VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q105289192 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010752.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q105289192‏
035 ‎‡a (OCoLC)Q105289192‏
100 0 ‎‡a Roger Baxter‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Roger Baxter‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 1047Use of electronic data to identify new zoster cases for a vaccine effectiveness study.‏
670 ‎‡a Author's 1078Risk Factors Associated with Developing Fever Following First Dose Measles-Containing Vaccines.‏
670 ‎‡a Author's 1105Chronic Kidney Disease and Invasive Pneumococcal Disease in Adults‏
670 ‎‡a Author's 1578Clinical Features, Vaccine Status and S. Pneumoniae Serotypes among HIV-positive and HIV-negative Individuals Diagnosed with Invasive Pneumococcal Disease.‏
670 ‎‡a Author's 2461. Safety of Quadrivalent Meningococcal Polysaccharide Diphtheria Toxoid-Conjugate Vaccine in Adolescents‏
670 ‎‡a Author's 597Increase in IPD incidence in Adults in 2013-2014 after 2 consecutive years of decline following introduction of 13-valent pneumococcal conjugate vaccine‏
670 ‎‡a Author's 597Increase in IPD incidence in Adults in 2013-2014 after 2 consecutive years of decline following introduction of 13-valent pneumococcal conjugate vaccine (PCV13).‏
670 ‎‡a Author's A Phase III Evaluation of Immunogenicity and Safety of Two Trivalent Inactivated Seasonal Influenza Vaccines in US Children‏
670 ‎‡a Author's A postlicensure evaluation of the safety of Ann Arbor strain live attenuated influenza vaccine in children 24-59 months of age.‏
670 ‎‡a Author's A postmarketing evaluation of the safety of Ann Arbor strain live attenuated influenza vaccine in adults 18-49 years of age.‏
670 ‎‡a Author's A postmarketing evaluation of the safety of Ann Arbor strain live attenuated influenza vaccine in children 5 through 17 years of age.‏
670 ‎‡a Author's Absence of associations between influenza vaccines and increased risks of seizures, Guillain-Barré syndrome, encephalitis, or anaphylaxis in the 2012-2013 season‏
670 ‎‡a Author's Acute Demyelinating Events Following Vaccines: A Case-Centered Analysis.‏
670 ‎‡a Author's Algorithm to assess causality after individual adverse events following immunizations‏
670 ‎‡a Author's Antibody persistence after primary and booster doses of a quadrivalent meningococcal conjugate vaccine in adolescents‏
670 ‎‡a Author's Antibody persistence and booster response of a quadrivalent meningococcal conjugate vaccine in adolescents‏
670 ‎‡a Author's Assessing the safety of influenza vaccination in specific populations: children and the elderly‏
670 ‎‡a Author's Asthma exacerbations among asthmatic children receiving live attenuated versus inactivated influenza vaccines.‏
670 ‎‡a Author's Biologically plausible and evidence-based risk intervals in immunization safety research‏
670 ‎‡a Author's Birth outcomes following immunization of pregnant women with pandemic H1N1 influenza vaccine 2009-2010.‏
670 ‎‡a Author's C-B5-02: H1N1 Vaccine Safety Monitoring in the Vaccine Safety Datalink Project: New Challenges and Useful Lessons.‏
670 ‎‡a Author's Case-centered Analysis of Optic Neuritis After Vaccines‏
670 ‎‡a Author's Case-control study of antibiotic use and subsequent Clostridium difficile-associated diarrhea in hospitalized patients‏
670 ‎‡a Author's Causality assessment of adverse events reported to the Vaccine Adverse Event Reporting System (VAERS).‏
670 ‎‡a Author's Cervical intraepithelial neoplasia grade 3 and adenocarcinoma in situ: comparison of ICD-9 codes and pathology results--Kaiser Permanente, United States, 2000-2005.‏
670 ‎‡a Author's Comparative effectiveness of acellular versus whole-cell pertussis vaccines in teenagers‏
670 ‎‡a Author's Corrigendum to "Safety of quadrivalent live attenuated influenza vaccine in subjects aged 2-49years" [Vaccine 35 (2017) 1254-1258]‏
670 ‎‡a Author's Developing the next generation of vaccinologists‏
670 ‎‡a Author's Effect of age on the risk of Fever and seizures following immunization with measles-containing vaccines in children‏
670 ‎‡a Author's Effect of influenza vaccination on hospitalizations in persons aged 50 years and older‏
670 ‎‡a Author's Effectiveness of pertussis vaccines for adolescents and adults: case-control study‏
670 ‎‡a Author's Effectiveness of Vaccination During Pregnancy to Prevent Infant Pertussis‏
670 ‎‡a Author's Epidemiologic and clinical features of Bell's palsy among children in Northern California‏
670 ‎‡a Author's Estimated rates of influenza-associated outpatient visits during 2001-2010 in six US integrated health care delivery organizations‏
670 ‎‡a Author's Evaluation of immunization rates and safety among children with inborn errors of metabolism.‏
670 ‎‡a Author's Evidence of bias in studies of influenza vaccine effectiveness in elderly patients.‏
