VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q37393309 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010710.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q37393309‏
024 ‎‡a 0000-0002-6999-5507‏ ‎‡2 orcid‏
024 ‎‡a 35465836500‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q37393309‏
100 0 ‎‡a Charles R. Newton‏ ‎‡c researcher‏ ‎‡9 en‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Charles R Newton‏ ‎‡c investigador‏ ‎‡9 es‏
400 0 ‎‡a Charles R. Newton‏ ‎‡c chercheur‏ ‎‡9 fr‏
400 0 ‎‡a Charles R Newton‏ ‎‡c onderzoeker‏ ‎‡9 nl‏
670 ‎‡a Author's A comparison of oral artesunate and artemether antimalarial bioactivities in acute falciparum malaria‏
670 ‎‡a Author's A randomized control trial of phototherapy and 20% albumin versus phototherapy and saline in Kilifi, Kenya‏
670 ‎‡a Author's A single dose of intramuscular sulfadoxine-pyrimethamine as an adjunct to quinine in the treatment of severe malaria: pharmacokinetics and efficacy‏
670 ‎‡a Author's A Systematic Review of Research on Autism Spectrum Disorders in Sub-Saharan Africa‏
670 ‎‡a Author's A ten year review of the sickle cell program in Muhimbili National Hospital, Tanzania‏
670 ‎‡a Author's Abnormal intra-aural pressure waves associated with death in African children with acute nontraumatic coma‏
670 ‎‡a Author's Accuracy of clinical stroke scores for distinguishing stroke subtypes in resource poor settings: A systematic review of diagnostic test accuracy‏
670 ‎‡a Author's Active convulsive epilepsy in a rural district of Kenya: a study of prevalence and possible risk factors‏
670 ‎‡a Author's Acute bacterial meningitis in children admitted to a rural Kenyan hospital: increasing antibiotic resistance and outcome‏
670 ‎‡a Author's Acute seizures attributable to falciparum malaria in an endemic area on the Kenyan coast‏
670 ‎‡a Author's Age, Spatial, and Temporal Variations in Hospital Admissions with Malaria in Kilifi County, Kenya: A 25-Year Longitudinal Observational Study‏
670 ‎‡a Author's An increase in the burden of neonatal admissions to a rural district hospital in Kenya over 19 years‏
670 ‎‡a Author's An observational study of children with sickle cell disease in Kilifi, Kenya‏
670 ‎‡a Author's An open randomized trial of artemether versus quinine in the treatment of cerebral malaria in African children‏
670 ‎‡a Author's Antibodies to voltage-gated calcium channels in children with falciparum malaria‏
670 ‎‡a Author's Antimalarial drugs and the prevalence of mental and neurological manifestations: A systematic review and meta-analysis.‏
670 ‎‡a Author's Assessment of severe malnutrition among hospitalized children in rural Kenya: comparison of weight for height and mid upper arm circumference‏
670 ‎‡a Author's Attitudes and practices of families and health care personnel toward children with epilepsy in Kilifi, Kenya‏
670 ‎‡a Author's Atypical brain response to novelty in rural African children with a history of severe falciparum malaria‏
670 ‎‡a Author's Auditory and visual novelty processing in normally-developing Kenyan children‏
670 ‎‡a Author's Autism spectrum disorders in sub-Saharan Africa.‏
670 ‎‡a Author's Axonal and astrocyte injury markers in the cerebrospinal fluid of Kenyan children with severe malaria‏
670 ‎‡a Author's Bacteraemia in sickle cell anaemia is associated with low haemoglobin: a report of 890 admissions to a tertiary hospital in Tanzania‏
670 ‎‡a Author's Behavioral problems in children with epilepsy in rural Kenya.‏
670 ‎‡a Author's Behavioural comorbidity in Tanzanian children with epilepsy: a community-based case-control study‏
670 ‎‡a Author's Both heterozygous and homozygous Alpha + thalassemias protect against severe and fatal Plasmodium falciparum malaria on the coast of Kenya.‏
670 ‎‡a Author's Brain damage after neonatal tetanus in a rural Kenyan hospital‏
670 ‎‡a Author's Burden, causes, and outcomes of people with epilepsy admitted to a rural hospital in Kenya‏
670 ‎‡a Author's Burden, features, and outcome of neurological involvement in acute falciparum malaria in Kenyan children‏
670 ‎‡a Author's Burden of epilepsy in rural Kenya measured in disability-adjusted life years‏
