VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q33279028 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000153.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q33279028‏
024 ‎‡a 0000-0001-5144-2421‏ ‎‡2 orcid‏
024 ‎‡a 6505966492‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q33279028‏
043 ‎‡c PT‏
100 0 ‎‡a David James Harris‏ ‎‡c biologiste, herpétologiste et arachnologue portugais‏ ‎‡9 fr‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a David James Harris‏ ‎‡c Portuguese biologist, herpetologist and arachnologist‏ ‎‡9 en‏
400 0 ‎‡a David James Harris‏ ‎‡c Portugees onderzoeker‏ ‎‡9 nl‏
400 0 ‎‡a David James Harris‏ ‎‡c investigador portugués‏ ‎‡9 ast‏
400 0 ‎‡a David James Harris‏ ‎‡c portugiesischer Arachnologe‏ ‎‡9 de‏
400 0 ‎‡a David James Harris‏ ‎‡c investigador portugués‏ ‎‡9 es‏
670 ‎‡a Author's A new species of Hepatozoon Miller, 1908 (Apicomplexa: Adelerina) from the snake Philodryas nattereri Steindachner (Squamata: Dipsadidae) in northeastern Brazil‏
670 ‎‡a Author's A new species of Spauligodon‏
670 ‎‡a Author's A new species of Spauligodon (Nematoda: Oxyurida: Pharyngodonidae) in geckos from São Nicolau Island (Cape Verde) and its phylogenetic assessment‏
670 ‎‡a Author's A paradise for parasites? Seven new haemogregarine species infecting lizards from the Canary Islands‏
670 ‎‡a Author's A phylogenetic assessment of the colonisation patterns in Spauligodon atlanticus Astasio-Arbiza et al., 1987 (Nematoda: Oxyurida: Pharyngodonidae), a parasite of lizards of the genus Gallotia Boulenger: no simple answers‏
670 ‎‡a Author's Along for the ride or missing it altogether: exploring the host specificity and diversity of haemogregarines in the Canary Islands.‏
670 ‎‡a Author's An integrative taxonomic revision of the Tarentola geckos (Squamata, Phyllodactylidae) of the Cape Verde Islands‏
670 ‎‡a Author's Ancient introgression of Lepus timidus mtDNA into L. granatensis and L. europaeus in the Iberian Peninsula‏
670 ‎‡a Author's Apicomplexa primers amplify Proteromonas (Stramenopiles, Slopalinida, Proteromonadidae) in tissue and blood samples from lizards.‏
670 ‎‡a Author's Assessing the diversity, host-specificity and infection patterns of apicomplexan parasites in reptiles from Oman, Arabia.‏
670 ‎‡a Author's Assessing the influence of geographic distance in parasite communities of an exotic lizard.‏
670 ‎‡a Author's Assessing the phylogenetic signal of the nuclear β-Fibrinogen intron 7 in salamandrids‏
670 ‎‡a Author's Assessing the phylogenetic signal of the nuclear β-Fibrinogen intron 7 in salamandrids (Amphibia: Salamandridae)‏
670 ‎‡a Author's Beneath the hairy look: the hidden reproductive diversity of the Gibsmithia hawaiiensis complex (Dumontiaceae, Rhodophyta).‏
670 ‎‡a Author's Biogeographic and demographic history of the Mediterranean snakes Malpolon monspessulanus and Hemorrhois hippocrepis across the Strait of Gibraltar‏
670 ‎‡a Author's Biogeographical crossroad across the Pillars of Hercules: Evolutionary history of Psammodromus lizards in space and time‏
670 ‎‡a Author's Blood parasite diversity (Apicomplexa: Haemogregarinidae) within the western populations of the European pond turtle Emys orbicularis‏
670 ‎‡a Author's Codon bias variation in C-mos between squamate families might distort phylogenetic inferences‏
670 ‎‡a Author's Comments on the Systematic Revision of Adeleid Haemogregarines: Are More Data Needed?‏
670 ‎‡a Author's Comparative phylogeography of northwest African Natrix maura‏
670 ‎‡a Author's Comparative phylogeography of northwest African Natrix maura (Serpentes: Colubridae) inferred from mtDNA sequences‏
670 ‎‡a Author's Comparing patterns of nuclear and mitochondrial divergence in a cryptic species complex: the case of Iberian and North African wall lizards (Podarcis, Lacertidae)‏
670 ‎‡a Author's Complex biogeographical distribution of genetic variation within Podarcis wall lizards across the Strait of Gibraltar‏
670 ‎‡a Author's Complex estimates of evolutionary relationships in Tarentola mauritanica‏
670 ‎‡a Author's Complex estimates of evolutionary relationships in Tarentola mauritanica (Reptilia: Gekkonidae) derived from mitochondrial DNA sequences‏
670 ‎‡a Author's Conflicting patterns of nucleotide diversity between mtDNA and nDNA in the Moorish gecko, Tarentola mauritanica.‏
670 ‎‡a Author's Conservation status of the world's skinks (Scincidae): Taxonomic and geographic patterns in extinction risk‏
670 ‎‡a Author's Correction to: The role of hybridisation in the origin and evolutionary persistence of vertebrate parthenogens: a case study of Darevskia lizards‏
670 ‎‡a Author's Cryptic diversity within the endemic prehensile-tailed geckoUrocotyledon inexpectataacross the Seychelles Islands: patterns of phylogeographical structure and isolation at the multilocus level‏
670 ‎‡a Author's Cryptic speciation patterns in Iranian rock lizards uncovered by integrative taxonomy‏
670 ‎‡a Author's Cryptic species unveiled: the case of the nematodeSpauligodon atlanticus‏
670 ‎‡a Author's Cyanobacterial hydrogenases: diversity, regulation and applications‏
670 ‎‡a Author's Deciphering patterns of transoceanic dispersal: the evolutionary origin and biogeography of coastal lizards‏
670 ‎‡a Author's Deciphering patterns of transoceanic dispersal: the evolutionary origin and biogeography of coastal lizards (Cryptoblepharus) in the Western Indian Ocean region‏
670 ‎‡a Author's Deep evolutionary lineages in a Western Mediterranean snake‏
670 ‎‡a Author's Deep evolutionary lineages in a Western Mediterranean snake (Vipera latastei/monticola group) and high genetic structuring in Southern Iberian populations‏
670 ‎‡a Author's Digging up the roots of an insular hotspot of genetic diversity: decoupled mito-nuclear histories in the evolution of the Corsican-Sardinian endemic lizard Podarcis tiliguerta‏
670 ‎‡a Author's Diversity and phylogenetic relationships of Hemidactylus geckos from the Comoro islands‏
670 ‎‡a Author's Does Contraceptive Use Lead to Increased Affairs? A Response to Larmuseau et al‏
670 ‎‡a Author's Environmental temperatures shape thermal physiology as well as diversification and genome-wide substitution rates in lizards‏
670 ‎‡a Author's Escape tactics of two syntopic forms of the Lacerta perspicillata complex with different colour patterns‏
670 ‎‡a Author's Evaluating the phylogenetic signal limit from mitogenomes, slow evolving nuclear genes, and the concatenation approach. New insights into the Lacertini radiation using fast evolving nuclear genes and species trees‏
670 ‎‡a Author's Evidence for genetic similarity of two allopatric European hares (Lepus corsicanus and L. castroviejoi) inferred from nuclear DNA sequences.‏
670 ‎‡a Author's Evolution of alternative male morphotypes in oxyurid nematodes: a case of convergence?‏
670 ‎‡a Author's Evolutionary and demographic correlates of Pleistocene coastline changes in the Sicilian wall lizard Podarcis wagleriana‏
670 ‎‡a Author's Evolutionary dynamics of an expressed MHC class IIβ locus in the Ranidae (Anura) uncovered by genome walking and high-throughput amplicon sequencing‏
670 ‎‡a Author's Evolutionary history of the genus Tarentola (Gekkota: Phyllodactylidae) from the Mediterranean Basin, estimated using multilocus sequence data‏
670 ‎‡a Author's Evolutionary history of the Maltese wall lizard Podarcis filfolensis: insights on the ‘Expansion–Contraction’ model of Pleistocene biogeography‏
670 ‎‡a Author's Evolutionary patterns of the mitochondrial genome in the Moorish gecko, Tarentola mauritanica‏
670 ‎‡a Author's Extreme genetic diversity in the lizard Atlantolacerta andreanskyi (Werner, 1929): a montane cryptic species complex‏
670 ‎‡a Author's First report of Hepatozoon (Apicomplexa: Adeleorina) in caecilians, with description of a new species.‏
670 ‎‡a Author's Genetic admixture between the Iberian endemic lizardsPodarcis bocageiandPodarcis carbonelli: evidence for limited natural hybridization and a bimodal hybrid zone‏
670 ‎‡a Author's Genetic diversity of Hepatozoon (Apicomplexa) from domestic cats in South Africa, with a global reassessment of Hepatozoon felis diversity‏
670 ‎‡a Author's Genetic diversity within scorpions of the genus Buthus from the Iberian Peninsula: mitochondrial DNA sequence data indicate additional distinct cryptic lineages‏
670 ‎‡a Author's Genetic polymorphism of 11 allozyme loci in populations of wall lizards‏
