photoelectrochemical cell.‏
670 ‎‡a  Author's Highly Efficient Photoelectrochemical Water Splitting from Hierarchical WO3/BiVO4 Nanoporous Sphere Arrays.‏
670 ‎‡a  Author's Intermolecular Charge-Transfer Transition Emitter Showing Thermally Activated Delayed Fluorescence for Efficient Non-Doped OLEDs‏
670 ‎‡a  Author's Iodine-Doped-Poly(3,4-Ethylenedioxythiophene)-Modified Si Nanowire 1D Core-Shell Arrays as an Efficient Photocatalyst for Solar Hydrogen Generation‏
670 ‎‡a  Author's Isomeric Thermally Activated Delayed Fluorescence Emitters for Color Purity-Improved Emission in Organic Light-Emitting Devices.‏
670 ‎‡a  Author's L-Type Ligand-Assisted Acid-Free Synthesis of CsPbBr3 Nanocrystals with Near-Unity Photoluminescence Quantum Yield and High Stability‏
670 ‎‡a  Author's Large-scale fabrication and characterization of Cd-doped ZnO nanocantilever arrays‏
670 ‎‡a  Author's Large-Scale Fabrication of Silicon Nanowires for Solar Energy Applications.‏
670 ‎‡a  Author's Lithium intercalation and diffusion in TiO2 nanotubes: a first-principles investigation‏
670 ‎‡a  Author's Low-cost solar cell based on a composite of silicon nanowires and a highly conductive nonphotoactive polymer.‏
670 ‎‡a  Author's Management of singlet and triplet excitons in a single emission layer: a simple approach for a high-efficiency fluorescence/phosphorescence hybrid white organic light-emitting device.‏
670 ‎‡a  Author's Memory phototransistors based on exponential-association photoelectric conversion law‏
670 ‎‡a  Author's Mitochondrial-Targeting Lonidamine-Doxorubicin Nanoparticles for Synergistic Chemotherapy to Conquer Drug Resistance.‏
670 ‎‡a  Author's MoO3 Nanodots Decorated CdS Nanoribbons for High-Performance, Homojunction Photovoltaic Devices on Flexible Substrates.‏
670 ‎‡a  Author's New fluorescent chemosensor based on exciplex signaling mechanism‏
670 ‎‡a  Author's Novel Carbazol-Pyridine-Carbonitrile Derivative as Excellent Blue Thermally Activated Delayed Fluorescence Emitter for Highly Efficient Organic Light-Emitting Devices‏
670 ‎‡a  Author's Prediction and design of efficient exciplex emitters for high-efficiency, thermally activated delayed-fluorescence organic light-emitting diodes.‏
670 ‎‡a  Author's Rapid-releasing of HI-6 via brain-targeted mesoporous silica nanoparticles for nerve agent detoxification.‏
670 ‎‡a  Author's Red Organic Light-Emitting Diode with External Quantum Efficiency beyond 20% Based on a Novel Thermally Activated Delayed Fluorescence Emitter‏
670 ‎‡a  Author's Saturated Vapor-Assisted Growth of Single-Crystalline Organic-Inorganic Hybrid Perovskite Nanowires for High-Performance Photodetectors with Robust Stability.‏
670 ‎‡a  Author's Self-assembly of ZnO/SiO2 hierarchical nanostructures array on metal substrate‏
670 ‎‡a  Author's Si nanowire directly grown on a liquid metal substrate--towards wafer scale transferable nanowire arrays with improved visible-light sterilization.‏