670 ‎‡a Author's Five-year Antibody Persistence and Booster Response to a Single Dose of Meningococcal A, C, W and Y Tetanus Toxoid Conjugate Vaccine in Adolescents and Young Adults: An Open, Randomized Trial‏
670 ‎‡a Author's Frequency of medically attended adverse events following tetanus and diphtheria toxoid vaccine in adolescents and young adults: a Vaccine Safety Datalink study.‏
670 ‎‡a Author's Further evidence for bias in observational studies of influenza vaccine effectiveness: the 2009 influenza A(H1N1) pandemic.‏
670 ‎‡a Author's Guillain–Barré syndrome and Fisher syndrome: Case definitions and guidelines for collection, analysis, and presentation of immunization safety data‏
670 ‎‡a Author's Guillain-Barré Syndrome, Influenza Vaccination, and Antecedent Respiratory and Gastrointestinal Infections: A Case-Centered Analysis in the Vaccine Safety Datalink, 2009-2011.‏
670 ‎‡a Author's H1N1 and seasonal influenza vaccine safety in the vaccine safety datalink project‏
670 ‎‡a Author's Hospital-level rates of fluoroquinolone use and the risk of hospital-acquired infection with ciprofloxacin-nonsusceptible Pseudomonas aeruginosa‏
670 ‎‡a Author's Immediate hypersensitivity reactions following monovalent 2009 pandemic influenza A (H1N1) vaccines: reports to VAERS.‏
670 ‎‡a Author's Immunization and Bell's palsy in children: a case-centered analysis‏
670 ‎‡a Author's Immunogenicity and Safety of a 13-Valent Pneumococcal Conjugate Vaccine Coadministered with a Quadrivalent Influenza Vaccine in Adults 50 Years and Older Previously Vaccinated With 23-Valent Pneumococcal Polysaccharide Vaccine‏
670 ‎‡a Author's Immunogenicity and Safety of an Investigational Quadrivalent Meningococcal ACWY Tetanus Toxoid Conjugate Vaccine in Healthy Adolescents and Young Adults 10 to 25 Years of Age‏
670 ‎‡a Author's Impact of an electronic medical record reminder on hepatitis B vaccine initiation and completion rates among insured adults with diabetes mellitus‏
670 ‎‡a Author's Impact of the 13-Valent Pneumococcal Conjugate Vaccine on Invasive Pneumococcal Disease After Introduction Into Routine Pediatric Use‏
670 ‎‡a Author's Impact of the use of heptavalent pneumococcal conjugate vaccine on disease epidemiology in children and adults‏
670 ‎‡a Author's Impact of vaccination on the epidemiology of varicella‏
670 ‎‡a Author's Impact of vaccination on the epidemiology of varicella: 1995-2009.‏
670 ‎‡a Author's Incidence of Herpes Zoster Among Children: 2003-2014‏
670 ‎‡a Author's Influenza vaccination and mortality: differentiating vaccine effects from bias‏
670 ‎‡a Author's Injection site and risk of medically attended local reactions to acellular pertussis vaccine‏
670 ‎‡a Author's Kaiser Permanente Northern California pregnancy database: Description and proof of concept study‏
670 ‎‡a Author's Kaiser Permanente Vaccine Study Center: Highlights of 2009-2012.‏
670 ‎‡a Author's Lack of association of Guillain-Barré syndrome with vaccinations‏
670 ‎‡a Author's Live attenuated influenza vaccine use and safety in children and adults with asthma.‏
670 ‎‡a Author's Live vaccine use and safety in DiGeorge syndrome‏
670 ‎‡a Author's Long-Term Effectiveness of the Live Zoster Vaccine in Preventing Shingles: A Cohort Study‏
670 ‎‡a Author's Long-term effectiveness of varicella vaccine: a 14-Year, prospective cohort study‏
670 ‎‡a Author's Long term risk of developing type 1 diabetes after HPV vaccination in males and females‏
670 ‎‡a Author's Measles-containing vaccines and febrile seizures in children age 4 to 6 years‏
670 ‎‡a Author's Measles-mumps-rubella-varicella combination vaccine and the risk of febrile seizures‏
670 ‎‡a Author's Monitoring vaccine safety using the Vaccine Safety Datalink: utilizing immunization registries for pandemic influenza‏
670 ‎‡a Author's Mortality Rates and Cause-of-Death Patterns in a Vaccinated Population‏
670 ‎‡a Author's Near real-time surveillance for influenza vaccine safety: proof-of-concept in the Vaccine Safety Datalink Project.‏
670 ‎‡a Author's No association between influenza vaccination during pregnancy and adverse birth outcomes‏
670 ‎‡a Author's Patterns in influenza antiviral medication use before and during the 2009 H1N1 pandemic, Vaccine Safety Datalink Project, 2000-2010.‏
670 ‎‡a Author's Patterns of pneumococcal vaccination and revaccination in elderly and non-elderly adults: a Vaccine Safety Datalink study‏
670 ‎‡a Author's Persistence of immune responses after a single dose of Novartis meningococcal serogroup A, C, W-135 and Y CRM-197 conjugate vaccine (Menveo®) or Menactra® among healthy adolescents‏
670 ‎‡a Author's Persistence of the immune response after MenACWY-CRM vaccination and response to a booster dose, in adolescents, children and infants‏