670 ‎‡a Author's Can erythropoietin be used to prevent brain damage in cerebral malaria?‏
670 ‎‡a Author's Caregiver perceptions of children who have complex communication needs following a home-based intervention using augmentative and alternative communication in rural Kenya: an intervention note‏
670 ‎‡a Author's Caring for children with disabilities in Kilifi, Kenya: what is the carer's experience?‏
670 ‎‡a Author's Causes and outcome of young infant admissions to a Kenyan district hospital‏
670 ‎‡a Author's Cerebral malaria: what is unarousable coma?‏
670 ‎‡a Author's Cerebrospinal fluid markers to distinguish bacterial meningitis from cerebral malaria in children.‏
670 ‎‡a Author's Changes in health in England, with analysis by English regions and areas of deprivation, 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013‏
670 ‎‡a Author's Changing trends in incidence and aetiology of childhood acute non-traumatic coma over a period of changing malaria transmission in rural coastal Kenya: a retrospective analysis‏
670 ‎‡a Author's Child neurology practice and neurological disorders in East Africa‏
670 ‎‡a Author's Child neurology services in africa‏
670 ‎‡a Author's Childhood acute non-traumatic coma: aetiology and challenges in management in resource-poor countries of Africa and Asia‏
670 ‎‡a Author's Childhood deaths in Africa: uses and limitations of verbal autopsies‏
670 ‎‡a Author's Children at risk for developmental delay can be recognised by stunting, being underweight, ill health, little maternal schooling or high gravidity‏
670 ‎‡a Author's Children with severe malnutrition: can those at highest risk of death be identified with the WHO protocol?‏
670 ‎‡a Author's Chloramphenicol pharmacokinetics in African children with severe malaria‏
670 ‎‡a Author's Clinical and neurophysiologic features of active convulsive epilepsy in rural Kenya: a population-based study‏
670 ‎‡a Author's Clinical indicators of bacterial meningitis among neonates and young infants in rural Kenya‏
670 ‎‡a Author's Closing the mental health treatment gap in South Africa: a review of costs and cost-effectiveness‏
670 ‎‡a Author's Cognition and behavior in a prevalent cohort of children with epilepsy in rural northern Tanzania: A three-year follow-up study.‏
670 ‎‡a Author's Cognitive deficits following exposure to pneumococcal meningitis: an event-related potential study‏
670 ‎‡a Author's Common values in assessing health outcomes from disease and injury: disability weights measurement study for the Global Burden of Disease Study 2010.‏
670 ‎‡a Author's Community health workers to improve adherence to anti-seizure medication in rural South Africa: Is it cost-effective?‏
670 ‎‡a Author's Community perceptions of developmental and behavioral problems experienced by children living with epilepsy on the Kenyan coast: A qualitative study‏
670 ‎‡a Author's Comparison of axillary, rectal and tympanic temperature measurements in children admitted with malaria‏
670 ‎‡a Author's Computerized tomography scan of the brain in a community study of neurological impairment in Kenya.‏
670 ‎‡a Author's Congenital and neonatal malaria in a rural Kenyan district hospital: an eight-year analysis‏
670 ‎‡a Author's Congenital microcephaly unrelated to flavivirus exposure in coastal Kenya‏
670 ‎‡a Author's Continuous EEG monitoring in Kenyan children with non-traumatic coma‏
670 ‎‡a Author's Cysticercosis and epilepsy in rural Tanzania: a community-based case-control and imaging study‏
670 ‎‡a Author's Determination of lorazepam in plasma from children by high-performance liquid chromatography with UV detection‏
670 ‎‡a Author's Determination of midazolam and its major metabolite 1'-hydroxymidazolam by high-performance liquid chromatography-electrospray mass spectrometry in plasma from children‏
670 ‎‡a Author's Determination of paraldehyde by gas chromatography in whole blood from children‏
670 ‎‡a Author's Development and validation of the Kilifi Epilepsy Beliefs and Attitude Scale‏
670 ‎‡a Author's Development and validation of the Kilifi Stigma Scale for Epilepsy in Kenya‏