670 ‎‡a  Author's Si/poly-CuTAPC coaxial core–shell nanowire array as enhanced visible-light photocatalyst for hydrogen production‏
670 ‎‡a  Author's Silicon nanowire based single-molecule SERS sensor‏
670 ‎‡a  Author's Silicon nanowire-based surface-enhanced raman spectroscopy endoscope for intracellular pH detection‏
670 ‎‡a  Author's Silicon Nanowire/Polymer Hybrid Solar Cell-Supercapacitor: A Self-Charging Power Unit with a Total Efficiency of 10.5.‏
670 ‎‡a  Author's Silicon/Organic Heterojunction for Photoelectrochemical Energy Conversion Photoanode with a Record Photovoltage‏
670 ‎‡a  Author's Strategies for Preparing Albumin-based Nanoparticles for Multifunctional Bioimaging and Drug Delivery‏
670 ‎‡a  Author's Synthesis of Hollow Silica Spheres with Hierarchical Shell Structure by the Dual Action of Liquid Indium Microbeads in Vapor–Liquid–Solid Growth‏
670 ‎‡a  Author's Synthesis, Structure, and Photophysical Properties of Two Four-Coordinate Cu(I)-NHC Complexes with Efficient Delayed Fluorescence.‏
670 ‎‡a  Author's Ternary organic solar cells with a phase-modulated surface distribution via the addition of a small molecular luminescent dye to obtain a high efficiency over 10.5.‏
670 ‎‡a  Author's Theoretical investigation of the singlet-triplet splittings for carbazole-based thermally activated delayed fluorescence emitters‏
670 ‎‡a  Author's Theoretical Studies of Bipolar Transport in CnBTBT-FmTCNQ Donor-Acceptor Cocrystals‏
670 ‎‡a  Author's Thermally Activated Delayed Fluorescence Carbonyl Derivatives for Organic Light-Emitting Diodes with Extremely Narrow Full Width at Half-Maximum‏
670 ‎‡a  Author's TiO2-Photoanode-Assisted Direct-Solar-Energy Harvesting and Storage in a Solar-Powered Redox Cell Using Halides as Active Materials‏
670 ‎‡a  Author's Transmission electron microscopy investigation of Sb-doped ZnO nanoribbons and Zn7Sb2O12 branched ZnO nanoribbon structure‏
670 ‎‡a  Author's Ultraminiaturized Stretchable Strain Sensors Based on Single Silicon Nanowires for Imperceptible Electronic Skins‏
670 ‎‡a  Author's Wafer-Scale Synthesis of Single-Crystal Zigzag Silicon Nanowire Arrays with Controlled Turning Angles‏
670 ‎‡a  Author's π-π stacking induced high current density and improved efficiency in ternary organic solar cells‏
909 ‎‡a  (orcid) 0000000267322499‏ ‎‡9  1‏
919 ‎‡a  directevidenceofmolecularaggregationanddegradationmechanismoforganiclightemittingdiodesunderjouleheatinganstmandphotoluminescencestudy‏ ‎‡A  Direct evidence of molecular aggregation and degradation mechanism of organic light-emitting diodes under joule heating: an STM and photoluminescence study‏ ‎‡9  1‏
919 ‎‡a  dualtargetedmultifunctionalnanoparticlesformagneticresonanceimagingguidedcancerdiagnosisandtherapy‏ ‎‡A  Dual-Targeted Multifunctional Nanoparticles for Magnetic Resonance Imaging Guided Cancer Diagnosis and Therapy‏ ‎‡9  1‏
919 ‎‡a  efficientorangeredthermallyactivateddelayedfluorescenceemittersfeasibleforboththermalevaporationandsolutionprocess‏ ‎‡A  Efficient Orange-Red Thermally Activated Delayed Fluorescence Emitters Feasible for Both Thermal Evaporation and Solution Process‏ ‎‡9  1‏