670 ‎‡a Author's Phase III comparison of an investigational quadrivalent meningococcal conjugate vaccine with the licensed meningococcal ACWY conjugate vaccine in adolescents‏
670 ‎‡a Author's Post-licensure safety surveillance study of routine use of tetanus toxoid, reduced diphtheria toxoid and 5-component acellular pertussis vaccine.‏
670 ‎‡a Author's Post licensure surveillance of influenza vaccines in the Vaccine Safety Datalink in the 2013-2014 and 2014-2015 seasons‏
670 ‎‡a Author's Postlicensure surveillance for pneumococcal invasive disease after use of heptavalent pneumococcal conjugate vaccine in Northern California Kaiser Permanente‏
670 ‎‡a Author's Postlicensure surveillance for pre-specified adverse events following the 13-valent pneumococcal conjugate vaccine in children‏
670 ‎‡a Author's Prevalence of HPV types in cervical specimens from an integrated healthcare delivery system: baseline assessment to measure HPV vaccine impact‏
670 ‎‡a Author's Quadrivalent meningococcal vaccination of adults: phase III comparison of an investigational conjugate vaccine, MenACWY-CRM, with the licensed vaccine, Menactra‏
670 ‎‡a Author's Rates of autoimmune diseases in Kaiser Permanente for use in vaccine adverse event safety studies‏
670 ‎‡a Author's Recurrent Guillain-Barre syndrome following vaccination‏
670 ‎‡a Author's Risk factors and familial clustering for fever 7-10days after the first dose of measles vaccines‏
670 ‎‡a Author's Risk of adverse events following oseltamivir treatment in influenza outpatients, Vaccine Safety Datalink Project, 2007-2010.‏
670 ‎‡a Author's Risk of confirmed Guillain-Barre syndrome following receipt of monovalent inactivated influenza A (H1N1) and seasonal influenza vaccines in the Vaccine Safety Datalink Project, 2009-2010.‏
670 ‎‡a Author's Risk of Herpes Zoster and Disseminated Varicella Zoster in Patients Taking Immunosuppressant Drugs at the Time of Zoster Vaccination‏
670 ‎‡a Author's Risk of medically attended local reactions following diphtheria toxoid containing vaccines in adolescents and young adults: A Vaccine Safety Datalink study‏
670 ‎‡a Author's Risk of rheumatoid arthritis following vaccination with tetanus, influenza and hepatitis B vaccines among persons 15–59 years of age‏
670 ‎‡a Author's Risk of underlying chronic medical conditions for invasive pneumococcal disease in adults‏
670 ‎‡a Author's Routinely vaccinating adolescents against meningococcus: targeting transmission & disease‏
670 ‎‡a Author's Safety of a tetanus-diphtheria-acellular pertussis vaccine when used off-label in an elderly population‏
670 ‎‡a Author's Safety of measles-containing vaccines in 1-year-old children‏
670 ‎‡a Author's Safety of quadrivalent live attenuated influenza vaccine in subjects aged 2-49years.‏
670 ‎‡a Author's Safety of Zostavax™--a cohort study in a managed care organization‏
670 ‎‡a Author's Serum anti-toxin B antibody correlates with protection from recurrent Clostridium difficile infection‏
670 ‎‡a Author's Serum anti-toxin B antibody correlates with protection from recurrent Clostridium difficile infection (CDI).‏
670 ‎‡a Author's Sudden-Onset Sensorineural Hearing Loss after Immunization: A Case-Centered Analysis.‏
670 ‎‡a Author's The risk of immune thrombocytopenic purpura after vaccination in children and adolescents‏
670 ‎‡a Author's The Vaccine Safety Datalink: a model for monitoring immunization safety‏
670 ‎‡a Author's The Vaccine Safety Datalink: successes and challenges monitoring vaccine safety.‏
670 ‎‡a Author's Treatment with monoclonal antibodies against Clostridium difficile toxins‏
670 ‎‡a Author's Understanding the Role of Human Variation in Vaccine Adverse Events: The Clinical Immunization Safety Assessment Network‏
670 ‎‡a Author's Vaccination and 30-Day Mortality Risk in Children, Adolescents, and Young Adults.‏
670 ‎‡a Author's Vaccination Site and Risk of Local Reactions in Children 1 Through 6 Years of Age‏
670 ‎‡a Author's Varicella vaccination and ischemic stroke in children: is there an association?‏
670 ‎‡a Author's Waning protection after fifth dose of acellular pertussis vaccine in children‏
670 ‎‡a Author's Waning protection following 5 doses of a 3-component diphtheria, tetanus, and acellular pertussis vaccine‏
670 ‎‡a Author's Waning Tdap Effectiveness in Adolescents‏
919 ‎‡a safetyofquadrivalentliveattenuatedinfluenzavaccineinsubjectsaged249years‏ ‎‡A Safety of quadrivalent live attenuated influenza vaccine in subjects aged 2-49years.‏ ‎‡9 1‏
919 ‎‡a riskofmedicallyattendedlocalreactionsfollowingdiphtheriatoxoidcontainingvaccinesinadolescentsandyoungadultsavaccinesafetydatalinkstudy‏ ‎‡A Risk of medically attended local reactions following diphtheria toxoid containing vaccines in adolescents and young adults: A Vaccine Safety Datalink study‏ ‎‡9 1‏