670 ‎‡a Author's Genetic polymorphism of 11 allozyme loci in populations of wall lizards (Podarcis sp.) from the Iberian Peninsula and North Africa‏
670 ‎‡a Author's Genetic variability within the Oudri's fan-footed gecko Ptyodactylus oudrii in North Africa assessed using mitochondrial and nuclear DNA sequences‏
670 ‎‡a Author's Getting ahead: exploitative competition by an invasive lizard‏
670 ‎‡a Author's Hares on thin ice: Introgression of mitochondrial DNA in hares and its implications for recent phylogenetic analyses‏
670 ‎‡a Author's Hepatozoon infection prevalence in four snake genera: influence of diet, prey parasitemia levels, or parasite type?‏
670 ‎‡a Author's High Diversity of Hepatozoon spp. in Geckos of the Genus Tarentola.‏
670 ‎‡a Author's High levels of mitochondrial DNA diversity within oxychilid land snails (subgenus Drouetia Gude, 1911) from São Miguel island, Azores‏
670 ‎‡a Author's Identifying priority areas for island endemics using genetic versus specific diversity – The case of terrestrial reptiles of the Cape Verde Islands‏
670 ‎‡a Author's Intragenomic variation within ITS1 and ITS2 of freshwater crayfishes (Decapoda: Cambaridae): implications for phylogenetic and microsatellite studies.‏
670 ‎‡a Author's Invasive lizard has fewer parasites than native congener‏
670 ‎‡a Author's Inverted replication of vertebrate mitochondria.‏
670 ‎‡a Author's Isolation and characterization of nine microsatellite loci in Podarcis bocagei‏
670 ‎‡a Author's Isolation and characterization of nine microsatellite loci in Podarcis bocagei (Squamata: Lacertidae)‏
670 ‎‡a Author's Learning from others: an invasive lizard uses social information from both conspecifics and heterospecifics‏
670 ‎‡a Author's Letter to the Editors‏
670 ‎‡a Author's Lusitania revisited: a phylogeographic analysis of the natterjack toad Bufo calamita across its entire biogeographical range‏
670 ‎‡a Author's Melting pots and hotspots: genetic variation within Acanthodactylus erythrurus (Reptilia: Lacertidae) from the Iberian Peninsula‏
670 ‎‡a Author's Mitochondrial DNA Divergence Suggests That Podarcis hispanica atrata‏
670 ‎‡a Author's Mitochondrial DNA Divergence Suggests That Podarcis hispanica atrata (Squamata: Lacertidae) from the Columbretes Islands Merits Specific Distinction‏
670 ‎‡a Author's Mitochondrial Gene Rearrangements and Partial Genome Duplications Detected by Multigene Asymmetric Compositional Bias Analysis‏
670 ‎‡a Author's Mitochondrial phylogeography of the Bedriaga's rock lizard, Archaeolacerta bedriagae (Reptilia: Lacertidae) endemic to Corsica and Sardinia‏
670 ‎‡a Author's Modelling the partially unknown distribution of wall lizards (Podarcis) in North Africa: ecological affinities, potential areas of occurrence, and methodological constraints‏
670 ‎‡a Author's Molecular assessment of apicomplexan parasites in the snake Psammophis from North Africa: do multiple parasite lineages reflect the final vertebrate host diet?‏
670 ‎‡a Author's Molecular characterization of Hepatozoon species in reptiles from the Seychelles‏
670 ‎‡a Author's Molecular Detection ofHemolivia‏
670 ‎‡a Author's Molecular Detection ofHemolivia(Apicomplexa: Haemogregarinidae) from Ticks of North AfricanTestudo graeca(Testudines: Testudinidae) and an Estimation of Their Phylogenetic Relationships Using 18S rRNA Sequences‏
670 ‎‡a Author's Molecular phylogenetics of Iberian wall lizards‏
670 ‎‡a Author's Molecular phylogenetics of Iberian wall lizards (Podarcis): is Podarcis hispanica a species complex?‏
670 ‎‡a Author's Molecular phylogeny, biogeography and insights into the origin of parthenogenesis in the Neotropical genus Leposoma (Squamata: Gymnophthalmidae): Ancient links between the Atlantic Forest and Amazonia‏
670 ‎‡a Author's Molecular Screening of Haemogregarine Hemoparasites (Apicomplexa: Adeleorina: Haemogregarinidae) in Populations of Native and Introduced Pond Turtles in Eastern Europe‏
670 ‎‡a Author's Molecular screening of nematodes in lacertid lizards from the Iberian Peninsula and Balearic Islands using 18S rRNA sequences‏
670 ‎‡a Author's Molecular survey of Apicomplexa in Podarcis wall lizards detects Hepatozoon, Sarcocystis, and Eimeria species.‏
670 ‎‡a Author's Molecular survey of Hepatozoon species in lizards from North Africa‏
670 ‎‡a Author's Morphological and molecular characterization of Karyolysus--a neglected but common parasite infecting some European lizards‏
670 ‎‡a Author's Morphology and molecules reveal two new species of the poorly studied gecko genus Paragehyra‏
670 ‎‡a Author's Morphology and molecules reveal two new species of the poorly studied gecko genus Paragehyra (Squamata: Gekkonidae) from Madagascar‏
670 ‎‡a Author's Multigene phylogeny of Malagasy day geckos of the genus Phelsuma.‏
670 ‎‡a Author's Multiple dispersal out of Anatolia: biogeography and evolution of oriental green lizards‏
670 ‎‡a Author's New data on the diversity and distribution of lineages of the Acanthodactylus erythrurus species complex in North Africa derived from mitochondrial DNA markers‏
670 ‎‡a Author's New species need characters: comments on recently described apicomplexan parasites from Australia‏
670 ‎‡a Author's Non-equilibrium estimates of gene flow inferred from nuclear genealogies suggest that Iberian and North African wall lizards (Podarcis spp.) are an assemblage of incipient species‏
670 ‎‡a Author's Origin and length distribution of unidirectional prokaryotic overlapping genes‏
670 ‎‡a Author's Origins and taxonomic status of Hemidactylus geckos on the Îles Éparses of the Western Indian Ocean‏
670 ‎‡a Author's Parthenogenesis through the ice ages: A biogeographic analysis of Caucasian rock lizards (genus Darevskia).‏
670 ‎‡a Author's Patterns of genetic diversity in Hepatozoon spp. infecting snakes from North Africa and the Mediterranean Basin‏
670 ‎‡a Author's Permanent genetic resources added to Molecular Ecology Resources Database 1 December 2011-31 January 2012.‏
670 ‎‡a Author's Permanent genetic resources added to molecular ecology resources database 1 December 2012-31 January 2013.‏
670 ‎‡a Author's Persistence across Pleistocene ice ages in Mediterranean and extra-Mediterranean refugia: phylogeographic insights from the common wall lizard‏
670 ‎‡a Author's Phylogenetic affinities of Comoroan and East African day geckos (genus Phelsuma): multiple natural colonisations, introductions and island radiations‏
670 ‎‡a Author's Phylogenetic analysis of apicomplexan parasites infecting commercially valuable species from the North-East Atlantic reveals high levels of diversity and insights into the evolution of the group‏
670 ‎‡a Author's Phylogenetic analysis of the north-east Atlantic and Mediterranean species of the genus Stenosoma (Isopoda, Valvifera, Idoteidae)‏
670 ‎‡a Author's Phylogenetic relationship of Hepatozoon blood parasites found in snakes from Africa, America and Asia.‏
670 ‎‡a Author's Phylogenetic relationships of Hemidactylus geckos from the Gulf of Guinea islands: patterns of natural colonizations and anthropogenic introductions estimated from mitochondrial and nuclear DNA sequences‏
670 ‎‡a Author's Phylogenetic relationships of Trachylepis skink species from Madagascar and the Seychelles (Squamata: Scincidae).‏
670 ‎‡a Author's Phylogeny and evolution of the green lizards, Lacerta spp. (Squamata: Lacertidae) based on mitochondrial and nuclear DNA sequences‏
670 ‎‡a Author's Phylogeny of North African Agama lizards‏
670 ‎‡a Author's Phylogeny of North African Agama lizards (Reptilia: Agamidae) and the role of the Sahara desert in vertebrate speciation‏
670 ‎‡a Author's Phylogeographic evidence for multiple long-distance introductions of the common wall lizard associated with human trade and transport‏
670 ‎‡a Author's Phylogeographic patterns of Buthus scorpions‏
670 ‎‡a Author's Phylogeographic patterns of Buthus scorpions (Scorpiones: Buthidae) in the Maghreb and South-Western Europe based on CO1 mtDNA sequences‏
670 ‎‡a Author's Phylogeography and diversification history of the day-gecko genus Phelsuma in the Seychelles islands‏
670 ‎‡a Author's Phylogeography and genetic diversity of Psammophis schokari‏
670 ‎‡a Author's Phylogeography and genetic diversity of Psammophis schokari (Serpentes) in North Africa based on mitochondrial DNA sequences‏
670 ‎‡a Author's Phylogeography of Drosophila subobscura from North Atlantic islands inferred from mtDNA A+T rich region sequences.‏