919 ‎‡a  efficientvisiblelightphotocatalystfabricatedbydepositingplasmonicagnanoparticlesonconductivepolymerprotectedsinanowirearraysforphotoelectrochemicalhydrogengeneration‏ ‎‡A  Efficient visible light photocatalyst fabricated by depositing plasmonic Ag nanoparticles on conductive polymer-protected Si nanowire arrays for photoelectrochemical hydrogen generation.‏ ‎‡9  1‏
919 ‎‡a  eqeclimbingover6athighbrightnessof14350400m2indeepblueoledsbasedonhybridizedlocalandchargetransferfluorescence‏ ‎‡A  EQE Climbing Over 6% at High Brightness of 14350 cd/m2 in Deep-Blue OLEDs Based on Hybridized Local and Charge-Transfer Fluorescence.‏ ‎‡9  1‏
919 ‎‡a  excellentphotocatalysisofhftreatedsiliconnanowires‏ ‎‡A  Excellent photocatalysis of HF-treated silicon nanowires‏ ‎‡9  1‏
919 ‎‡a  fabricationandstructurecharacterizationoftebutterflynanostructures‏ ‎‡A  Fabrication and structure characterization of te butterfly nanostructures‏ ‎‡9  1‏
919 ‎‡a  fluorescenceturnonofcoumarinderivativesbymetalcationsanewsignalingmechanismbasedon100nisomerization‏ ‎‡A  Fluorescence turn on of coumarin derivatives by metal cations: a new signaling mechanism based on C=N isomerization.‏ ‎‡9  1‏
919 ‎‡a  highperformancesimplifiedfluorescenceandphosphorescencehybridwhiteorganiclightemittingdevicesallowingcompletetripletharvesting‏ ‎‡A  High-Performance, Simplified Fluorescence and Phosphorescence Hybrid White Organic Light-Emitting Devices Allowing Complete Triplet Harvesting.‏ ‎‡9  1‏
919 ‎‡a  highlyefficientandstablesinanowiresarrayembeddedintotransparentpolymerforvisiblelightphotoelectrochemicalcell‏ ‎‡A  Highly efficient and stable Si nanowires array embedded into transparent polymer for visible light photoelectrochemical cell.‏ ‎‡9  1‏
919 ‎‡a  highlyefficientphotoelectrochemicalwatersplittingfromhierarchicalwo3bivo4nanoporousspherearrays‏ ‎‡A  Highly Efficient Photoelectrochemical Water Splitting from Hierarchical WO3/BiVO4 Nanoporous Sphere Arrays.‏ ‎‡9  1‏
919 ‎‡a  intermolecularchargetransfertransitionemittershowingthermallyactivateddelayedfluorescenceforefficientnondopedoleds‏ ‎‡A  Intermolecular Charge-Transfer Transition Emitter Showing Thermally Activated Delayed Fluorescence for Efficient Non-Doped OLEDs‏ ‎‡9  1‏
919 ‎‡a  iodinedopedpoly34ethylenedioxythiophenemodifiedsinanowire1dcoreshellarraysasanefficientphotocatalystforsolarhydrogengeneration‏ ‎‡A  Iodine-Doped-Poly(3,4-Ethylenedioxythiophene)-Modified Si Nanowire 1D Core-Shell Arrays as an Efficient Photocatalyst for Solar Hydrogen Generation‏ ‎‡9  1‏
919 ‎‡a  isomericthermallyactivateddelayedfluorescenceemittersforcolorpurityimprovedemissioninorganiclightemittingdevices‏ ‎‡A  Isomeric Thermally Activated Delayed Fluorescence Emitters for Color Purity-Improved Emission in Organic Light-Emitting Devices.‏ ‎‡9  1‏
919 ‎‡a  typeligandassistedacidfreesynthesisofcspbbr3nanocrystalswithnearunityphotoluminescencequantumyieldandhighstability‏ ‎‡A  L-Type Ligand-Assisted Acid-Free Synthesis of CsPbBr3 Nanocrystals with Near-Unity Photoluminescence Quantum Yield and High Stability‏ ‎‡9  1‏