919 ‎‡a riskofherpeszosteranddisseminatedvaricellazosterinpatientstakingimmunosuppressantdrugsatthetimeofzostervaccination‏ ‎‡A Risk of Herpes Zoster and Disseminated Varicella Zoster in Patients Taking Immunosuppressant Drugs at the Time of Zoster Vaccination‏ ‎‡9 1‏
919 ‎‡a riskofconfirmedguillainbarresyndromefollowingreceiptofmonovalentinactivatedinfluenzaah1n1andseasonalinfluenzavaccinesinthevaccinesafetydatalinkproject2009‏ ‎‡A Risk of confirmed Guillain-Barre syndrome following receipt of monovalent inactivated influenza A (H1N1) and seasonal influenza vaccines in the Vaccine Safety Datalink Project, 2009-2010.‏ ‎‡9 1‏
919 ‎‡a riskofadverseeventsfollowingoseltamivirtreatmentininfluenzaoutpatientsvaccinesafetydatalinkproject2007‏ ‎‡A Risk of adverse events following oseltamivir treatment in influenza outpatients, Vaccine Safety Datalink Project, 2007-2010.‏ ‎‡9 1‏
919 ‎‡a riskfactorsandfamilialclusteringforfever710daysafterthe1doseofmeaslesvaccines‏ ‎‡A Risk factors and familial clustering for fever 7-10days after the first dose of measles vaccines‏ ‎‡9 1‏
919 ‎‡a recurrentguillainbarresyndromefollowingvaccination‏ ‎‡A Recurrent Guillain-Barre syndrome following vaccination‏ ‎‡9 1‏
919 ‎‡a ratesofautoimmunediseasesinkaiserpermanenteforuseinvaccineadverseeventsafetystudies‏ ‎‡A Rates of autoimmune diseases in Kaiser Permanente for use in vaccine adverse event safety studies‏ ‎‡9 1‏
919 ‎‡a safetyofzostavaxtmacohortstudyinamanagedcareorganization‏ ‎‡A Safety of Zostavax™--a cohort study in a managed care organization‏ ‎‡9 1‏
919 ‎‡a quadrivalentmeningococcalvaccinationofadultsphase3comparisonofaninvestigationalconjugatevaccinemenacwycrmwiththelicensedvaccinemenactra‏ ‎‡A Quadrivalent meningococcal vaccination of adults: phase III comparison of an investigational conjugate vaccine, MenACWY-CRM, with the licensed vaccine, Menactra‏ ‎‡9 1‏
919 ‎‡a serumantitoxinbantibodycorrelateswithprotectionfromrecurrentclostridiumdifficileinfection‏ ‎‡A Serum anti-toxin B antibody correlates with protection from recurrent Clostridium difficile infection‏ ‎‡9 1‏
919 ‎‡a prevalenceofhpvtypesincervicalspecimensfromanintegratedhealthcaredeliverysystembaselineassessmenttomeasurehpvvaccineimpact‏ ‎‡A Prevalence of HPV types in cervical specimens from an integrated healthcare delivery system: baseline assessment to measure HPV vaccine impact‏ ‎‡9 1‏
919 ‎‡a serumantitoxinbantibodycorrelateswithprotectionfromrecurrentclostridiumdifficileinfection401‏ ‎‡A Serum anti-toxin B antibody correlates with protection from recurrent Clostridium difficile infection (CDI).‏ ‎‡9 1‏
919 ‎‡a postlicensuresurveillanceforprespecifiedadverseeventsfollowingthe13valentpneumococcalconjugatevaccineinchildren‏ ‎‡A Postlicensure surveillance for pre-specified adverse events following the 13-valent pneumococcal conjugate vaccine in children‏ ‎‡9 1‏
919 ‎‡a suddenonsetsensorineuralhearinglossafterimmunizationacasecenteredanalysis‏ ‎‡A Sudden-Onset Sensorineural Hearing Loss after Immunization: A Case-Centered Analysis.‏ ‎‡9 1‏
919 ‎‡a postlicensuresurveillanceforpneumococcalinvasivediseaseafteruseofheptavalentpneumococcalconjugatevaccineinnortherncaliforniakaiserpermanente‏ ‎‡A Postlicensure surveillance for pneumococcal invasive disease after use of heptavalent pneumococcal conjugate vaccine in Northern California Kaiser Permanente‏ ‎‡9 1‏
919 ‎‡a riskofimmunethrombocytopenicpurpuraaftervaccinationinchildrenandadolescents‏ ‎‡A The risk of immune thrombocytopenic purpura after vaccination in children and adolescents‏ ‎‡9 1‏
919 ‎‡a postlicensuresurveillanceofinfluenzavaccinesinthevaccinesafetydatalinkinthe20132014and20142015seasons‏ ‎‡A Post licensure surveillance of influenza vaccines in the Vaccine Safety Datalink in the 2013-2014 and 2014-2015 seasons‏ ‎‡9 1‏
919 ‎‡a vaccinesafetydatalinkamodelformonitoringimmunizationsafety‏ ‎‡A The Vaccine Safety Datalink: a model for monitoring immunization safety‏ ‎‡9 1‏
919 ‎‡a vaccinesafetydatalinksuccessesandchallengesmonitoringvaccinesafety‏ ‎‡A The Vaccine Safety Datalink: successes and challenges monitoring vaccine safety.‏ ‎‡9 1‏
919 ‎‡a postlicensuresafetysurveillancestudyofroutineuseoftetanustoxoidreduceddiphtheriatoxoidand5componentacellularpertussisvaccine‏ ‎‡A Post-licensure safety surveillance study of routine use of tetanus toxoid, reduced diphtheria toxoid and 5-component acellular pertussis vaccine.‏ ‎‡9 1‏
919 ‎‡a treatmentwithmonoclonalantibodiesagainstclostridiumdifficiletoxins‏ ‎‡A Treatment with monoclonal antibodies against Clostridium difficile toxins‏ ‎‡9 1‏
919 ‎‡a understandingtheroleofhumanvariationinvaccineadverseeventstheclinicalimmunizationsafetyassessmentnetwork‏ ‎‡A Understanding the Role of Human Variation in Vaccine Adverse Events: The Clinical Immunization Safety Assessment Network‏ ‎‡9 1‏