670 ‎‡a Author's Phylogeography of Mabuya maculilabris‏
670 ‎‡a Author's Phylogeography of Mabuya maculilabris (Reptilia) from São Tomé Island (Gulf of Guinea) inferred from mtDNA sequences‏
670 ‎‡a Author's Phylogeography of North African Amietophrynus xeros estimated from mitochondrial DNA sequences‏
670 ‎‡a Author's Phylogeography of the lacertid lizard, Psammodromus algirus, in Iberia and across the Strait of Gibraltar‏
670 ‎‡a Author's Phylogeography of the Madeiran endemic lizard Lacerta dugesii inferred from mtDNA sequences.‏
670 ‎‡a Author's Prevalence and diversity of Hepatozoon in native and exotic geckos from Brazil.‏
670 ‎‡a Author's Rapid lizard radiation lacking niche conservatism: ecological diversification within a complex landscape‏
670 ‎‡a Author's Rapid speciation, morphological evolution, and adaptation to extreme environments in South African sand lizards (Meroles) as revealed by mitochondrial gene sequences.‏
670 ‎‡a Author's Recent evolutionary history of the Iberian endemic lizards Podarcis bocagei (Seoane, 1884) and Podarcis carbonelli Pérez-Mellado, 1981 (Squamata: Lacertidae) revealed by allozyme and microsatellite markers‏
670 ‎‡a Author's Recent oceanic long-distance dispersal and divergence in the amphi-Atlantic rain forest genus Renealmia L.f.‏
670 ‎‡a Author's Recent oceanic long-distance dispersal and divergence in the amphi-Atlantic rain forest genus Renealmia L.f. (Zingiberaceae).‏
670 ‎‡a Author's Reconstruction of the evolutionary history of Haemosporida (Apicomplexa) based on the cyt b gene with characterization of Haemocystidium in geckos (Squamata: Gekkota) from Oman.‏
670 ‎‡a Author's Reevaluation of 16S ribosomal RNA variation in Bufo‏
670 ‎‡a Author's Reevaluation of 16S ribosomal RNA variation in Bufo (Anura: Amphibia).‏
670 ‎‡a Author's Reexamination of the Iberian and North African Podarcis‏
670 ‎‡a Author's Reexamination of the Iberian and North African Podarcis (Squamata: Lacertidae) phylogeny based on increased mitochondrial DNA sequencing‏
670 ‎‡a Author's Relationships of Afroablepharus Greer, 1974 skinks from the Gulf of Guinea islands based on mitochondrial and nuclear DNA: patterns of colonization and comments on taxonomy‏
670 ‎‡a Author's Relationships of lacertid lizards‏
670 ‎‡a Author's Relationships of lacertid lizards (Reptilia: Lacertidae) estimated from mitochondrial DNA sequences and morphology.‏
670 ‎‡a Author's Relationships of scincid lizards‏
670 ‎‡a Author's Relationships of scincid lizards (Mabuya spp; Reptilia: Scincidae) from the Cape Verde islands based on mitochondrial and nuclear DNA sequences‏
670 ‎‡a Author's Review of the distribution and conservation status of the terrestrial reptiles of the Cape Verde Islands‏
670 ‎‡a Author's Rules have reasons: response to Greay et al. (2019)‏
670 ‎‡a Author's Structure and evolution of the mitochondrial DNA complete control region in the Drosophila subobscura subgroup.‏
670 ‎‡a Author's Structure and Evolution of the Mitochondrial DNA Complete Control Region in the Lizard Lacerta dugesii (Lacertidae, Sauria)‏
670 ‎‡a Author's Surfing in tortoises? Empirical signs of genetic structuring owing to range expansion‏
670 ‎‡a Author's Systematic and phylogeographical assessment of the Acanthodactylus erythrurus group‏
670 ‎‡a Author's Systematic and phylogeographical assessment of the Acanthodactylus erythrurus group (Reptilia: Lacertidae) based on phylogenetic analyses of mitochondrial and nuclear DNA.‏
670 ‎‡a Author's Systematics, biogeography and evolution of the endemicHemidactylusgeckos (Reptilia, Squamata, Gekkonidae) of the Cape Verde Islands: based on morphology and mitochondrial and nuclear DNA sequences‏
670 ‎‡a Author's The importance of integrative approaches in nematode taxonomy: the validity of Parapharyngodon and Thelandros as distinct genera‏
670 ‎‡a Author's The inversion of the Control Region in three mitogenomes provides further evidence for an asymmetric model of vertebrate mtDNA replication‏
670 ‎‡a Author's The role of hybridisation in the origin and evolutionary persistence of vertebrate parthenogens: a case study of Darevskia lizards‏
670 ‎‡a Author's The taxonomy of the Tarentola mauritanica species complex (Gekkota: Phyllodactylidae): Bayesian species delimitation supports six candidate species.‏
670 ‎‡a Author's The unexpected gecko: A new cryptic species within Urocotyledon inexpectata (Stejneger, 1893) from the northern granitic Seychelles‏
670 ‎‡a Author's Transcriptome annotation and characterization of novel toxins in six scorpion species‏
670 ‎‡a Author's Underground cryptic speciation within the Maghreb: multilocus phylogeography sheds light on the diversification of the checkerboard worm lizard Trogonophis wiegmanni‏
670 ‎‡a Author's Updated catalogue and taxonomic notes on the Old-World scorpion genus Buthus Leach, 1815 (Scorpiones, Buthidae)‏
670 ‎‡a Author's When cryptic diversity blurs the picture: a cautionary tale from Iberian and North African Podarcis wall lizards‏
670 ‎‡a Author's When selection deceives phylogeographic interpretation: the case of the Mediterranean house gecko, Hemidactylus turcicus (Linnaeus, 1758).‏
670 ‎‡a Author's Why are Red List species not on the EDGE? A response to Winter et al.‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/ISNI|0000000067985749‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/PTBNP|1321934‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NLP|a0000003159407‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/viaf/317144709‏
670 ‎‡a wikidata site links‏ ‎‡u https://species.wikipedia.org/wiki/David_James_Harris‏
909 ‎‡a (scopus) 6505966492‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000151442421‏ ‎‡9 1‏
919 ‎‡a parthenogenesisthroughtheiceagesabiogeographicanalysisofcaucasianrocklizardsgenusdarevskia‏ ‎‡A Parthenogenesis through the ice ages: A biogeographic analysis of Caucasian rock lizards (genus Darevskia).‏ ‎‡9 1‏
919 ‎‡a persistenceacrosspleistoceneiceagesinmediterraneanandextramediterraneanrefugiaphylogeographicinsightsfromthecommonwalllizard‏ ‎‡A Persistence across Pleistocene ice ages in Mediterranean and extra-Mediterranean refugia: phylogeographic insights from the common wall lizard‏ ‎‡9 1‏
919 ‎‡a originsandtaxonomicstatusofhemidactylusgeckosontheileseparsesofthewesternindianocean‏ ‎‡A Origins and taxonomic status of Hemidactylus geckos on the Îles Éparses of the Western Indian Ocean‏ ‎‡9 1‏
919 ‎‡a originandlengthdistributionofunidirectionalprokaryoticoverlappinggenes‏ ‎‡A Origin and length distribution of unidirectional prokaryotic overlapping genes‏ ‎‡9 1‏
919 ‎‡a phylogeneticaffinitiesofcomoroanandeastafricandaygeckosgenusphelsumamultiplenaturalcolonisationsintroductionsandislandradiations‏ ‎‡A Phylogenetic affinities of Comoroan and East African day geckos (genus Phelsuma): multiple natural colonisations, introductions and island radiations‏ ‎‡9 1‏
919 ‎‡a nonequilibriumestimatesofgeneflowinferredfromnucleargenealogiessuggestthatiberianandnorthafricanwalllizardspodarcissppareanassemblageofincipientspecies‏ ‎‡A Non-equilibrium estimates of gene flow inferred from nuclear genealogies suggest that Iberian and North African wall lizards (Podarcis spp.) are an assemblage of incipient species‏ ‎‡9 1‏
919 ‎‡a newspeciesneedcharacterscommentsonrecentlydescribedapicomplexanparasitesfromaustralia‏ ‎‡A New species need characters: comments on recently described apicomplexan parasites from Australia‏ ‎‡9 1‏
919 ‎‡a phylogeneticanalysisofapicomplexanparasitesinfectingcommerciallyvaluablespeciesfromthenortheastatlanticrevealshighlevelsofdiversityandinsightsintotheevolutionofthegroup‏ ‎‡A Phylogenetic analysis of apicomplexan parasites infecting commercially valuable species from the North-East Atlantic reveals high levels of diversity and insights into the evolution of the group‏ ‎‡9 1‏
919 ‎‡a newdataonthediversityanddistributionoflineagesoftheacanthodactyluserythrurusspeciescomplexinnorthafricaderivedfrommitochondrialdnamarkers‏ ‎‡A New data on the diversity and distribution of lineages of the Acanthodactylus erythrurus species complex in North Africa derived from mitochondrial DNA markers‏ ‎‡9 1‏
919 ‎‡a phylogeneticanalysisofthenortheastatlanticandmediterraneanspeciesofthegenusstenosomaisopodavalviferaidoteidae‏ ‎‡A Phylogenetic analysis of the north-east Atlantic and Mediterranean species of the genus Stenosoma (Isopoda, Valvifera, Idoteidae)‏ ‎‡9 1‏