919 ‎‡a  largescalefabricationandcharacterizationof400dopedznonanocantileverarrays‏ ‎‡A  Large-scale fabrication and characterization of Cd-doped ZnO nanocantilever arrays‏ ‎‡9  1‏
919 ‎‡a  largescalefabricationofsiliconnanowiresforsolarenergyapplications‏ ‎‡A  Large-Scale Fabrication of Silicon Nanowires for Solar Energy Applications.‏ ‎‡9  1‏
919 ‎‡a  lithiumintercalationanddiffusionintio2nanotubesa1principlesinvestigation‏ ‎‡A  Lithium intercalation and diffusion in TiO2 nanotubes: a first-principles investigation‏ ‎‡9  1‏
919 ‎‡a  lowcostsolarcellbasedonacompositeofsiliconnanowiresandahighlyconductivenonphotoactivepolymer‏ ‎‡A  Low-cost solar cell based on a composite of silicon nanowires and a highly conductive nonphotoactive polymer.‏ ‎‡9  1‏
919 ‎‡a  managementofsingletandtripletexcitonsinasingleemissionlayerasimpleapproachforahighefficiencyfluorescencephosphorescencehybridwhiteorganiclightemittingdevice‏ ‎‡A  Management of singlet and triplet excitons in a single emission layer: a simple approach for a high-efficiency fluorescence/phosphorescence hybrid white organic light-emitting device.‏ ‎‡9  1‏
919 ‎‡a  memoryphototransistorsbasedonexponentialassociationphotoelectricconversionlaw‏ ‎‡A  Memory phototransistors based on exponential-association photoelectric conversion law‏ ‎‡9  1‏
919 ‎‡a  mitochondrialtargetinglonidaminedoxorubicinnanoparticlesforsynergisticchemotherapytoconquerdrugresistance‏ ‎‡A  Mitochondrial-Targeting Lonidamine-Doxorubicin Nanoparticles for Synergistic Chemotherapy to Conquer Drug Resistance.‏ ‎‡9  1‏
919 ‎‡a  moo3nanodotsdecoratedcdsnanoribbonsforhighperformancehomojunctionphotovoltaicdevicesonflexiblesubstrates‏ ‎‡A  MoO3 Nanodots Decorated CdS Nanoribbons for High-Performance, Homojunction Photovoltaic Devices on Flexible Substrates.‏ ‎‡9  1‏
919 ‎‡a  newfluorescentchemosensorbasedonexciplexsignalingmechanism‏ ‎‡A  New fluorescent chemosensor based on exciplex signaling mechanism‏ ‎‡9  1‏
919 ‎‡a  novelcarbazolpyridinecarbonitrilederivativeasexcellentbluethermallyactivateddelayedfluorescenceemitterforhighlyefficientorganiclightemittingdevices‏ ‎‡A  Novel Carbazol-Pyridine-Carbonitrile Derivative as Excellent Blue Thermally Activated Delayed Fluorescence Emitter for Highly Efficient Organic Light-Emitting Devices‏ ‎‡9  1‏
919 ‎‡a  predictionanddesignofefficientexciplexemittersforhighefficiencythermallyactivateddelayedfluorescenceorganiclightemittingdiodes‏ ‎‡A  Prediction and design of efficient exciplex emitters for high-efficiency, thermally activated delayed-fluorescence organic light-emitting diodes.‏ ‎‡9  1‏
919 ‎‡a  rapidreleasingofhi6viabraintargetedmesoporoussilicananoparticlesfornerveagentdetoxification‏ ‎‡A  Rapid-releasing of HI-6 via brain-targeted mesoporous silica nanoparticles for nerve agent detoxification.‏ ‎‡9  1‏