919 ‎‡a phase3comparisonofaninvestigationalquadrivalentmeningococcalconjugatevaccinewiththelicensedmeningococcalacwyconjugatevaccineinadolescents‏ ‎‡A Phase III comparison of an investigational quadrivalent meningococcal conjugate vaccine with the licensed meningococcal ACWY conjugate vaccine in adolescents‏ ‎‡9 1‏
919 ‎‡a persistenceoftheimmuneresponseaftermenacwycrmvaccinationandresponsetoaboosterdoseinadolescentschildrenandinfants‏ ‎‡A Persistence of the immune response after MenACWY-CRM vaccination and response to a booster dose, in adolescents, children and infants‏ ‎‡9 1‏
919 ‎‡a persistenceofimmuneresponsesafterasingledoseofnovartismeningococcalserogroupa100w135andycrm197conjugatevaccinemenveoormenactraamonghealthyadolescents‏ ‎‡A Persistence of immune responses after a single dose of Novartis meningococcal serogroup A, C, W-135 and Y CRM-197 conjugate vaccine (Menveo®) or Menactra® among healthy adolescents‏ ‎‡9 1‏
919 ‎‡a patternsofpneumococcalvaccinationandrevaccinationinelderlyandnonelderlyadultsavaccinesafetydatalinkstudy‏ ‎‡A Patterns of pneumococcal vaccination and revaccination in elderly and non-elderly adults: a Vaccine Safety Datalink study‏ ‎‡9 1‏
919 ‎‡a patternsininfluenzaantiviralmedicationusebeforeandduringthe2009h1n1pandemicvaccinesafetydatalinkproject2000‏ ‎‡A Patterns in influenza antiviral medication use before and during the 2009 H1N1 pandemic, Vaccine Safety Datalink Project, 2000-2010.‏ ‎‡9 1‏
919 ‎‡a noassociationbetweeninfluenzavaccinationduringpregnancyandadversebirthoutcomes‏ ‎‡A No association between influenza vaccination during pregnancy and adverse birth outcomes‏ ‎‡9 1‏
919 ‎‡a vaccinationand30daymortalityriskinchildrenadolescentsandyoungadults‏ ‎‡A Vaccination and 30-Day Mortality Risk in Children, Adolescents, and Young Adults.‏ ‎‡9 1‏
919 ‎‡a vaccinationsiteandriskoflocalreactionsinchildren1through6yearsofage‏ ‎‡A Vaccination Site and Risk of Local Reactions in Children 1 Through 6 Years of Age‏ ‎‡9 1‏
919 ‎‡a varicellavaccinationandischemicstrokeinchildrenisthereanassociation‏ ‎‡A Varicella vaccination and ischemic stroke in children: is there an association?‏ ‎‡9 1‏
919 ‎‡a nearrealtimesurveillanceforinfluenzavaccinesafetyproofofconceptinthevaccinesafetydatalinkproject‏ ‎‡A Near real-time surveillance for influenza vaccine safety: proof-of-concept in the Vaccine Safety Datalink Project.‏ ‎‡9 1‏
919 ‎‡a mortalityratesandcauseofdeathpatternsinavaccinatedpopulation‏ ‎‡A Mortality Rates and Cause-of-Death Patterns in a Vaccinated Population‏ ‎‡9 1‏
919 ‎‡a monitoringvaccinesafetyusingthevaccinesafetydatalinkutilizingimmunizationregistriesforpandemicinfluenza‏ ‎‡A Monitoring vaccine safety using the Vaccine Safety Datalink: utilizing immunization registries for pandemic influenza‏ ‎‡9 1‏
919 ‎‡a measlesmumpsrubellavaricellacombinationvaccineandtheriskoffebrileseizures‏ ‎‡A Measles-mumps-rubella-varicella combination vaccine and the risk of febrile seizures‏ ‎‡9 1‏
919 ‎‡a measlescontainingvaccinesandfebrileseizuresinchildrenage4to6years‏ ‎‡A Measles-containing vaccines and febrile seizures in children age 4 to 6 years‏ ‎‡9 1‏
919 ‎‡a longtermriskofdevelopingtype1diabetesafterhpvvaccinationinmalesandfemales‏ ‎‡A Long term risk of developing type 1 diabetes after HPV vaccination in males and females‏ ‎‡9 1‏
919 ‎‡a longtermeffectivenessofvaricellavaccinea14yearprospectivecohortstudy‏ ‎‡A Long-term effectiveness of varicella vaccine: a 14-Year, prospective cohort study‏ ‎‡9 1‏
919 ‎‡a longtermeffectivenessofthelivezostervaccineinpreventingshinglesacohortstudy‏ ‎‡A Long-Term Effectiveness of the Live Zoster Vaccine in Preventing Shingles: A Cohort Study‏ ‎‡9 1‏
919 ‎‡a livevaccineuseandsafetyindigeorgesyndrome‏ ‎‡A Live vaccine use and safety in DiGeorge syndrome‏ ‎‡9 1‏
919 ‎‡a liveattenuatedinfluenzavaccineuseandsafetyinchildrenandadultswithasthma‏ ‎‡A Live attenuated influenza vaccine use and safety in children and adults with asthma.‏ ‎‡9 1‏
919 ‎‡a lackofassociationofguillainbarresyndromewithvaccinations‏ ‎‡A Lack of association of Guillain-Barré syndrome with vaccinations‏ ‎‡9 1‏
919 ‎‡a kaiserpermanentevaccinestudycenterhighlightsof2009‏ ‎‡A Kaiser Permanente Vaccine Study Center: Highlights of 2009-2012.‏ ‎‡9 1‏
919 ‎‡a waningprotectionafter5doseofacellularpertussisvaccineinchildren‏ ‎‡A Waning protection after fifth dose of acellular pertussis vaccine in children‏ ‎‡9 1‏
919 ‎‡a waningprotectionfollowing5dosesofa3componentdiphtheriatetanusandacellularpertussisvaccine‏ ‎‡A Waning protection following 5 doses of a 3-component diphtheria, tetanus, and acellular pertussis vaccine‏ ‎‡9 1‏
919 ‎‡a waningtdapeffectivenessinadolescents‏ ‎‡A Waning Tdap Effectiveness in Adolescents‏ ‎‡9 1‏
919 ‎‡a kaiserpermanentenortherncaliforniapregnancydatabasedescriptionandproofofconceptstudy‏ ‎‡A Kaiser Permanente Northern California pregnancy database: Description and proof of concept study‏ ‎‡9 1‏