919 ‎‡a multipledispersaloutofanatoliabiogeographyandevolutionoforientalgreenlizards‏ ‎‡A Multiple dispersal out of Anatolia: biogeography and evolution of oriental green lizards‏ ‎‡9 1‏
919 ‎‡a multigenephylogenyofmalagasydaygeckosofthegenusphelsuma‏ ‎‡A Multigene phylogeny of Malagasy day geckos of the genus Phelsuma.‏ ‎‡9 1‏
919 ‎‡a morphologyandmoleculesreveal2newspeciesofthepoorlystudiedgeckogenusparagehyrasquamatagekkonidaefrommadagascar‏ ‎‡A Morphology and molecules reveal two new species of the poorly studied gecko genus Paragehyra (Squamata: Gekkonidae) from Madagascar‏ ‎‡9 1‏
919 ‎‡a morphologyandmoleculesreveal2newspeciesofthepoorlystudiedgeckogenusparagehyra‏ ‎‡A Morphology and molecules reveal two new species of the poorly studied gecko genus Paragehyra‏ ‎‡9 1‏
919 ‎‡a morphologicalandmolecularcharacterizationofkaryolysusaneglectedbutcommonparasiteinfectingsomeeuropeanlizards‏ ‎‡A Morphological and molecular characterization of Karyolysus--a neglected but common parasite infecting some European lizards‏ ‎‡9 1‏
919 ‎‡a molecularsurveyofhepatozoonspeciesinlizardsfromnorthafrica‏ ‎‡A Molecular survey of Hepatozoon species in lizards from North Africa‏ ‎‡9 1‏
919 ‎‡a molecularsurveyofapicomplexainpodarciswalllizardsdetectshepatozoonsarcocystisandeimeriaspecies‏ ‎‡A Molecular survey of Apicomplexa in Podarcis wall lizards detects Hepatozoon, Sarcocystis, and Eimeria species.‏ ‎‡9 1‏
919 ‎‡a molecularscreeningofnematodesinlacertidlizardsfromtheiberianpeninsulaandbalearicislandsusing18srrnasequences‏ ‎‡A Molecular screening of nematodes in lacertid lizards from the Iberian Peninsula and Balearic Islands using 18S rRNA sequences‏ ‎‡9 1‏
919 ‎‡a molecularscreeningofhaemogregarinehemoparasitesapicomplexaadeleorinahaemogregarinidaeinpopulationsofnativeandintroducedpondturtlesineasterneurope‏ ‎‡A Molecular Screening of Haemogregarine Hemoparasites (Apicomplexa: Adeleorina: Haemogregarinidae) in Populations of Native and Introduced Pond Turtles in Eastern Europe‏ ‎‡9 1‏
919 ‎‡a molecularphylogenybiogeographyandinsightsintotheoriginofparthenogenesisintheneotropicalgenusleposomasquamatagymnophthalmidaeancientlinksbetweentheatlanticforestandamazonia‏ ‎‡A Molecular phylogeny, biogeography and insights into the origin of parthenogenesis in the Neotropical genus Leposoma (Squamata: Gymnophthalmidae): Ancient links between the Atlantic Forest and Amazonia‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticsofiberianwalllizardspodarcisispodarcishispanicaaspeciescomplex‏ ‎‡A Molecular phylogenetics of Iberian wall lizards (Podarcis): is Podarcis hispanica a species complex?‏ ‎‡9 1‏
919 ‎‡a molecularphylogeneticsofiberianwalllizards‏ ‎‡A Molecular phylogenetics of Iberian wall lizards‏ ‎‡9 1‏
919 ‎‡a moleculardetectionofhemoliviaapicomplexahaemogregarinidaefromticksofnorthafricantestudograecatestudinestestudinidaeandanestimationoftheirphylogeneticrelationshipsusing18srrnasequences‏ ‎‡A Molecular Detection ofHemolivia(Apicomplexa: Haemogregarinidae) from Ticks of North AfricanTestudo graeca(Testudines: Testudinidae) and an Estimation of Their Phylogenetic Relationships Using 18S rRNA Sequences‏ ‎‡9 1‏
919 ‎‡a moleculardetectionofhemolivia‏ ‎‡A Molecular Detection ofHemolivia‏ ‎‡9 1‏
919 ‎‡a molecularcharacterizationofhepatozoonspeciesinreptilesfromtheseychelles‏ ‎‡A Molecular characterization of Hepatozoon species in reptiles from the Seychelles‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipofhepatozoonbloodparasitesfoundinsnakesfromafricaamericaandasia‏ ‎‡A Phylogenetic relationship of Hepatozoon blood parasites found in snakes from Africa, America and Asia.‏ ‎‡9 1‏
919 ‎‡a molecularassessmentofapicomplexanparasitesinthesnakepsammophisfromnorthafricadomultipleparasitelineagesreflectthefinalvertebratehostdiet‏ ‎‡A Molecular assessment of apicomplexan parasites in the snake Psammophis from North Africa: do multiple parasite lineages reflect the final vertebrate host diet?‏ ‎‡9 1‏
919 ‎‡a modellingthepartiallyunknowndistributionofwalllizardspodarcisinnorthafricaecologicalaffinitiespotentialareasofoccurrenceandmethodologicalconstraints‏ ‎‡A Modelling the partially unknown distribution of wall lizards (Podarcis) in North Africa: ecological affinities, potential areas of occurrence, and methodological constraints‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipsofhemidactylusgeckosfromthegulfofguineaislandspatternsofnaturalcolonizationsandanthropogenicintroductionsestimatedfrommitochondrialandnucleardnasequences‏ ‎‡A Phylogenetic relationships of Hemidactylus geckos from the Gulf of Guinea islands: patterns of natural colonizations and anthropogenic introductions estimated from mitochondrial and nuclear DNA sequences‏ ‎‡9 1‏
919 ‎‡a phylogeneticrelationshipsoftrachylepisskinkspeciesfrommadagascarandtheseychellessquamatascincidae‏ ‎‡A Phylogenetic relationships of Trachylepis skink species from Madagascar and the Seychelles (Squamata: Scincidae).‏ ‎‡9 1‏
919 ‎‡a mitochondrialphylogeographyofthebedriagasrocklizardarchaeolacertabedriagaereptilialacertidaeendemictocorsicaandsardinia‏ ‎‡A Mitochondrial phylogeography of the Bedriaga's rock lizard, Archaeolacerta bedriagae (Reptilia: Lacertidae) endemic to Corsica and Sardinia‏ ‎‡9 1‏
919 ‎‡a mitochondrialgenerearrangementsandpartialgenomeduplicationsdetectedbymultigeneasymmetriccompositionalbiasanalysis‏ ‎‡A Mitochondrial Gene Rearrangements and Partial Genome Duplications Detected by Multigene Asymmetric Compositional Bias Analysis‏ ‎‡9 1‏
919 ‎‡a mitochondrialdnadivergencesuggeststhatpodarcishispanicaatratasquamatalacertidaefromthecolumbretesislandsmeritsspecificdistinction‏ ‎‡A Mitochondrial DNA Divergence Suggests That Podarcis hispanica atrata (Squamata: Lacertidae) from the Columbretes Islands Merits Specific Distinction‏ ‎‡9 1‏
919 ‎‡a mitochondrialdnadivergencesuggeststhatpodarcishispanicaatrata‏ ‎‡A Mitochondrial DNA Divergence Suggests That Podarcis hispanica atrata‏ ‎‡9 1‏
919 ‎‡a meltingpotsandhotspotsgeneticvariationwithinacanthodactyluserythrurusreptilialacertidaefromtheiberianpeninsula‏ ‎‡A Melting pots and hotspots: genetic variation within Acanthodactylus erythrurus (Reptilia: Lacertidae) from the Iberian Peninsula‏ ‎‡9 1‏
919 ‎‡a lusitaniarevisitedaphylogeographicanalysisofthenatterjacktoadbufocalamitaacrossitsentirebiogeographicalrange‏ ‎‡A Lusitania revisited: a phylogeographic analysis of the natterjack toad Bufo calamita across its entire biogeographical range‏ ‎‡9 1‏
919 ‎‡a lettertotheeditors‏ ‎‡A Letter to the Editors‏ ‎‡9 1‏
919 ‎‡a learningfromothersaninvasivelizardusessocialinformationfrombothconspecificsandheterospecifics‏ ‎‡A Learning from others: an invasive lizard uses social information from both conspecifics and heterospecifics‏ ‎‡9 1‏
919 ‎‡a isolationandcharacterizationof9microsatellitelociinpodarcisbocageisquamatalacertidae‏ ‎‡A Isolation and characterization of nine microsatellite loci in Podarcis bocagei (Squamata: Lacertidae)‏ ‎‡9 1‏
919 ‎‡a isolationandcharacterizationof9microsatellitelociinpodarcisbocagei‏ ‎‡A Isolation and characterization of nine microsatellite loci in Podarcis bocagei‏ ‎‡9 1‏
919 ‎‡a invertedreplicationofvertebratemitochondria‏ ‎‡A Inverted replication of vertebrate mitochondria.‏ ‎‡9 1‏
919 ‎‡a invasivelizardhasfewerparasitesthannativecongener‏ ‎‡A Invasive lizard has fewer parasites than native congener‏ ‎‡9 1‏
919 ‎‡a intragenomicvariationwithinits1andits2offreshwatercrayfishesdecapodacambaridaeimplicationsforphylogeneticandmicrosatellitestudies‏ ‎‡A Intragenomic variation within ITS1 and ITS2 of freshwater crayfishes (Decapoda: Cambaridae): implications for phylogenetic and microsatellite studies.‏ ‎‡9 1‏
919 ‎‡a identifyingpriorityareasforislandendemicsusinggeneticversusspecificdiversitythecaseofterrestrialreptilesofthecapeverdeislands‏ ‎‡A Identifying priority areas for island endemics using genetic versus specific diversity – The case of terrestrial reptiles of the Cape Verde Islands‏ ‎‡9 1‏
919 ‎‡a highlevelsofmitochondrialdnadiversitywithinoxychilidlandsnailssubgenusdrouetiagude1911fromsaomiguelislandazores‏ ‎‡A High levels of mitochondrial DNA diversity within oxychilid land snails (subgenus Drouetia Gude, 1911) from São Miguel island, Azores‏ ‎‡9 1‏
919 ‎‡a highdiversityofhepatozoonsppingeckosofthegenustarentola‏ ‎‡A High Diversity of Hepatozoon spp. in Geckos of the Genus Tarentola.‏ ‎‡9 1‏
919 ‎‡a hepatozooninfectionprevalencein4snakegenerainfluenceofdietpreyparasitemialevelsorparasitetype‏ ‎‡A Hepatozoon infection prevalence in four snake genera: influence of diet, prey parasitemia levels, or parasite type?‏ ‎‡9 1‏