919 ‎‡a  redorganiclightemittingdiodewithexternalquantumefficiencybeyond20basedonanovelthermallyactivateddelayedfluorescenceemitter‏ ‎‡A  Red Organic Light-Emitting Diode with External Quantum Efficiency beyond 20% Based on a Novel Thermally Activated Delayed Fluorescence Emitter‏ ‎‡9  1‏
919 ‎‡a  saturatedvaporassistedgrowthofsinglecrystallineorganicinorganichybridperovskitenanowiresforhighperformancephotodetectorswithrobuststability‏ ‎‡A  Saturated Vapor-Assisted Growth of Single-Crystalline Organic-Inorganic Hybrid Perovskite Nanowires for High-Performance Photodetectors with Robust Stability.‏ ‎‡9  1‏
919 ‎‡a  selfassemblyofznosio2hierarchicalnanostructuresarrayonmetalsubstrate‏ ‎‡A  Self-assembly of ZnO/SiO2 hierarchical nanostructures array on metal substrate‏ ‎‡9  1‏
919 ‎‡a  sinanowiredirectlygrownonaliquidmetalsubstratetowardswaferscaletransferablenanowirearrayswithimprovedvisiblelightsterilization‏ ‎‡A  Si nanowire directly grown on a liquid metal substrate--towards wafer scale transferable nanowire arrays with improved visible-light sterilization.‏ ‎‡9  1‏
919 ‎‡a  sipolycutapccoaxialcoreshellnanowirearrayasenhancedvisiblelightphotocatalystforhydrogenproduction‏ ‎‡A  Si/poly-CuTAPC coaxial core–shell nanowire array as enhanced visible-light photocatalyst for hydrogen production‏ ‎‡9  1‏
919 ‎‡a  siliconnanowirebasedsinglemoleculeserssensor‏ ‎‡A  Silicon nanowire based single-molecule SERS sensor‏ ‎‡9  1‏
919 ‎‡a  siliconnanowirebasedsurfaceenhancedramanspectroscopyendoscopeforintracellularphdetection‏ ‎‡A  Silicon nanowire-based surface-enhanced raman spectroscopy endoscope for intracellular pH detection‏ ‎‡9  1‏
919 ‎‡a  siliconnanowirepolymerhybridsolarcellsupercapacitoraselfchargingpowerunitwithatotalefficiencyof105‏ ‎‡A  Silicon Nanowire/Polymer Hybrid Solar Cell-Supercapacitor: A Self-Charging Power Unit with a Total Efficiency of 10.5.‏ ‎‡9  1‏
919 ‎‡a  siliconorganicheterojunctionforphotoelectrochemicalenergyconversionphotoanodewitharecordphotovoltage‏ ‎‡A  Silicon/Organic Heterojunction for Photoelectrochemical Energy Conversion Photoanode with a Record Photovoltage‏ ‎‡9  1‏
919 ‎‡a  strategiesforpreparingalbuminbasednanoparticlesformultifunctionalbioimaginganddrugdelivery‏ ‎‡A  Strategies for Preparing Albumin-based Nanoparticles for Multifunctional Bioimaging and Drug Delivery‏ ‎‡9  1‏
919 ‎‡a  synthesisofhollowsilicasphereswithhierarchicalshellstructurebythedualactionofliquidindiummicrobeadsinvaporliquidsolidgrowth‏ ‎‡A  Synthesis of Hollow Silica Spheres with Hierarchical Shell Structure by the Dual Action of Liquid Indium Microbeads in Vapor–Liquid–Solid Growth‏ ‎‡9  1‏
919 ‎‡a  synthesisstructureandphotophysicalpropertiesof24coordinatecu1nhccomplexeswithefficientdelayedfluorescence‏ ‎‡A  Synthesis, Structure, and Photophysical Properties of Two Four-Coordinate Cu(I)-NHC Complexes with Efficient Delayed Fluorescence.‏ ‎‡9  1‏
919 ‎‡a  ternaryorganicsolarcellswithaphasemodulatedsurfacedistributionviatheadditionofasmallmolecularluminescentdyetoobtainahighefficiencyover105‏ ‎‡A  Ternary organic solar cells with a phase-modulated surface distribution via the addition of a small molecular luminescent dye to obtain a high efficiency over 10.5.‏ ‎‡9  1‏