919 ‎‡a injectionsiteandriskofmedicallyattendedlocalreactionstoacellularpertussisvaccine‏ ‎‡A Injection site and risk of medically attended local reactions to acellular pertussis vaccine‏ ‎‡9 1‏
919 ‎‡a influenzavaccinationandmortalitydifferentiatingvaccineeffectsfrombias‏ ‎‡A Influenza vaccination and mortality: differentiating vaccine effects from bias‏ ‎‡9 1‏
919 ‎‡a incidenceofherpeszosteramongchildren2003‏ ‎‡A Incidence of Herpes Zoster Among Children: 2003-2014‏ ‎‡9 1‏
919 ‎‡a impactofvaccinationontheepidemiologyofvaricella1995‏ ‎‡A Impact of vaccination on the epidemiology of varicella: 1995-2009.‏ ‎‡9 1‏
919 ‎‡a impactofvaccinationontheepidemiologyofvaricella‏ ‎‡A Impact of vaccination on the epidemiology of varicella‏ ‎‡9 1‏
919 ‎‡a impactoftheuseofheptavalentpneumococcalconjugatevaccineondiseaseepidemiologyinchildrenandadults‏ ‎‡A Impact of the use of heptavalent pneumococcal conjugate vaccine on disease epidemiology in children and adults‏ ‎‡9 1‏
919 ‎‡a impactofthe13valentpneumococcalconjugatevaccineoninvasivepneumococcaldiseaseafterintroductionintoroutinepediatricuse‏ ‎‡A Impact of the 13-Valent Pneumococcal Conjugate Vaccine on Invasive Pneumococcal Disease After Introduction Into Routine Pediatric Use‏ ‎‡9 1‏
919 ‎‡a impactofanelectronicmedicalrecordreminderonhepatitisbvaccineinitiationandcompletionratesamonginsuredadultswithdiabetesmellitus‏ ‎‡A Impact of an electronic medical record reminder on hepatitis B vaccine initiation and completion rates among insured adults with diabetes mellitus‏ ‎‡9 1‏
919 ‎‡a immunogenicityandsafetyofaninvestigationalquadrivalentmeningococcalacwytetanustoxoidconjugatevaccineinhealthyadolescentsandyoungadults10to25yearsofage‏ ‎‡A Immunogenicity and Safety of an Investigational Quadrivalent Meningococcal ACWY Tetanus Toxoid Conjugate Vaccine in Healthy Adolescents and Young Adults 10 to 25 Years of Age‏ ‎‡9 1‏
919 ‎‡a immunogenicityandsafetyofa13valentpneumococcalconjugatevaccinecoadministeredwithaquadrivalentinfluenzavaccineinadults50yearsandolderpreviouslyvaccinatedwith23valentpneumococcalpolysaccharidevaccine‏ ‎‡A Immunogenicity and Safety of a 13-Valent Pneumococcal Conjugate Vaccine Coadministered with a Quadrivalent Influenza Vaccine in Adults 50 Years and Older Previously Vaccinated With 23-Valent Pneumococcal Polysaccharide Vaccine‏ ‎‡9 1‏
919 ‎‡a immunizationandbellspalsyinchildrenacasecenteredanalysis‏ ‎‡A Immunization and Bell's palsy in children: a case-centered analysis‏ ‎‡9 1‏
919 ‎‡a immediatehypersensitivityreactionsfollowingmonovalent2009pandemicinfluenzaah1n1vaccinesreportstovaers‏ ‎‡A Immediate hypersensitivity reactions following monovalent 2009 pandemic influenza A (H1N1) vaccines: reports to VAERS.‏ ‎‡9 1‏
919 ‎‡a hospitallevelratesoffluoroquinoloneuseandtheriskofhospitalacquiredinfectionwithciprofloxacinnonsusceptiblepseudomonasaeruginosa‏ ‎‡A Hospital-level rates of fluoroquinolone use and the risk of hospital-acquired infection with ciprofloxacin-nonsusceptible Pseudomonas aeruginosa‏ ‎‡9 1‏
919 ‎‡a h1n1andseasonalinfluenzavaccinesafetyinthevaccinesafetydatalinkproject‏ ‎‡A H1N1 and seasonal influenza vaccine safety in the vaccine safety datalink project‏ ‎‡9 1‏
919 ‎‡a guillainbarresyndromeinfluenzavaccinationandantecedentrespiratoryandgastrointestinalinfectionsacasecenteredanalysisinthevaccinesafetydatalink2009‏ ‎‡A Guillain-Barré Syndrome, Influenza Vaccination, and Antecedent Respiratory and Gastrointestinal Infections: A Case-Centered Analysis in the Vaccine Safety Datalink, 2009-2011.‏ ‎‡9 1‏
919 ‎‡a guillainbarresyndromeandfishersyndromecasedefinitionsandguidelinesforcollectionanalysisandpresentationofimmunizationsafetydata‏ ‎‡A Guillain–Barré syndrome and Fisher syndrome: Case definitions and guidelines for collection, analysis, and presentation of immunization safety data‏ ‎‡9 1‏
919 ‎‡a riskofrheumatoidarthritisfollowingvaccinationwithtetanusinfluenzaandhepatitisbvaccinesamongpersons1559yearsofage‏ ‎‡A Risk of rheumatoid arthritis following vaccination with tetanus, influenza and hepatitis B vaccines among persons 15–59 years of age‏ ‎‡9 1‏
919 ‎‡a furtherevidenceforbiasinobservationalstudiesofinfluenzavaccineeffectivenessthe2009influenzaah1n1pandemic‏ ‎‡A Further evidence for bias in observational studies of influenza vaccine effectiveness: the 2009 influenza A(H1N1) pandemic.‏ ‎‡9 1‏
919 ‎‡a frequencyofmedicallyattendedadverseeventsfollowingtetanusanddiphtheriatoxoidvaccineinadolescentsandyoungadultsavaccinesafetydatalinkstudy‏ ‎‡A Frequency of medically attended adverse events following tetanus and diphtheria toxoid vaccine in adolescents and young adults: a Vaccine Safety Datalink study.‏ ‎‡9 1‏
919 ‎‡a 5yearantibodypersistenceandboosterresponsetoasingledoseofmeningococcala100wandytetanustoxoidconjugatevaccineinadolescentsandyoungadultsanopenrandomizedtrial‏ ‎‡A Five-year Antibody Persistence and Booster Response to a Single Dose of Meningococcal A, C, W and Y Tetanus Toxoid Conjugate Vaccine in Adolescents and Young Adults: An Open, Randomized Trial‏ ‎‡9 1‏