670 ‎‡a Author's Developmental impairments following severe falciparum malaria in children‏
670 ‎‡a Author's Developmental inventories using illiterate parents as informants: Communicative Development Inventory (CDI) adaptation for two Kenyan languages‏
670 ‎‡a Author's Diagnosis and management of the neurological complications of falciparum malaria‏
670 ‎‡a Author's Diagnosis of acute bacterial meningitis in children at a district hospital in sub-Saharan Africa.‏
670 ‎‡a Author's Disability-adjusted life years (DALYs) for 291 diseases and injuries in 21 regions, 1990-2010: a systematic analysis for the Global Burden of Disease Study 2010‏
670 ‎‡a Author's Do helminths cause epilepsy?‏
670 ‎‡a Author's Early production of the passive in two Eastern Bantu languages‏
670 ‎‡a Author's Effect of a fall in malaria transmission on morbidity and mortality in Kilifi, Kenya‏
670 ‎‡a Author's Electroencephalographic features of convulsive epilepsy in Africa: A multicentre study of prevalence, pattern and associated factors‏
670 ‎‡a Author's Emergency triage assessment for hypoxaemia in neonates and young children in a Kenyan hospital: an observational study.‏
670 ‎‡a Author's Epidemiology, causes, and treatment of epilepsy in sub-Saharan Africa‏
670 ‎‡a Author's Epilepsy in poor regions of the world‏
670 ‎‡a Author's Epilepsy is ubiquitous, but more devastating in the poorer regions of the world... or is it?‏
670 ‎‡a Author's Epileptic seizures and malaria in Kenyan children‏
670 ‎‡a Author's Estimation of the burden of active and life-time epilepsy: a meta-analytic approach‏
670 ‎‡a Author's Evaluation of Kilifi epilepsy education programme: a randomized controlled trial‏
670 ‎‡a Author's Excess child mortality after discharge from hospital in Kilifi, Kenya: a retrospective cohort analysis‏
670 ‎‡a Author's Expanding access to mental health care: a missing ingredient.‏
670 ‎‡a Author's Exposure to multiple parasites is associated with the prevalence of active convulsive epilepsy in sub-Saharan Africa‏
670 ‎‡a Author's Falciparum malaria in children‏
670 ‎‡a Author's Fetal Hemoglobin is Associated with Peripheral Oxygen Saturation in Sickle Cell Disease in Tanzania‏
670 ‎‡a Author's Fosphenytoin for seizure prevention in childhood coma in Africa: a randomized clinical trial‏
670 ‎‡a Author's Fraction of all hospital admissions and deaths attributable to malnutrition among children in rural Kenya‏
670 ‎‡a Author's Genetics of fetal hemoglobin in Tanzanian and British patients with sickle cell anemia‏
670 ‎‡a Author's Genomewide analysis of the host response to malaria in Kenyan children‏
670 ‎‡a Author's Global arginine bioavailability in Tanzanian sickle cell anaemia patients at steady-state: a nested case control study of deaths versus survivors‏
670 ‎‡a Author's Global proteomic analysis of plasma from mice infected with Plasmodium berghei ANKA using two dimensional gel electrophoresis and matrix assisted laser desorption ionization-time of flight mass spectrometry.‏
670 ‎‡a Author's Global, regional, and national age-sex-specific mortality for 282 causes of death in 195 countries and territories, 1980–2017: a systematic analysis for the Global Burden of Disease Study 2017‏
670 ‎‡a Author's Global, regional, and national comparative risk assessment of 79 behavioural, environmental and occupational, and metabolic risks or clusters of risks in 188 countries, 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013‏
670 ‎‡a Author's Global, regional, and national disability-adjusted life years (DALYs) for 306 diseases and injuries and healthy life expectancy (HALE) for 188 countries, 1990-2013: quantifying the epidemiological transition‏
670 ‎‡a Author's Global, regional, and national incidence and mortality for HIV, tuberculosis, and malaria during 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013.‏
670 ‎‡a Author's Global, regional, and national levels and causes of maternal mortality during 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013.‏
670 ‎‡a Author's Growth parameters and childhood epilepsy in Hai District, Tanzania: a community-based study‏