919 ‎‡a  theoreticalinvestigationofthesinglettripletsplittingsforcarbazolebasedthermallyactivateddelayedfluorescenceemitters‏ ‎‡A  Theoretical investigation of the singlet-triplet splittings for carbazole-based thermally activated delayed fluorescence emitters‏ ‎‡9  1‏
919 ‎‡a  theoreticalstudiesofbipolartransportincnbtbtfmtcnqdonoracceptorcocrystals‏ ‎‡A  Theoretical Studies of Bipolar Transport in CnBTBT-FmTCNQ Donor-Acceptor Cocrystals‏ ‎‡9  1‏
919 ‎‡a  thermallyactivateddelayedfluorescencecarbonylderivativesfororganiclightemittingdiodeswithextremelynarrowfullwidthathalfmaximum‏ ‎‡A  Thermally Activated Delayed Fluorescence Carbonyl Derivatives for Organic Light-Emitting Diodes with Extremely Narrow Full Width at Half-Maximum‏ ‎‡9  1‏
919 ‎‡a  tio2photoanodeassisteddirectsolarenergyharvestingandstorageinasolarpoweredredoxcellusinghalidesasactivematerials‏ ‎‡A  TiO2-Photoanode-Assisted Direct-Solar-Energy Harvesting and Storage in a Solar-Powered Redox Cell Using Halides as Active Materials‏ ‎‡9  1‏
919 ‎‡a  transmissionelectronmicroscopyinvestigationofsbdopedznonanoribbonsandzn7sb2o12branchedznonanoribbonstructure‏ ‎‡A  Transmission electron microscopy investigation of Sb-doped ZnO nanoribbons and Zn7Sb2O12 branched ZnO nanoribbon structure‏ ‎‡9  1‏
919 ‎‡a  ultraminiaturizedstretchablestrainsensorsbasedonsinglesiliconnanowiresforimperceptibleelectronicskins‏ ‎‡A  Ultraminiaturized Stretchable Strain Sensors Based on Single Silicon Nanowires for Imperceptible Electronic Skins‏ ‎‡9  1‏
919 ‎‡a  waferscalesynthesisofsinglecrystalzigzagsiliconnanowirearrayswithcontrolledturningangles‏ ‎‡A  Wafer-Scale Synthesis of Single-Crystal Zigzag Silicon Nanowire Arrays with Controlled Turning Angles‏ ‎‡9  1‏
919 ‎‡a  ππstackinginducedhighcurrentdensityandimprovedefficiencyinternaryorganicsolarcells‏ ‎‡A  π-π stacking induced high current density and improved efficiency in ternary organic solar cells‏ ‎‡9  1‏
919 ‎‡a  dualbandhighperformancephototransistorsfromhybridperovskiteandorganiccrystalarrayforsecurecommunicationapplications‏ ‎‡A  Dual-Band, High-Performance Phototransistors from Hybrid Perovskite and Organic Crystal Array for Secure Communication Applications‏ ‎‡9  1‏
919 ‎‡a  612dihydro612diboradibenzochryseneadoublyborondopedpolycyclicaromatichydrocarbonfororganiclightemittingdiodesbya1potsynthesis‏ ‎‡A  6,12-Dihydro-6,12-diboradibenzo[def,mno]chrysene: A Doubly Boron-Doped Polycyclic Aromatic Hydrocarbon for Organic Light Emitting Diodes by a One-Pot Synthesis‏ ‎‡9  1‏
919 ‎‡a  bipolartransporterasanefficientgreenfluorescentemitterandhostforredphosphorsinmultiandsinglelayerorganiclightemittingdiodes‏ ‎‡A  A bipolar transporter as an efficient green fluorescent emitter and host for red phosphors in multi- and single-layer organic light-emitting diodes.‏ ‎‡9  1‏