919 ‎‡a evidenceofbiasinstudiesofinfluenzavaccineeffectivenessinelderlypatients‏ ‎‡A Evidence of bias in studies of influenza vaccine effectiveness in elderly patients.‏ ‎‡9 1‏
919 ‎‡a evaluationofimmunizationratesandsafetyamongchildrenwithinbornerrorsofmetabolism‏ ‎‡A Evaluation of immunization rates and safety among children with inborn errors of metabolism.‏ ‎‡9 1‏
919 ‎‡a estimatedratesofinfluenzaassociatedoutpatientvisitsduring20012010in6usintegratedhealthcaredeliveryorganizations‏ ‎‡A Estimated rates of influenza-associated outpatient visits during 2001-2010 in six US integrated health care delivery organizations‏ ‎‡9 1‏
919 ‎‡a epidemiologicandclinicalfeaturesofbellspalsyamongchildreninnortherncalifornia‏ ‎‡A Epidemiologic and clinical features of Bell's palsy among children in Northern California‏ ‎‡9 1‏
919 ‎‡a effectivenessofvaccinationduringpregnancytopreventinfantpertussis‏ ‎‡A Effectiveness of Vaccination During Pregnancy to Prevent Infant Pertussis‏ ‎‡9 1‏
919 ‎‡a effectivenessofpertussisvaccinesforadolescentsandadultscasecontrolstudy‏ ‎‡A Effectiveness of pertussis vaccines for adolescents and adults: case-control study‏ ‎‡9 1‏
919 ‎‡a effectofinfluenzavaccinationonhospitalizationsinpersonsaged50yearsandolder‏ ‎‡A Effect of influenza vaccination on hospitalizations in persons aged 50 years and older‏ ‎‡9 1‏
919 ‎‡a effectofageontheriskoffeverandseizuresfollowingimmunizationwithmeaslescontainingvaccinesinchildren‏ ‎‡A Effect of age on the risk of Fever and seizures following immunization with measles-containing vaccines in children‏ ‎‡9 1‏
919 ‎‡a developingthenextgenerationofvaccinologists‏ ‎‡A Developing the next generation of vaccinologists‏ ‎‡9 1‏
919 ‎‡a corrigendumtosafetyofquadrivalentliveattenuatedinfluenzavaccineinsubjectsaged249yearsvaccine3520171254‏ ‎‡A Corrigendum to "Safety of quadrivalent live attenuated influenza vaccine in subjects aged 2-49years" [Vaccine 35 (2017) 1254-1258]‏ ‎‡9 1‏
919 ‎‡a comparativeeffectivenessofacellularversuswholecellpertussisvaccinesinteenagers‏ ‎‡A Comparative effectiveness of acellular versus whole-cell pertussis vaccines in teenagers‏ ‎‡9 1‏
919 ‎‡a cervicalintraepithelialneoplasiagrade3andadenocarcinomainsitucomparisonoficd9codesandpathologyresultskaiserpermanenteunitedstates2000‏ ‎‡A Cervical intraepithelial neoplasia grade 3 and adenocarcinoma in situ: comparison of ICD-9 codes and pathology results--Kaiser Permanente, United States, 2000-2005.‏ ‎‡9 1‏
919 ‎‡a causalityassessmentofadverseeventsreportedtothevaccineadverseeventreportingsystemvaers‏ ‎‡A Causality assessment of adverse events reported to the Vaccine Adverse Event Reporting System (VAERS).‏ ‎‡9 1‏
919 ‎‡a casecontrolstudyofantibioticuseandsubsequentclostridiumdifficileassociateddiarrheainhospitalizedpatients‏ ‎‡A Case-control study of antibiotic use and subsequent Clostridium difficile-associated diarrhea in hospitalized patients‏ ‎‡9 1‏
919 ‎‡a casecenteredanalysisofopticneuritisaftervaccines‏ ‎‡A Case-centered Analysis of Optic Neuritis After Vaccines‏ ‎‡9 1‏
919 ‎‡a 100b502h1n1vaccinesafetymonitoringinthevaccinesafetydatalinkprojectnewchallengesandusefullessons‏ ‎‡A C-B5-02: H1N1 Vaccine Safety Monitoring in the Vaccine Safety Datalink Project: New Challenges and Useful Lessons.‏ ‎‡9 1‏
919 ‎‡a birthoutcomesfollowingimmunizationofpregnantwomenwithpandemich1n1influenzavaccine2009‏ ‎‡A Birth outcomes following immunization of pregnant women with pandemic H1N1 influenza vaccine 2009-2010.‏ ‎‡9 1‏
919 ‎‡a biologicallyplausibleandevidencebasedriskintervalsinimmunizationsafetyresearch‏ ‎‡A Biologically plausible and evidence-based risk intervals in immunization safety research‏ ‎‡9 1‏
919 ‎‡a asthmaexacerbationsamongasthmaticchildrenreceivingliveattenuatedversusinactivatedinfluenzavaccines‏ ‎‡A Asthma exacerbations among asthmatic children receiving live attenuated versus inactivated influenza vaccines.‏ ‎‡9 1‏
919 ‎‡a assessingthesafetyofinfluenzavaccinationinspecificpopulationschildrenandtheelderly‏ ‎‡A Assessing the safety of influenza vaccination in specific populations: children and the elderly‏ ‎‡9 1‏
919 ‎‡a antibodypersistenceandboosterresponseofaquadrivalentmeningococcalconjugatevaccineinadolescents‏ ‎‡A Antibody persistence and booster response of a quadrivalent meningococcal conjugate vaccine in adolescents‏ ‎‡9 1‏
919 ‎‡a antibodypersistenceafterprimaryandboosterdosesofaquadrivalentmeningococcalconjugatevaccineinadolescents‏ ‎‡A Antibody persistence after primary and booster doses of a quadrivalent meningococcal conjugate vaccine in adolescents‏ ‎‡9 1‏
919 ‎‡a algorithmtoassesscausalityafterindividualadverseeventsfollowingimmunizations‏ ‎‡A Algorithm to assess causality after individual adverse events following immunizations‏ ‎‡9 1‏