670 ‎‡a Author's Haptoglobin, Alpha -thalassaemia and glucose-6-phosphate dehydrogenase polymorphisms and risk of abnormal transcranial Doppler among patients with sickle cell anaemia in Tanzania.‏
670 ‎‡a Author's Haptoglobin HP2-2 genotype, Alpha -thalassaemia and acute seizures in children living in a malaria-endemic area.‏
670 ‎‡a Author's Health risk behavior among perinatally HIV exposed uninfected adolescents: A systematic review‏
670 ‎‡a Author's Health Risk Behaviour among Adolescents Living with HIV in Sub-Saharan Africa: A Systematic Review and Meta-Analysis‏
670 ‎‡a Author's Hematological and Genetic Predictors of Daytime Hemoglobin Saturation in Tanzanian Children with and without Sickle Cell Anemia‏
670 ‎‡a Author's High levels of erythropoietin are associated with protection against neurological sequelae in African children with cerebral malaria.‏
670 ‎‡a Author's Homozygosity and risk of childhood death due to invasive bacterial disease‏
670 ‎‡a Author's Hypokalemia in children with severe falciparum malaria‏
670 ‎‡a Author's Identification of people with disabilities using participatory rural appraisal and key informants: a pragmatic approach with action potential promoting validity and low cost‏
670 ‎‡a Author's Identifying children with neurological impairment and disability in resource-poor countries.‏
670 ‎‡a Author's Impaired everyday memory associated with encephalopathy of severe malaria: the role of seizures and hippocampal damage‏
670 ‎‡a Author's Impairment of executive function in Kenyan children exposed to severe falciparum malaria with neurological involvement‏
670 ‎‡a Author's Incidence and outcome of convulsive status epilepticus in Kenyan children: a cohort study‏
670 ‎‡a Author's Incidence and risk factors for neonatal tetanus in admissions to Kilifi County Hospital, Kenya.‏
670 ‎‡a Author's Incidence, causes and phenotypes of acute seizures in Kenyan children post the malaria-decline period‏
670 ‎‡a Author's Incidence of convulsive epilepsy in a rural area in Kenya‏
670 ‎‡a Author's Incidence of epilepsy: a systematic review and meta-analysis.‏
670 ‎‡a Author's Incidence, Remission and Mortality of Convulsive Epilepsy in Rural Northeast South Africa‏
670 ‎‡a Author's Increased prevalence of epilepsy associated with severe falciparum malaria in children‏
670 ‎‡a Author's Indicators of acute bacterial meningitis in children at a rural Kenyan district hospital‏
670 ‎‡a Author's Indicators of life-threatening malaria in African children‏
670 ‎‡a Author's Interaction between Plasmodium falciparum and human immunodeficiency virus type 1 on the central nervous system of African children.‏
670 ‎‡a Author's Intracranial pressure in African children with cerebral malaria‏
670 ‎‡a Author's Investigating the Evidence of Behavioral, Cognitive, and Psychiatric Endophenotypes in Autism: A Systematic Review‏
670 ‎‡a Author's Investigation of practices to support the complex communication needs of children with hearing impairment and cerebral palsy in a rural district of Kenya: a case series‏
670 ‎‡a Author's Iron deficiency and acute seizures: results from children living in rural Kenya and a meta-analysis‏
670 ‎‡a Author's Lack of association of interferon regulatory factor 1 with severe malaria in affected child-parental trio studies across three African populations‏
670 ‎‡a Author's Life-threatening hyponatraemia and neurotoxicity during chemotherapy for Burkitt's lymphoma.‏
670 ‎‡a Author's Likely health outcomes for untreated acute febrile illness in the tropics in decision and economic models; a Delphi survey‏
670 ‎‡a Author's Long-term neurodevelopmental outcomes after intrauterine and neonatal insults: a systematic review‏
670 ‎‡a Author's Long-term outcomes of survivors of neonatal insults: A systematic review and meta-analysis‏
670 ‎‡a Author's Malaria‏
670 ‎‡a Author's Malaria in patients with sickle cell anemia: burden, risk factors, and outcome at the outpatient clinic and during hospitalization‏
670 ‎‡a Author's Maternal and neonatal tetanus‏
670 ‎‡a Author's Monitoring psychomotor development in a resource-limited setting: an evaluation of the Kilifi Developmental Inventory.‏