919 ‎‡a haresonthiniceintrogressionofmitochondrialdnainharesanditsimplicationsforrecentphylogeneticanalyses‏ ‎‡A Hares on thin ice: Introgression of mitochondrial DNA in hares and its implications for recent phylogenetic analyses‏ ‎‡9 1‏
919 ‎‡a gettingaheadexploitativecompetitionbyaninvasivelizard‏ ‎‡A Getting ahead: exploitative competition by an invasive lizard‏ ‎‡9 1‏
919 ‎‡a geneticvariabilitywithintheoudrisfanfootedgeckoptyodactylusoudriiinnorthafricaassessedusingmitochondrialandnucleardnasequences‏ ‎‡A Genetic variability within the Oudri's fan-footed gecko Ptyodactylus oudrii in North Africa assessed using mitochondrial and nuclear DNA sequences‏ ‎‡9 1‏
919 ‎‡a geneticpolymorphismof11allozymelociinpopulationsofwalllizardspodarcisspfromtheiberianpeninsulaandnorthafrica‏ ‎‡A Genetic polymorphism of 11 allozyme loci in populations of wall lizards (Podarcis sp.) from the Iberian Peninsula and North Africa‏ ‎‡9 1‏
919 ‎‡a geneticpolymorphismof11allozymelociinpopulationsofwalllizards‏ ‎‡A Genetic polymorphism of 11 allozyme loci in populations of wall lizards‏ ‎‡9 1‏
919 ‎‡a geneticdiversitywithinscorpionsofthegenusbuthusfromtheiberianpeninsulamitochondrialdnasequencedataindicateadditionaldistinctcrypticlineages‏ ‎‡A Genetic diversity within scorpions of the genus Buthus from the Iberian Peninsula: mitochondrial DNA sequence data indicate additional distinct cryptic lineages‏ ‎‡9 1‏
919 ‎‡a geneticdiversityofhepatozoonapicomplexafromdomesticcatsinsouthafricawithaglobalreassessmentofhepatozoonfelisdiversity‏ ‎‡A Genetic diversity of Hepatozoon (Apicomplexa) from domestic cats in South Africa, with a global reassessment of Hepatozoon felis diversity‏ ‎‡9 1‏
919 ‎‡a geneticadmixturebetweentheiberianendemiclizardspodarcisbocageiandpodarciscarbonellievidenceforlimitednaturalhybridizationandabimodalhybridzone‏ ‎‡A Genetic admixture between the Iberian endemic lizardsPodarcis bocageiandPodarcis carbonelli: evidence for limited natural hybridization and a bimodal hybrid zone‏ ‎‡9 1‏
919 ‎‡a 1reportofhepatozoonapicomplexaadeleorinaincaecilianswithdescriptionofanewspecies‏ ‎‡A First report of Hepatozoon (Apicomplexa: Adeleorina) in caecilians, with description of a new species.‏ ‎‡9 1‏
919 ‎‡a extremegeneticdiversityinthelizardatlantolacertaandreanskyiwerner1929amontanecrypticspeciescomplex‏ ‎‡A Extreme genetic diversity in the lizard Atlantolacerta andreanskyi (Werner, 1929): a montane cryptic species complex‏ ‎‡9 1‏
919 ‎‡a evolutionarypatternsofthemitochondrialgenomeinthemoorishgeckotarentolamauritanica‏ ‎‡A Evolutionary patterns of the mitochondrial genome in the Moorish gecko, Tarentola mauritanica‏ ‎‡9 1‏
919 ‎‡a evolutionaryhistoryofthemaltesewalllizardpodarcisfilfolensisinsightsontheexpansioncontractionmodelofpleistocenebiogeography‏ ‎‡A Evolutionary history of the Maltese wall lizard Podarcis filfolensis: insights on the ‘Expansion–Contraction’ model of Pleistocene biogeography‏ ‎‡9 1‏
919 ‎‡a evolutionaryhistoryofthegenustarentolagekkotaphyllodactylidaefromthemediterraneanbasinestimatedusingmultilocussequencedata‏ ‎‡A Evolutionary history of the genus Tarentola (Gekkota: Phyllodactylidae) from the Mediterranean Basin, estimated using multilocus sequence data‏ ‎‡9 1‏
919 ‎‡a evolutionarydynamicsofanexpressedmhcclassiiβlocusintheranidaeanurauncoveredbygenomewalkingandhighthroughputampliconsequencing‏ ‎‡A Evolutionary dynamics of an expressed MHC class IIβ locus in the Ranidae (Anura) uncovered by genome walking and high-throughput amplicon sequencing‏ ‎‡9 1‏
919 ‎‡a evolutionaryanddemographiccorrelatesofpleistocenecoastlinechangesinthesicilianwalllizardpodarciswagleriana‏ ‎‡A Evolutionary and demographic correlates of Pleistocene coastline changes in the Sicilian wall lizard Podarcis wagleriana‏ ‎‡9 1‏
919 ‎‡a evolutionofalternativemalemorphotypesinoxyuridnematodesacaseofconvergence‏ ‎‡A Evolution of alternative male morphotypes in oxyurid nematodes: a case of convergence?‏ ‎‡9 1‏
919 ‎‡a evidenceforgeneticsimilarityof2allopatriceuropeanhareslepuscorsicanusand50castroviejoiinferredfromnucleardnasequences‏ ‎‡A Evidence for genetic similarity of two allopatric European hares (Lepus corsicanus and L. castroviejoi) inferred from nuclear DNA sequences.‏ ‎‡9 1‏
919 ‎‡a evaluatingthephylogeneticsignallimitfrommitogenomesslowevolvingnucleargenesandtheconcatenationapproachnewinsightsintothelacertiniradiationusingfastevolvingnucleargenesandspeciestrees‏ ‎‡A Evaluating the phylogenetic signal limit from mitogenomes, slow evolving nuclear genes, and the concatenation approach. New insights into the Lacertini radiation using fast evolving nuclear genes and species trees‏ ‎‡9 1‏
919 ‎‡a escapetacticsof2syntopicformsofthelacertaperspicillatacomplexwithdifferentcolourpatterns‏ ‎‡A Escape tactics of two syntopic forms of the Lacerta perspicillata complex with different colour patterns‏ ‎‡9 1‏
919 ‎‡a environmentaltemperaturesshapethermalphysiologyaswellasdiversificationandgenomewidesubstitutionratesinlizards‏ ‎‡A Environmental temperatures shape thermal physiology as well as diversification and genome-wide substitution rates in lizards‏ ‎‡9 1‏
919 ‎‡a doescontraceptiveuseleadtoincreasedaffairsaresponsetolarmuseauetal‏ ‎‡A Does Contraceptive Use Lead to Increased Affairs? A Response to Larmuseau et al‏ ‎‡9 1‏
919 ‎‡a diversityandphylogeneticrelationshipsofhemidactylusgeckosfromthecomoroislands‏ ‎‡A Diversity and phylogenetic relationships of Hemidactylus geckos from the Comoro islands‏ ‎‡9 1‏
919 ‎‡a digginguptherootsofaninsularhotspotofgeneticdiversitydecoupledmitonuclearhistoriesintheevolutionofthecorsicansardinianendemiclizardpodarcistiliguerta‏ ‎‡A Digging up the roots of an insular hotspot of genetic diversity: decoupled mito-nuclear histories in the evolution of the Corsican-Sardinian endemic lizard Podarcis tiliguerta‏ ‎‡9 1‏
919 ‎‡a deepevolutionarylineagesinawesternmediterraneansnakeviperalatasteimonticolagroupandhighgeneticstructuringinsoutherniberianpopulations‏ ‎‡A Deep evolutionary lineages in a Western Mediterranean snake (Vipera latastei/monticola group) and high genetic structuring in Southern Iberian populations‏ ‎‡9 1‏
919 ‎‡a phylogenyandevolutionofthegreenlizardslacertasppsquamatalacertidaebasedonmitochondrialandnucleardnasequences‏ ‎‡A Phylogeny and evolution of the green lizards, Lacerta spp. (Squamata: Lacertidae) based on mitochondrial and nuclear DNA sequences‏ ‎‡9 1‏
919 ‎‡a phylogenyofnorthafricanagamalizards‏ ‎‡A Phylogeny of North African Agama lizards‏ ‎‡9 1‏
919 ‎‡a phylogenyofnorthafricanagamalizardsreptiliaagamidaeandtheroleofthesaharadesertinvertebratespeciation‏ ‎‡A Phylogeny of North African Agama lizards (Reptilia: Agamidae) and the role of the Sahara desert in vertebrate speciation‏ ‎‡9 1‏
919 ‎‡a phylogeographicevidenceformultiplelongdistanceintroductionsofthecommonwalllizardassociatedwithhumantradeandtransport‏ ‎‡A Phylogeographic evidence for multiple long-distance introductions of the common wall lizard associated with human trade and transport‏ ‎‡9 1‏
919 ‎‡a phylogeographicpatternsofbuthusscorpions‏ ‎‡A Phylogeographic patterns of Buthus scorpions‏ ‎‡9 1‏
919 ‎‡a phylogeographicpatternsofbuthusscorpionsscorpionesbuthidaeinthemaghrebandsouthwesterneuropebasedonco1mtdnasequences‏ ‎‡A Phylogeographic patterns of Buthus scorpions (Scorpiones: Buthidae) in the Maghreb and South-Western Europe based on CO1 mtDNA sequences‏ ‎‡9 1‏
919 ‎‡a phylogeographyanddiversificationhistoryofthedaygeckogenusphelsumaintheseychellesislands‏ ‎‡A Phylogeography and diversification history of the day-gecko genus Phelsuma in the Seychelles islands‏ ‎‡9 1‏
919 ‎‡a phylogeographyandgeneticdiversityofpsammophisschokari‏ ‎‡A Phylogeography and genetic diversity of Psammophis schokari‏ ‎‡9 1‏
919 ‎‡a phylogeographyandgeneticdiversityofpsammophisschokariserpentesinnorthafricabasedonmitochondrialdnasequences‏ ‎‡A Phylogeography and genetic diversity of Psammophis schokari (Serpentes) in North Africa based on mitochondrial DNA sequences‏ ‎‡9 1‏
919 ‎‡a phylogeographyofdrosophilasubobscurafromnorthatlanticislandsinferredfrommtdnaa+trichregionsequences‏ ‎‡A Phylogeography of Drosophila subobscura from North Atlantic islands inferred from mtDNA A+T rich region sequences.‏ ‎‡9 1‏
919 ‎‡a deepevolutionarylineagesinawesternmediterraneansnake‏ ‎‡A Deep evolutionary lineages in a Western Mediterranean snake‏ ‎‡9 1‏