919 ‎‡a acutedemyelinatingeventsfollowingvaccinesacasecenteredanalysis‏ ‎‡A Acute Demyelinating Events Following Vaccines: A Case-Centered Analysis.‏ ‎‡9 1‏
919 ‎‡a absenceofassociationsbetweeninfluenzavaccinesandincreasedrisksofseizuresguillainbarresyndromeencephalitisoranaphylaxisinthe20122013season‏ ‎‡A Absence of associations between influenza vaccines and increased risks of seizures, Guillain-Barré syndrome, encephalitis, or anaphylaxis in the 2012-2013 season‏ ‎‡9 1‏
919 ‎‡a postmarketingevaluationofthesafetyofannarborstrainliveattenuatedinfluenzavaccineinchildren5through17yearsofage‏ ‎‡A A postmarketing evaluation of the safety of Ann Arbor strain live attenuated influenza vaccine in children 5 through 17 years of age.‏ ‎‡9 1‏
919 ‎‡a postmarketingevaluationofthesafetyofannarborstrainliveattenuatedinfluenzavaccineinadults1849yearsofage‏ ‎‡A A postmarketing evaluation of the safety of Ann Arbor strain live attenuated influenza vaccine in adults 18-49 years of age.‏ ‎‡9 1‏
919 ‎‡a postlicensureevaluationofthesafetyofannarborstrainliveattenuatedinfluenzavaccineinchildren2459monthsofage‏ ‎‡A A postlicensure evaluation of the safety of Ann Arbor strain live attenuated influenza vaccine in children 24-59 months of age.‏ ‎‡9 1‏
919 ‎‡a phase3evaluationofimmunogenicityandsafetyof2trivalentinactivatedseasonalinfluenzavaccinesinuschildren‏ ‎‡A A Phase III Evaluation of Immunogenicity and Safety of Two Trivalent Inactivated Seasonal Influenza Vaccines in US Children‏ ‎‡9 1‏
919 ‎‡a 597increaseinipdincidenceinadultsin20132014after2consecutiveyearsofdeclinefollowingintroductionof13valentpneumococcalconjugatevaccinepcv13‏ ‎‡A 597Increase in IPD incidence in Adults in 2013-2014 after 2 consecutive years of decline following introduction of 13-valent pneumococcal conjugate vaccine (PCV13).‏ ‎‡9 1‏
919 ‎‡a 597increaseinipdincidenceinadultsin20132014after2consecutiveyearsofdeclinefollowingintroductionof13valentpneumococcalconjugatevaccine‏ ‎‡A 597Increase in IPD incidence in Adults in 2013-2014 after 2 consecutive years of decline following introduction of 13-valent pneumococcal conjugate vaccine‏ ‎‡9 1‏
919 ‎‡a 2461safetyofquadrivalentmeningococcalpolysaccharidediphtheriatoxoidconjugatevaccineinadolescents‏ ‎‡A 2461. Safety of Quadrivalent Meningococcal Polysaccharide Diphtheria Toxoid-Conjugate Vaccine in Adolescents‏ ‎‡9 1‏
919 ‎‡a 1578clinicalfeaturesvaccinestatusandspneumoniaeserotypesamonghivpositiveandhivnegativeindividualsdiagnosedwithinvasivepneumococcaldisease‏ ‎‡A 1578Clinical Features, Vaccine Status and S. Pneumoniae Serotypes among HIV-positive and HIV-negative Individuals Diagnosed with Invasive Pneumococcal Disease.‏ ‎‡9 1‏
919 ‎‡a 1105chronickidneydiseaseandinvasivepneumococcaldiseaseinadults‏ ‎‡A 1105Chronic Kidney Disease and Invasive Pneumococcal Disease in Adults‏ ‎‡9 1‏
919 ‎‡a 1078riskfactorsassociatedwithdevelopingfeverfollowing1dosemeaslescontainingvaccines‏ ‎‡A 1078Risk Factors Associated with Developing Fever Following First Dose Measles-Containing Vaccines.‏ ‎‡9 1‏
919 ‎‡a 1047useofelectronicdatatoidentifynewzostercasesforavaccineeffectivenessstudy‏ ‎‡A 1047Use of electronic data to identify new zoster cases for a vaccine effectiveness study.‏ ‎‡9 1‏
919 ‎‡a riskofunderlyingchronicmedicalconditionsforinvasivepneumococcaldiseaseinadults‏ ‎‡A Risk of underlying chronic medical conditions for invasive pneumococcal disease in adults‏ ‎‡9 1‏
919 ‎‡a routinelyvaccinatingadolescentsagainstmeningococcustargetingtransmissionanddisease‏ ‎‡A Routinely vaccinating adolescents against meningococcus: targeting transmission & disease‏ ‎‡9 1‏
919 ‎‡a safetyofatetanusdiphtheriaacellularpertussisvaccinewhenusedofflabelinanelderlypopulation‏ ‎‡A Safety of a tetanus-diphtheria-acellular pertussis vaccine when used off-label in an elderly population‏ ‎‡9 1‏
919 ‎‡a safetyofmeaslescontainingvaccinesin1yearoldchildren‏ ‎‡A Safety of measles-containing vaccines in 1-year-old children‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2010‏ ‎‡9 7‏
943 ‎‡a 200x‏ ‎‡A 2009‏ ‎‡9 2‏
943 ‎‡a 125x‏ ‎‡A 1258‏ ‎‡9 1‏
996 ‎‡2 DNB|1165187612‏
996 ‎‡2 BIBSYS|90509100‏
996 ‎‡2 ISNI|0000000076656322‏
996 ‎‡2 ISNI|0000000067700045‏
996 ‎‡2 J9U|987007444460205171‏
996 ‎‡2 BIBSYS|90065076‏
996 ‎‡2 LC|no2009175961‏
996 ‎‡2 CAOONL|ncf11034824‏
996 ‎‡2 LC|n 2003105838‏
996 ‎‡2 BIBSYS|36140‏
996 ‎‡2 RERO|A005695361‏
996 ‎‡2 BIBSYS|90954666‏
996 ‎‡2 ISNI|0000000045901479‏
996 ‎‡2 NUKAT|n 2013003090‏
996 ‎‡2 LC|no2008057874‏
996 ‎‡2 LC|no2003108444‏
996 ‎‡2 DNB|1037275101‏
996 ‎‡2 NUKAT|n 2013079319‏
996 ‎‡2 DNB|1025516001‏
996 ‎‡2 ISNI|0000000024824531‏
996 ‎‡2 SUDOC|243489048‏
996 ‎‡2 LC|n 87914871‏
996 ‎‡2 J9U|987007438824005171‏
996 ‎‡2 LC|n 79069823‏
996 ‎‡2 BIBSYS|11068643‏
996 ‎‡2 NSK|000270104‏
996 ‎‡2 LC|n 83203258‏
996 ‎‡2 NTA|369202813‏
996 ‎‡2 BIBSYS|90779876‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