919 ‎‡a  microchannelconfinedcrystallizationstrategyenablesbladecoatingofperovskitesinglecrystalarraysfordeviceintegration‏ ‎‡A  A Microchannel-Confined Crystallization Strategy Enables Blade Coating of Perovskite Single Crystal Arrays for Device Integration‏ ‎‡9  1‏
919 ‎‡a  multifunctionalphosphineoxidediphenylaminehybridcompoundasahighperformancedeepbluefluorescentemitterandgreenphosphorescenthost‏ ‎‡A  A multifunctional phosphine oxide-diphenylamine hybrid compound as a high performance deep-blue fluorescent emitter and green phosphorescent host‏ ‎‡9  1‏
919 ‎‡a  novelcolorimetricandfluorescentanionchemosensorbasedontheflavonequasicrownethermetalcomplex‏ ‎‡A  A novel colorimetric and fluorescent anion chemosensor based on the flavone quasi-crown ether-metal complex.‏ ‎‡9  1‏
919 ‎‡a  siliconzinc291623tetraaminophthalocyaninecoaxialcoreshellnanowirearrayasanefficientsolarhydrogengenerationphotocatalyst‏ ‎‡A  A silicon/zinc 2,9,16,23-tetraaminophthalocyanine coaxial core–shell nanowire array as an efficient solar hydrogen generation photocatalyst‏ ‎‡9  1‏
919 ‎‡a  achievinghighlyefficientsimpleemissionlayerfluorescencephosphorescencehybridwhiteorganiclightemittingdevicesviaeffectiveconfinementoftriplets‏ ‎‡A  Achieving highly efficient simple-emission layer fluorescence/phosphorescence hybrid white organic light-emitting devices via effective confinement of triplets‏ ‎‡9  1‏
919 ‎‡a  ambientelectrosynthesisofammoniaelectrodeporosityandcompositionengineering‏ ‎‡A  Ambient Electrosynthesis of Ammonia: Electrode Porosity and Composition Engineering‏ ‎‡9  1‏
919 ‎‡a  efficientchlorideselectivefluorescentchemosensorbasedon29bis4hydroxyphenylphenanthrolinecu2complex‏ ‎‡A  An efficient chloride-selective fluorescent chemosensor based on 2,9-bis(4'-hydroxyphenyl)phenanthroline Cu(II) complex‏ ‎‡9  1‏
919 ‎‡a  organicnanowiremetalnanoparticlehybridforthehighlyenhancedfluorescencedetectionofdopamine‏ ‎‡A  An organic nanowire-metal nanoparticle hybrid for the highly enhanced fluorescence detection of dopamine‏ ‎‡9  1‏
919 ‎‡a  avoidingenergylossontadfemitterscontrollingthedualconformationsof500astructuremoleculesbasedonthepseudoplanarsegments‏ ‎‡A  Avoiding Energy Loss on TADF Emitters: Controlling the Dual Conformations of D-A Structure Molecules Based on the Pseudoplanar Segments.‏ ‎‡9  1‏
919 ‎‡a  biodegradableπconjugatedoligomernanoparticleswithhighphotothermalconversionefficiencyforcancertheranostics‏ ‎‡A  Biodegradable π-Conjugated Oligomer Nanoparticles with High Photothermal Conversion Efficiency for Cancer Theranostics‏ ‎‡9  1‏
919 ‎‡a  bulkpreparationofsisioxhierarchicalstructureshighdensityradiallyorientedamorphoussilicananowiresonasinglecrystalsiliconnanocore‏ ‎‡A  Bulk preparation of Si-SiOx hierarchical structures: high-density radially oriented amorphous silica nanowires on a single-crystal silicon nanocore‏ ‎‡9  1‏
919 ‎‡a  centimeterlongsinglecrystallinesinanowires‏ ‎‡A  Centimeter-Long Single-Crystalline Si Nanowires.‏ ‎‡9  1‏