919 ‎‡a decipheringpatternsoftransoceanicdispersaltheevolutionaryoriginandbiogeographyofcoastallizardscryptoblepharusinthewesternindianoceanregion‏ ‎‡A Deciphering patterns of transoceanic dispersal: the evolutionary origin and biogeography of coastal lizards (Cryptoblepharus) in the Western Indian Ocean region‏ ‎‡9 1‏
919 ‎‡a decipheringpatternsoftransoceanicdispersaltheevolutionaryoriginandbiogeographyofcoastallizards‏ ‎‡A Deciphering patterns of transoceanic dispersal: the evolutionary origin and biogeography of coastal lizards‏ ‎‡9 1‏
919 ‎‡a cyanobacterialhydrogenasesdiversityregulationandapplications‏ ‎‡A Cyanobacterial hydrogenases: diversity, regulation and applications‏ ‎‡9 1‏
919 ‎‡a crypticspeciesunveiledthecaseofthenematodespauligodonatlanticus‏ ‎‡A Cryptic species unveiled: the case of the nematodeSpauligodon atlanticus‏ ‎‡9 1‏
919 ‎‡a crypticspeciationpatternsiniranianrocklizardsuncoveredbyintegrativetaxonomy‏ ‎‡A Cryptic speciation patterns in Iranian rock lizards uncovered by integrative taxonomy‏ ‎‡9 1‏
919 ‎‡a crypticdiversitywithintheendemicprehensiletailedgeckourocotyledoninexpectataacrosstheseychellesislandspatternsofphylogeographicalstructureandisolationatthemultilocuslevel‏ ‎‡A Cryptic diversity within the endemic prehensile-tailed geckoUrocotyledon inexpectataacross the Seychelles Islands: patterns of phylogeographical structure and isolation at the multilocus level‏ ‎‡9 1‏
919 ‎‡a correctiontotheroleofhybridisationintheoriginandevolutionarypersistenceofvertebrateparthenogensacasestudyofdarevskializards‏ ‎‡A Correction to: The role of hybridisation in the origin and evolutionary persistence of vertebrate parthenogens: a case study of Darevskia lizards‏ ‎‡9 1‏
919 ‎‡a conservationstatusoftheworldsskinksscincidaetaxonomicandgeographicpatternsinextinctionrisk‏ ‎‡A Conservation status of the world's skinks (Scincidae): Taxonomic and geographic patterns in extinction risk‏ ‎‡9 1‏
919 ‎‡a conflictingpatternsofnucleotidediversitybetweenmtdnaandndnainthemoorishgeckotarentolamauritanica‏ ‎‡A Conflicting patterns of nucleotide diversity between mtDNA and nDNA in the Moorish gecko, Tarentola mauritanica.‏ ‎‡9 1‏
919 ‎‡a complexestimatesofevolutionaryrelationshipsintarentolamauritanicareptiliagekkonidaederivedfrommitochondrialdnasequences‏ ‎‡A Complex estimates of evolutionary relationships in Tarentola mauritanica (Reptilia: Gekkonidae) derived from mitochondrial DNA sequences‏ ‎‡9 1‏
919 ‎‡a phylogeographyofmabuyamaculilabris‏ ‎‡A Phylogeography of Mabuya maculilabris‏ ‎‡9 1‏
919 ‎‡a complexestimatesofevolutionaryrelationshipsintarentolamauritanica‏ ‎‡A Complex estimates of evolutionary relationships in Tarentola mauritanica‏ ‎‡9 1‏
919 ‎‡a phylogeographyofmabuyamaculilabrisreptiliafromsaotomeislandgulfofguineainferredfrommtdnasequences‏ ‎‡A Phylogeography of Mabuya maculilabris (Reptilia) from São Tomé Island (Gulf of Guinea) inferred from mtDNA sequences‏ ‎‡9 1‏
919 ‎‡a complexbiogeographicaldistributionofgeneticvariationwithinpodarciswalllizardsacrossthestraitofgibraltar‏ ‎‡A Complex biogeographical distribution of genetic variation within Podarcis wall lizards across the Strait of Gibraltar‏ ‎‡9 1‏
919 ‎‡a phylogeographyofnorthafricanamietophrynusxerosestimatedfrommitochondrialdnasequences‏ ‎‡A Phylogeography of North African Amietophrynus xeros estimated from mitochondrial DNA sequences‏ ‎‡9 1‏
919 ‎‡a comparingpatternsofnuclearandmitochondrialdivergenceinacrypticspeciescomplexthecaseofiberianandnorthafricanwalllizardspodarcislacertidae‏ ‎‡A Comparing patterns of nuclear and mitochondrial divergence in a cryptic species complex: the case of Iberian and North African wall lizards (Podarcis, Lacertidae)‏ ‎‡9 1‏
919 ‎‡a phylogeographyofthelacertidlizardpsammodromusalgirusiniberiaandacrossthestraitofgibraltar‏ ‎‡A Phylogeography of the lacertid lizard, Psammodromus algirus, in Iberia and across the Strait of Gibraltar‏ ‎‡9 1‏
919 ‎‡a comparativephylogeographyofnorthwestafricannatrixmauraserpentescolubridaeinferredfrommtdnasequences‏ ‎‡A Comparative phylogeography of northwest African Natrix maura (Serpentes: Colubridae) inferred from mtDNA sequences‏ ‎‡9 1‏
919 ‎‡a phylogeographyofthemadeiranendemiclizardlacertadugesiiinferredfrommtdnasequences‏ ‎‡A Phylogeography of the Madeiran endemic lizard Lacerta dugesii inferred from mtDNA sequences.‏ ‎‡9 1‏
919 ‎‡a comparativephylogeographyofnorthwestafricannatrixmaura‏ ‎‡A Comparative phylogeography of northwest African Natrix maura‏ ‎‡9 1‏
919 ‎‡a prevalenceanddiversityofhepatozooninnativeandexoticgeckosfrombrazil‏ ‎‡A Prevalence and diversity of Hepatozoon in native and exotic geckos from Brazil.‏ ‎‡9 1‏
919 ‎‡a commentsonthesystematicrevisionofadeleidhaemogregarinesaremoredataneeded‏ ‎‡A Comments on the Systematic Revision of Adeleid Haemogregarines: Are More Data Needed?‏ ‎‡9 1‏
919 ‎‡a rapidlizardradiationlackingnicheconservatismecologicaldiversificationwithinacomplexlandscape‏ ‎‡A Rapid lizard radiation lacking niche conservatism: ecological diversification within a complex landscape‏ ‎‡9 1‏
919 ‎‡a rapidspeciationmorphologicalevolutionandadaptationtoextremeenvironmentsinsouthafricansandlizardsmerolesasrevealedbymitochondrialgenesequences‏ ‎‡A Rapid speciation, morphological evolution, and adaptation to extreme environments in South African sand lizards (Meroles) as revealed by mitochondrial gene sequences.‏ ‎‡9 1‏
919 ‎‡a recentevolutionaryhistoryoftheiberianendemiclizardspodarcisbocageiseoane1884andpodarciscarbonelliperezmellado1981squamatalacertidaerevealedbyallozymeandmicrosatellitemarkers‏ ‎‡A Recent evolutionary history of the Iberian endemic lizards Podarcis bocagei (Seoane, 1884) and Podarcis carbonelli Pérez-Mellado, 1981 (Squamata: Lacertidae) revealed by allozyme and microsatellite markers‏ ‎‡9 1‏
919 ‎‡a recentoceaniclongdistancedispersalanddivergenceintheamphiatlanticrainforestgenusrenealmia50f‏ ‎‡A Recent oceanic long-distance dispersal and divergence in the amphi-Atlantic rain forest genus Renealmia L.f.‏ ‎‡9 1‏
919 ‎‡a codonbiasvariationin100mosbetweensquamatefamiliesmightdistortphylogeneticinferences‏ ‎‡A Codon bias variation in C-mos between squamate families might distort phylogenetic inferences‏ ‎‡9 1‏
919 ‎‡a bloodparasitediversityapicomplexahaemogregarinidaewithinthewesternpopulationsoftheeuropeanpondturtleemysorbicularis‏ ‎‡A Blood parasite diversity (Apicomplexa: Haemogregarinidae) within the western populations of the European pond turtle Emys orbicularis‏ ‎‡9 1‏
919 ‎‡a biogeographicalcrossroadacrossthepillarsofherculesevolutionaryhistoryofpsammodromuslizardsinspaceandtime‏ ‎‡A Biogeographical crossroad across the Pillars of Hercules: Evolutionary history of Psammodromus lizards in space and time‏ ‎‡9 1‏
919 ‎‡a biogeographicanddemographichistoryofthemediterraneansnakesmalpolonmonspessulanusandhemorrhoishippocrepisacrossthestraitofgibraltar‏ ‎‡A Biogeographic and demographic history of the Mediterranean snakes Malpolon monspessulanus and Hemorrhois hippocrepis across the Strait of Gibraltar‏ ‎‡9 1‏
919 ‎‡a beneaththehairylookthehiddenreproductivediversityofthegibsmithiahawaiiensiscomplexdumontiaceaerhodophyta‏ ‎‡A Beneath the hairy look: the hidden reproductive diversity of the Gibsmithia hawaiiensis complex (Dumontiaceae, Rhodophyta).‏ ‎‡9 1‏
919 ‎‡a assessingthephylogeneticsignalofthenuclearβfibrinogenintron7insalamandridsamphibiasalamandridae‏ ‎‡A Assessing the phylogenetic signal of the nuclear β-Fibrinogen intron 7 in salamandrids (Amphibia: Salamandridae)‏ ‎‡9 1‏
919 ‎‡a assessingthephylogeneticsignalofthenuclearβfibrinogenintron7insalamandrids‏ ‎‡A Assessing the phylogenetic signal of the nuclear β-Fibrinogen intron 7 in salamandrids‏ ‎‡9 1‏
919 ‎‡a assessingtheinfluenceofgeographicdistanceinparasitecommunitiesofanexoticlizard‏ ‎‡A Assessing the influence of geographic distance in parasite communities of an exotic lizard.‏ ‎‡9 1‏
919 ‎‡a assessingthediversityhostspecificityandinfectionpatternsofapicomplexanparasitesinreptilesfromomanarabia‏ ‎‡A Assessing the diversity, host-specificity and infection patterns of apicomplexan parasites in reptiles from Oman, Arabia.‏ ‎‡9 1‏
919 ‎‡a apicomplexaprimersamplifyproteromonasstramenopilesslopalinidaproteromonadidaeintissueandbloodsamplesfromlizards‏ ‎‡A Apicomplexa primers amplify Proteromonas (Stramenopiles, Slopalinida, Proteromonadidae) in tissue and blood samples from lizards.‏ ‎‡9 1‏
919 ‎‡a ancientintrogressionoflepustimidusmtdnainto50granatensisand50europaeusintheiberianpeninsula‏ ‎‡A Ancient introgression of Lepus timidus mtDNA into L. granatensis and L. europaeus in the Iberian Peninsula‏ ‎‡9 1‏
919 ‎‡a integrativetaxonomicrevisionofthetarentolageckossquamataphyllodactylidaeofthecapeverdeislands‏ ‎‡A An integrative taxonomic revision of the Tarentola geckos (Squamata, Phyllodactylidae) of the Cape Verde Islands‏ ‎‡9 1‏
919 ‎‡a alongfortherideormissingitaltogetherexploringthehostspecificityanddiversityofhaemogregarinesinthecanaryislands‏ ‎‡A Along for the ride or missing it altogether: exploring the host specificity and diversity of haemogregarines in the Canary Islands.‏ ‎‡9 1‏
919 ‎‡a phylogeneticassessmentofthecolonisationpatternsinspauligodonatlanticusastasioarbizaetal1987nematodaoxyuridapharyngodonidaeaparasiteoflizardsofthegenusgallotiaboulengernosimpleanswers‏ ‎‡A A phylogenetic assessment of the colonisation patterns in Spauligodon atlanticus Astasio-Arbiza et al., 1987 (Nematoda: Oxyurida: Pharyngodonidae), a parasite of lizards of the genus Gallotia Boulenger: no simple answers‏ ‎‡9 1‏
919 ‎‡a paradiseforparasites7newhaemogregarinespeciesinfectinglizardsfromthecanaryislands‏ ‎‡A A paradise for parasites? Seven new haemogregarine species infecting lizards from the Canary Islands‏ ‎‡9 1‏
919 ‎‡a newspeciesofspauligodonnematodaoxyuridapharyngodonidaeingeckosfromsaonicolauislandcapeverdeanditsphylogeneticassessment‏ ‎‡A A new species of Spauligodon (Nematoda: Oxyurida: Pharyngodonidae) in geckos from São Nicolau Island (Cape Verde) and its phylogenetic assessment‏ ‎‡9 1‏
919 ‎‡a newspeciesofspauligodon‏ ‎‡A A new species of Spauligodon‏ ‎‡9 1‏
919 ‎‡a newspeciesofhepatozoonmiller1908apicomplexaadelerinafromthesnakephilodryasnattereristeindachnersquamatadipsadidaeinnortheasternbrazil‏ ‎‡A A new species of Hepatozoon Miller, 1908 (Apicomplexa: Adelerina) from the snake Philodryas nattereri Steindachner (Squamata: Dipsadidae) in northeastern Brazil‏ ‎‡9 1‏
919 ‎‡a recentoceaniclongdistancedispersalanddivergenceintheamphiatlanticrainforestgenusrenealmia50fzingiberaceae‏ ‎‡A Recent oceanic long-distance dispersal and divergence in the amphi-Atlantic rain forest genus Renealmia L.f. (Zingiberaceae).‏ ‎‡9 1‏
919 ‎‡a reconstructionoftheevolutionaryhistoryofhaemosporidaapicomplexabasedonthecytbgenewithcharacterizationofhaemocystidiumingeckossquamatagekkotafromoman‏ ‎‡A Reconstruction of the evolutionary history of Haemosporida (Apicomplexa) based on the cyt b gene with characterization of Haemocystidium in geckos (Squamata: Gekkota) from Oman.‏ ‎‡9 1‏
919 ‎‡a reevaluationof16sribosomalrnavariationinbufo‏ ‎‡A Reevaluation of 16S ribosomal RNA variation in Bufo‏ ‎‡9 1‏
919 ‎‡a reevaluationof16sribosomalrnavariationinbufoanuraamphibia‏ ‎‡A Reevaluation of 16S ribosomal RNA variation in Bufo (Anura: Amphibia).‏ ‎‡9 1‏
919 ‎‡a reexaminationoftheiberianandnorthafricanpodarcis‏ ‎‡A Reexamination of the Iberian and North African Podarcis‏ ‎‡9 1‏
919 ‎‡a reexaminationoftheiberianandnorthafricanpodarcissquamatalacertidaephylogenybasedonincreasedmitochondrialdnasequencing‏ ‎‡A Reexamination of the Iberian and North African Podarcis (Squamata: Lacertidae) phylogeny based on increased mitochondrial DNA sequencing‏ ‎‡9 1‏
919 ‎‡a relationshipsofafroablepharusgreer1974skinksfromthegulfofguineaislandsbasedonmitochondrialandnucleardnapatternsofcolonizationandcommentsontaxonomy‏ ‎‡A Relationships of Afroablepharus Greer, 1974 skinks from the Gulf of Guinea islands based on mitochondrial and nuclear DNA: patterns of colonization and comments on taxonomy‏ ‎‡9 1‏
919 ‎‡a relationshipsoflacertidlizards‏ ‎‡A Relationships of lacertid lizards‏ ‎‡9 1‏
919 ‎‡a relationshipsoflacertidlizardsreptilialacertidaeestimatedfrommitochondrialdnasequencesandmorphology‏ ‎‡A Relationships of lacertid lizards (Reptilia: Lacertidae) estimated from mitochondrial DNA sequences and morphology.‏ ‎‡9 1‏
919 ‎‡a relationshipsofscincidlizards‏ ‎‡A Relationships of scincid lizards‏ ‎‡9 1‏
919 ‎‡a relationshipsofscincidlizardsmabuyasppreptiliascincidaefromthecapeverdeislandsbasedonmitochondrialandnucleardnasequences‏ ‎‡A Relationships of scincid lizards (Mabuya spp; Reptilia: Scincidae) from the Cape Verde islands based on mitochondrial and nuclear DNA sequences‏ ‎‡9 1‏
919 ‎‡a reviewofthedistributionandconservationstatusoftheterrestrialreptilesofthecapeverdeislands‏ ‎‡A Review of the distribution and conservation status of the terrestrial reptiles of the Cape Verde Islands‏ ‎‡9 1‏
919 ‎‡a ruleshavereasonsresponsetogreayetal‏ ‎‡A Rules have reasons: response to Greay et al. (2019)‏ ‎‡9 1‏
919 ‎‡a structureandevolutionofthemitochondrialdnacompletecontrolregioninthedrosophilasubobscurasubgroup‏ ‎‡A Structure and evolution of the mitochondrial DNA complete control region in the Drosophila subobscura subgroup.‏ ‎‡9 1‏
919 ‎‡a structureandevolutionofthemitochondrialdnacompletecontrolregioninthelizardlacertadugesiilacertidaesauria‏ ‎‡A Structure and Evolution of the Mitochondrial DNA Complete Control Region in the Lizard Lacerta dugesii (Lacertidae, Sauria)‏ ‎‡9 1‏
919 ‎‡a surfingintortoisesempiricalsignsofgeneticstructuringowingtorangeexpansion‏ ‎‡A Surfing in tortoises? Empirical signs of genetic structuring owing to range expansion‏ ‎‡9 1‏
919 ‎‡a systematicandphylogeographicalassessmentoftheacanthodactyluserythrurusgroup‏ ‎‡A Systematic and phylogeographical assessment of the Acanthodactylus erythrurus group‏ ‎‡9 1‏
919 ‎‡a systematicandphylogeographicalassessmentoftheacanthodactyluserythrurusgroupreptilialacertidaebasedonphylogeneticanalysesofmitochondrialandnucleardna‏ ‎‡A Systematic and phylogeographical assessment of the Acanthodactylus erythrurus group (Reptilia: Lacertidae) based on phylogenetic analyses of mitochondrial and nuclear DNA.‏ ‎‡9 1‏
919 ‎‡a systematicsbiogeographyandevolutionoftheendemichemidactylusgeckosreptiliasquamatagekkonidaeofthecapeverdeislandsbasedonmorphologyandmitochondrialandnucleardnasequences‏ ‎‡A Systematics, biogeography and evolution of the endemicHemidactylusgeckos (Reptilia, Squamata, Gekkonidae) of the Cape Verde Islands: based on morphology and mitochondrial and nuclear DNA sequences‏ ‎‡9 1‏
919 ‎‡a importanceofintegrativeapproachesinnematodetaxonomythevalidityofparapharyngodonandthelandrosasdistinctgenera‏ ‎‡A The importance of integrative approaches in nematode taxonomy: the validity of Parapharyngodon and Thelandros as distinct genera‏ ‎‡9 1‏
919 ‎‡a inversionofthecontrolregionin3mitogenomesprovidesfurtherevidenceforanasymmetricmodelofvertebratemtdnareplication‏ ‎‡A The inversion of the Control Region in three mitogenomes provides further evidence for an asymmetric model of vertebrate mtDNA replication‏ ‎‡9 1‏
919 ‎‡a roleofhybridisationintheoriginandevolutionarypersistenceofvertebrateparthenogensacasestudyofdarevskializards‏ ‎‡A The role of hybridisation in the origin and evolutionary persistence of vertebrate parthenogens: a case study of Darevskia lizards‏ ‎‡9 1‏
919 ‎‡a taxonomyofthetarentolamauritanicaspeciescomplexgekkotaphyllodactylidaebayesianspeciesdelimitationsupports6candidatespecies‏ ‎‡A The taxonomy of the Tarentola mauritanica species complex (Gekkota: Phyllodactylidae): Bayesian species delimitation supports six candidate species.‏ ‎‡9 1‏
919 ‎‡a unexpectedgeckoanewcrypticspecieswithinurocotyledoninexpectatastejneger1893fromthenortherngraniticseychelles‏ ‎‡A The unexpected gecko: A new cryptic species within Urocotyledon inexpectata (Stejneger, 1893) from the northern granitic Seychelles‏ ‎‡9 1‏
919 ‎‡a transcriptomeannotationandcharacterizationofnoveltoxinsin6scorpionspecies‏ ‎‡A Transcriptome annotation and characterization of novel toxins in six scorpion species‏ ‎‡9 1‏
919 ‎‡a undergroundcrypticspeciationwithinthemaghrebmultilocusphylogeographyshedslightonthediversificationofthecheckerboardwormlizardtrogonophiswiegmanni‏ ‎‡A Underground cryptic speciation within the Maghreb: multilocus phylogeography sheds light on the diversification of the checkerboard worm lizard Trogonophis wiegmanni‏ ‎‡9 1‏
919 ‎‡a updatedcatalogueandtaxonomicnotesontheoldworldscorpiongenusbuthusleach1815scorpionesbuthidae‏ ‎‡A Updated catalogue and taxonomic notes on the Old-World scorpion genus Buthus Leach, 1815 (Scorpiones, Buthidae)‏ ‎‡9 1‏
919 ‎‡a whencrypticdiversityblursthepictureacautionarytalefromiberianandnorthafricanpodarciswalllizards‏ ‎‡A When cryptic diversity blurs the picture: a cautionary tale from Iberian and North African Podarcis wall lizards‏ ‎‡9 1‏