919 ‎‡a  controlofdualconformationsdevelopingthermallyactivateddelayedfluorescenceemittersforhighlyefficientsingleemitterwhiteorganiclightemittingdiodes‏ ‎‡A  Control of Dual Conformations: Developing Thermally Activated Delayed Fluorescence Emitters for Highly Efficient Single-Emitter White Organic Light-Emitting Diodes‏ ‎‡9  1‏
919 ‎‡a  controlledsynthesisoforiented1dznonanostructuresontransparentconductivesubstrates‏ ‎‡A  Controlled synthesis of oriented 1D ZnO nanostructures on transparent conductive substrates‏ ‎‡9  1‏
919 ‎‡a  coumarinbasedthermallyactivateddelayedfluorescenceemitterswithhighexternalquantumefficiencyandlowefficiencyrolloffinthedevices‏ ‎‡A  Coumarin-Based Thermally Activated Delayed Fluorescence Emitters with High External Quantum Efficiency and Low Efficiency Roll-off in the Devices.‏ ‎‡9  1‏
996 ‎‡2  PTBNP|1019528‏
996 ‎‡2  ISNI|0000000374382227‏
996 ‎‡2  LC|n 2012039847‏
996 ‎‡2  BIBSYS|90326798‏
996 ‎‡2  ISNI|0000000370264506‏
996 ‎‡2  SUDOC|25447229X‏
996 ‎‡2  LC|nr 92001213‏
996 ‎‡2  CAOONL|ncf11900525‏
996 ‎‡2  LC|n 2019059366‏
996 ‎‡2  PLWABN|9812615464005606‏
996 ‎‡2  LC|nb2007003074‏
996 ‎‡2  DNB|1199856622‏
996 ‎‡2  PLWABN|9811538587105606‏
996 ‎‡2  SUDOC|28037240X‏
996 ‎‡2  LC|n 2023184675‏
996 ‎‡2  PLWABN|9810637776105606‏
996 ‎‡2  ERRR|12380969‏
996 ‎‡2  NTA|32442065X‏
996 ‎‡2  LC|n 2012025052‏
996 ‎‡2  BNF|17744304‏
996 ‎‡2  DNB|111104628X‏
996 ‎‡2  BNF|15025456‏
996 ‎‡2  NTA|344685004‏
996 ‎‡2  NTA|270884696‏
996 ‎‡2  NII|DA18717898‏
996 ‎‡2  ISNI|0000000496160796‏
996 ‎‡2  ISNI|0000000387194639‏
996 ‎‡2  ISNI|000000011919363X‏
996 ‎‡2  NTA|364154292‏
996 ‎‡2  RERO|A003998486‏
996 ‎‡2  CAOONL|ncf10610914‏
996 ‎‡2  DNB|124977138‏
996 ‎‡2  LC|no2014008082‏
996 ‎‡2  NTA|339708395‏
996 ‎‡2  LC|no2007115048‏
996 ‎‡2  ISNI|0000000108370581‏
996 ‎‡2  PLWABN|9810555406205606‏
996 ‎‡2  PLWABN|9811784280405606‏
996 ‎‡2  ISNI|0000000069585386‏
996 ‎‡2  ISNI|0000000371379663‏
996 ‎‡2  NSK|000523654‏
996 ‎‡2  ISNI|0000000071322622‏
996 ‎‡2  CYT|AC000615666‏
996 ‎‡2  SUDOC|233198083‏
996 ‎‡2  LC|n 2022184983‏
996 ‎‡2  NTA|364154586‏
996 ‎‡2  BNF|15604533‏
996 ‎‡2  DNB|1155539508‏
996 ‎‡2  NKC|ola2004228896‏
996 ‎‡2  NKC|xx0279295‏
996 ‎‡2  RERO|A027272734‏
996 ‎‡2  ISNI|0000000389029143‏
996 ‎‡2  NII|DA11543697‏
996 ‎‡2  DNB|1011279460‏
996 ‎‡2  NTA|405887337‏
996 ‎‡2  LC|no2009146674‏
996 ‎‡2  ISNI|0000000392617499‏
996 ‎‡2  NSK|000735742‏
996 ‎‡2  LC|n 2015021894‏
996 ‎‡2  NDL|001276818‏
996 ‎‡2  PLWABN|9810644667805606‏
996 ‎‡2  NTA|405887248‏
996 ‎‡2  NII|DA07023365‏
996 ‎‡2  J9U|987007363715305171‏
996 ‎‡2  BIBSYS|4022357‏
996 ‎‡2  LC|no2016083950‏
996 ‎‡2  SUDOC|275035913‏
996 ‎‡2  LC|n 2010083097‏
996 ‎‡2  DNB|1246978180‏
996 ‎‡2  ISNI|0000000395579037‏
996 ‎‡2  PLWABN|9812422791005606‏
996 ‎‡2  NTA|408629371‏
996 ‎‡2  LC|n 2015022278‏
996 ‎‡2  LC|no2010109208‏
996 ‎‡2  DNB|1015021964‏
996 ‎‡2  BIBSYS|1671433161852‏
996 ‎‡2  DNB|1151167908‏
996 ‎‡2  SUDOC|132967251‏
996 ‎‡2  NTA|364154136‏
996 ‎‡2  CYT|AC000008627‏
996 ‎‡2  DNB|17377167X‏
996 ‎‡2  LC|no2022044042‏
996 ‎‡2  ISNI|0000000442803880‏
997 ‎‡a  0 0 lived 0 0‏ ‎‡9  1‏