919 ‎‡a whenselectiondeceivesphylogeographicinterpretationthecaseofthemediterraneanhousegeckohemidactylusturcicuslinnaeus‏ ‎‡A When selection deceives phylogeographic interpretation: the case of the Mediterranean house gecko, Hemidactylus turcicus (Linnaeus, 1758).‏ ‎‡9 1‏
919 ‎‡a whyareredlistspeciesnotontheedgearesponsetowinteretal‏ ‎‡A Why are Red List species not on the EDGE? A response to Winter et al.‏ ‎‡9 1‏
919 ‎‡a permanentgeneticresourcesaddedtomolecularecologyresourcesdatabase1december201131january‏ ‎‡A Permanent genetic resources added to Molecular Ecology Resources Database 1 December 2011-31 January 2012.‏ ‎‡9 1‏
919 ‎‡a permanentgeneticresourcesaddedtomolecularecologyresourcesdatabase1december201231january‏ ‎‡A Permanent genetic resources added to molecular ecology resources database 1 December 2012-31 January 2013.‏ ‎‡9 1‏
919 ‎‡a patternsofgeneticdiversityinhepatozoonsppinfectingsnakesfromnorthafricaandthemediterraneanbasin‏ ‎‡A Patterns of genetic diversity in Hepatozoon spp. infecting snakes from North Africa and the Mediterranean Basin‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2013‏ ‎‡9 3‏
943 ‎‡a 175x‏ ‎‡A 1758‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
947 ‎‡a PT‏ ‎‡9 1‏
996 ‎‡2 NII|DA03171666‏
996 ‎‡2 DNB|1139127489‏
996 ‎‡2 LC|n 2012048142‏
996 ‎‡2 NII|DA06359564‏
996 ‎‡2 LC|no2003016641‏
996 ‎‡2 LC|n 86820871‏
996 ‎‡2 CAOONL|ncf10452500‏
996 ‎‡2 LNB|LNC10-000172421‏
996 ‎‡2 DNB|1139137581‏
996 ‎‡2 SUDOC|190626089‏
996 ‎‡2 LC|no2015150406‏
996 ‎‡2 J9U|987007455126505171‏
996 ‎‡2 BNF|16673060‏
996 ‎‡2 NUKAT|nx2022613716‏
996 ‎‡2 LC|n 93033297‏
996 ‎‡2 LC|nb2022001818‏
996 ‎‡2 ISNI|0000000110814866‏
996 ‎‡2 LC|no 00042482‏
996 ‎‡2 CAOONL|ncf10186772‏
996 ‎‡2 LC|n 2003008933‏
996 ‎‡2 BIBSYS|90139848‏
996 ‎‡2 ISNI|0000000439853123‏
996 ‎‡2 LC|n 50026660‏
996 ‎‡2 DNB|1092213937‏
996 ‎‡2 ISNI|0000000076822765‏
996 ‎‡2 ISNI|0000000121180045‏
996 ‎‡2 BNF|12507164‏
996 ‎‡2 DNB|138959641‏
996 ‎‡2 NTA|091690684‏
996 ‎‡2 SUDOC|05863682X‏
996 ‎‡2 LC|no2024076042‏
996 ‎‡2 SIMACOB|127250531‏
996 ‎‡2 LC|nb 99014643‏
996 ‎‡2 PLWABN|9810808935905606‏
996 ‎‡2 BIBSYS|1691037120428‏
996 ‎‡2 J9U|987007429631405171‏
996 ‎‡2 BNE|XX1719100‏
996 ‎‡2 BNF|17036894‏
996 ‎‡2 CAOONL|ncf10122299‏
996 ‎‡2 DNB|136705723‏
996 ‎‡2 LC|n 88252284‏
996 ‎‡2 LC|n 77005751‏
996 ‎‡2 ISNI|0000000051890753‏
996 ‎‡2 NTA|242202683‏
996 ‎‡2 ISNI|0000000384284102‏
996 ‎‡2 BNE|XX4701924‏
996 ‎‡2 N6I|vtls002396564‏
996 ‎‡2 DNB|17421815X‏
996 ‎‡2 BNF|12681029‏
996 ‎‡2 LC|nb2011018373‏
996 ‎‡2 J9U|987010648614905171‏
996 ‎‡2 CAOONL|ncf10366876‏
996 ‎‡2 LIH|LNB:_h_D_n_;=B_q_‏
996 ‎‡2 DNB|1139127004‏
996 ‎‡2 PLWABN|9810588688905606‏
996 ‎‡2 J9U|987007601824505171‏
996 ‎‡2 DNB|1101965266‏
996 ‎‡2 ISNI|0000000396589261‏
996 ‎‡2 LC|nb2012020868‏
996 ‎‡2 NTA|069655553‏
996 ‎‡2 DNB|1044621451‏
996 ‎‡2 LC|no2007079499‏
996 ‎‡2 NTA|068246773‏
996 ‎‡2 LC|n 2021020372‏
996 ‎‡2 LC|n 2007052062‏
996 ‎‡2 LC|nb 99012769‏
996 ‎‡2 CAOONL|ncf10992649‏
996 ‎‡2 LC|n 2007052068‏
996 ‎‡2 BIBSYS|90605454‏
996 ‎‡2 LC|n 2007052117‏
996 ‎‡2 NTA|131234587‏
996 ‎‡2 SUDOC|264429370‏
996 ‎‡2 SUDOC|159769833‏
996 ‎‡2 SUDOC|129604925‏
996 ‎‡2 ISNI|0000000385981735‏
996 ‎‡2 SUDOC|160357101‏
996 ‎‡2 LC|no 00048176‏
996 ‎‡2 BNF|14638730‏
996 ‎‡2 RERO|A006305372‏
996 ‎‡2 NUKAT|n 2013144778‏
996 ‎‡2 LC|n 2001085178‏
996 ‎‡2 SUDOC|276928601‏
996 ‎‡2 BLBNB|000317787‏
996 ‎‡2 N6I|vtls001301250‏
996 ‎‡2 DNB|1304951049‏
996 ‎‡2 BIBSYS|90912971‏
996 ‎‡2 J9U|987007345936105171‏
996 ‎‡2 NII|DA07863650‏
996 ‎‡2 SUDOC|257508309‏
996 ‎‡2 BIBSYS|90174454‏
996 ‎‡2 BIBSYS|4053484‏
996 ‎‡2 DNB|172940869‏
996 ‎‡2 NLA|000035174365‏
996 ‎‡2 LC|no2002104288‏
996 ‎‡2 ISNI|000000011576997X‏
996 ‎‡2 NTA|394296265‏
996 ‎‡2 LC|no2024044419‏
996 ‎‡2 LC|no2013022830‏
996 ‎‡2 LC|n 2001089423‏
996 ‎‡2 J9U|987007444868405171‏
996 ‎‡2 DNB|1062095928‏
996 ‎‡2 DNB|131722808‏
996 ‎‡2 RERO|A003349202‏
996 ‎‡2 RERO|A003349203‏
996 ‎‡2 RERO|A003349205‏
996 ‎‡2 ISNI|0000000025284274‏
996 ‎‡2 BNF|15051865‏
996 ‎‡2 ISNI|0000000410142299‏
996 ‎‡2 DNB|1044619589‏
996 ‎‡2 DNB|1283377721‏
996 ‎‡2 SUDOC|098313045‏
996 ‎‡2 NSK|000670130‏
996 ‎‡2 LIH|LNB:B_b_P_n_;=B_y_‏
996 ‎‡2 LC|n 2006070730‏
996 ‎‡2 CAOONL|ncf10255947‏
996 ‎‡2 DNB|1196642109‏
996 ‎‡2 J9U|987007262191505171‏
996 ‎‡2 ISNI|000000010238152X‏
996 ‎‡2 LC|nb2008008320‏
996 ‎‡2 ISNI|0000000110789066‏
996 ‎‡2 J9U|987007321106805171‏
996 ‎‡2 LC|nb2011031715‏
996 ‎‡2 LC|n 2001001493‏
996 ‎‡2 NUKAT|n 96500767‏
996 ‎‡2 SUDOC|230381545‏
996 ‎‡2 SUDOC|17741653X‏
996 ‎‡2 SUDOC|276634837‏
996 ‎‡2 NTA|082530114‏
996 ‎‡2 NII|DA04594450‏
996 ‎‡2 LC|no2019056645‏
996 ‎‡2 ISNI|0000000380244066‏
996 ‎‡2 J9U|987012995076405171‏
996 ‎‡2 SUDOC|133456404‏
996 ‎‡2 SELIBR|212890‏
996 ‎‡2 NUKAT|n 2020066700‏
996 ‎‡2 ISNI|0000000039860797‏
996 ‎‡2 LC|n 85811790‏
996 ‎‡2 LC|n 88058647‏
996 ‎‡2 LC|no2024107702‏
996 ‎‡2 J9U|987007367058005171‏
996 ‎‡2 LC|n 81046247‏
996 ‎‡2 DNB|1044620552‏
996 ‎‡2 BIBSYS|4053509‏
996 ‎‡2 BIBSYS|4053506‏
996 ‎‡2 DNB|1139135562‏
996 ‎‡2 NUKAT|nx2023122839‏
996 ‎‡2 DNB|1128445573‏
996 ‎‡2 ISNI|0000000044037690‏
996 ‎‡2 NUKAT|n 2006088209‏
996 ‎‡2 LC|no2018109597‏
996 ‎‡2 LC|no2002007828‏
996 ‎‡2 LC|nb2010020392‏
996 ‎‡2 ISNI|0000000039037602‏
996 ‎‡2 ISNI|0000000082151398‏
996 ‎‡2 ISNI|0000000053682472‏
996 ‎‡2 LC|n 99054197‏
996 ‎‡2 LC|no2009071738‏
996 ‎‡2 LC|no 94030925‏
996 ‎‡2 NDL|00542031‏
996 ‎‡2 BNF|12383188‏
996 ‎‡2 CAOONL|ncf11231065‏
996 ‎‡2 NII|DA02669581‏
996 ‎‡2 SUDOC|160534321‏
996 ‎‡2 ISNI|0000000114909424‏
996 ‎‡2 LC|n 2010063560‏
996 ‎‡2 DNB|1050542355‏
996 ‎‡2 BNC|981058525807106706‏
996 ‎‡2 CAOONL|ncf11668518‏
996 ‎‡2 NLA|000035925050‏
996 ‎‡2 LIH|LNB:CHNK;=BA‏
996 ‎‡2 LC|no2011035324‏
996 ‎‡2 J9U|987012722479005171‏
996 ‎‡2 DNB|1055638695‏
996 ‎‡2 LC|n 2014070351‏
996 ‎‡2 NUKAT|n 97039082‏
996 ‎‡2 LC|n 85092136‏
996 ‎‡2 ISNI|0000000031735350‏
996 ‎‡2 LC|n 88125918‏
996 ‎‡2 LC|no2001058676‏
996 ‎‡2 ISNI|0000000109602698‏
996 ‎‡2 ISNI|0000000083234507‏
996 ‎‡2 DNB|1165354608‏
996 ‎‡2 ISNI|0000000117010377‏
996 ‎‡2 ISNI|0000000040325134‏
996 ‎‡2 NUKAT|n 2009050497‏
996 ‎‡2 J9U|987007439591405171‏
996 ‎‡2 LC|n 2009070245‏
996 ‎‡2 CAOONL|ncf10367309‏
996 ‎‡2 SUDOC|111945003‏
996 ‎‡2 LC|nb2008003532‏
996 ‎‡2 LC|no2023031824‏
996 ‎‡2 SUDOC|034513213‏
996 ‎‡2 NII|DA15022492‏
996 ‎‡2 LC|n 81025805‏
996 ‎‡2 J9U|987007404350105171‏
996 ‎‡2 SUDOC|060847212‏
996 ‎‡2 ISNI|0000000051214405‏
996 ‎‡2 J9U|987007342709005171‏
996 ‎‡2 SUDOC|032889992‏
996 ‎‡2 BNF|12441193‏
996 ‎‡2 BIBSYS|97001112‏
996 ‎‡2 RERO|A023253364‏
996 ‎‡2 BNF|13595001‏
996 ‎‡2 DNB|121277623‏
996 ‎‡2 ISNI|0000000079017542‏
996 ‎‡2 BIBSYS|90704477‏
996 ‎‡2 CAOONL|ncf11471675‏
996 ‎‡2 RERO|A023108952‏
996 ‎‡2 NTA|354667998‏
996 ‎‡2 NII|DA01648189‏
996 ‎‡2 SUDOC|128598131‏
996 ‎‡2 NSK|000746107‏
996 ‎‡2 J9U|987007337806705171‏
996 ‎‡2 NII|DA18012575‏
996 ‎‡2 CAOONL|ncf11264796‏
996 ‎‡2 SIMACOB|44681827‏
996 ‎‡2 CAOONL|ncf10241371‏
996 ‎‡2 DNB|1196642451‏
996 ‎‡2 SZ|1283377721‏
996 ‎‡2 LNB|LNC10-000006242‏
996 ‎‡2 DNB|1196642354‏
996 ‎‡2 LC|n 93010045‏
996 ‎‡2 LC|no2015089638‏
996 ‎‡2 SUDOC|200399063‏
996 ‎‡2 LC|n 83039694‏
996 ‎‡2 BNF|12526224‏
996 ‎‡2 BIBSYS|1634281497873‏
996 ‎‡2 CAOONL|ncf10083894‏
996 ‎‡2 BIBSYS|1057742‏
996 ‎‡2 BIBSYS|9060474‏
996 ‎‡2 LC|nb2009004061‏
996 ‎‡2 SUDOC|080244963‏
996 ‎‡2 BIBSYS|90593821‏
996 ‎‡2 PLWABN|9812805293905606‏
996 ‎‡2 LC|n 2008028054‏
996 ‎‡2 ISNI|0000000458751181‏
996 ‎‡2 RERO|A022470018‏
996 ‎‡2 NII|DA07831767‏
996 ‎‡2 DNB|113914006X‏
996 ‎‡2 DNB|1055645365‏
996 ‎‡2 ISNI|0000000039536567‏
996 ‎‡2 LC|no2002023154‏
996 ‎‡2 CAOONL|ncf11619765‏
996 ‎‡2 BNE|XX5646265‏
996 ‎‡2 SUDOC|175472203‏
996 ‎‡2 JPG|500022392‏
996 ‎‡2 RERO|A024761629‏
996 ‎‡2 SUDOC|069767912‏
996 ‎‡2 CAOONL|ncf10613216‏
996 ‎‡2 DNB|1045167517‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏
998 ‎‡a Harris, D. James‏ ‎‡2 PLWABN|9810544788905606‏ ‎‡3 viafid‏
998 ‎‡a Harris, David James‏ ‎‡2 PLWABN|9810596709705606‏ ‎‡3 exact title: (1.00, 'assessingtheinfluenceofgeographicdistanceinparasitecommunitiesofanexoticlizard', 'assessingtheinfluenceofgeographicdistanceinparasitecommunitiesofanexoticlizard')‏
998 ‎‡a Harris,‏ ‎‡b David James‏ ‎‡2 PTBNP|1321934‏ ‎‡3 suggested‏ ‎‡3 title: (0.71, 'diversityinfectionpatternsandhostparasiteassociationsofapicomplexanparasitesinreptiles', 'assessingthediversityhostspecificityandinfectionpatternsofapicomplexanparasitesinreptilesfromomanarabia')‏
998 ‎‡a Harris, David James‏ ‎‡2 ISNI|0000000067985749‏ ‎‡3 suggested‏