670 ‎‡a Author's Mortality among Kenyan children admitted to a rural district hospital on weekends as compared with weekdays‏
670 ‎‡a Author's Mortality in sickle cell anemia in Africa: a prospective cohort study in Tanzania‏
670 ‎‡a Author's Neonatal jaundice and developmental impairment among infants in Kilifi, Kenya‏
670 ‎‡a Author's Neonatal seizures in a rural Kenyan District Hospital: aetiology, incidence and outcome of hospitalization.‏
670 ‎‡a Author's Neonatal severe bacterial infection impairment estimates in South Asia, sub-Saharan Africa, and Latin America for 2010‏
670 ‎‡a Author's Neuro-cognitive impairment following acquired central nervous system infections in childhood: a systematic review‏
670 ‎‡a Author's Neurodevelopmental disorders in low- and middle-income countries‏
670 ‎‡a Author's Neurological and developmental outcome of neonatal jaundice and sepsis in rural Kenya‏
670 ‎‡a Author's Neurological aspects of tropical disease‏
670 ‎‡a Author's Neurological manifestations of falciparum malaria‏
670 ‎‡a Author's New classification of acute papilledema in children with severe malaria.‏
670 ‎‡a Author's Nocturnal haemoglobin oxygen desaturation in urban and rural East African paediatric cohorts with and without sickle cell anaemia: a cross-sectional study‏
670 ‎‡a Author's Nutritional status, hospitalization and mortality among patients with sickle cell anemia in Tanzania‏
670 ‎‡a Author's Oxidative stress and erythrocyte damage in Kenyan children with severe Plasmodium falciparum malaria.‏
670 ‎‡a Author's Packages of care for epilepsy in low- and middle-income countries‏
670 ‎‡a Author's Paediatric coma scales.‏
670 ‎‡a Author's Paediatric neurology: advances on many fronts‏
670 ‎‡a Author's Parasitic disorders‏
670 ‎‡a Author's Parents' and professionals' perceptions on causes and treatment options for Autism Spectrum Disorders (ASD) in a multicultural context on the Kenyan Coast‏
670 ‎‡a Author's Parvovirus B19 infection and severe anaemia in Kenyan children: a retrospective case control study‏
670 ‎‡a Author's Patterns of neurobehavioral functioning in school-aged survivors of neonatal jaundice and hypoxic-ischemic encephalopathy in Kilifi, Kenya: A cross-sectional study‏
670 ‎‡a Author's Periodicity and space-time clustering of severe childhood malaria on the coast of Kenya‏
670 ‎‡a Author's Persistent neurocognitive impairments associated with severe falciparum malaria in Kenyan children.‏
670 ‎‡a Author's Perturbations in electrolyte levels in kenyan children with severe malaria complicated by acidosis‏
670 ‎‡a Author's Perturbations of cerebral hemodynamics in Kenyans with cerebral malaria‏
670 ‎‡a Author's Pharmacokinetics and anticonvulsant effects of diazepam in children with severe falciparum malaria and convulsions.‏
670 ‎‡a Author's Pharmacokinetics and clinical effect of phenobarbital in children with severe falciparum malaria and convulsions.‏
670 ‎‡a Author's Pharmacokinetics and clinical effects of phenytoin and fosphenytoin in children with severe malaria and status epilepticus.‏
670 ‎‡a Author's Pharmacokinetics and clinical efficacy of lorazepam in children with severe malaria and convulsions.‏
670 ‎‡a Author's Phase III trials required to resolve clinical equipoise over optimal fluid management in children with severe malaria‏
670 ‎‡a Author's Plasmodium falciparum and the brain‏
670 ‎‡a Author's Plasmodium falciparum var gene expression is modified by host immunity‏
670 ‎‡a Author's Positive selection of a CD36 nonsense variant in sub-saharan Africa, but no association with severe malaria phenotypes‏
670 ‎‡a Author's Pre-transfusion management of children with severe malarial anaemia: a randomised controlled trial of intravascular volume expansion‏
670 ‎‡a Author's Premature mortality in active convulsive epilepsy in rural Kenya: causes and associated factors‏
670 ‎‡a Author's Premature mortality in epilepsy and the role of psychiatric comorbidity: a total population study‏
670 ‎‡a Author's Prevalence and risk factors for active convulsive epilepsy in rural northeast South Africa‏
670 ‎‡a Author's Prevalence and risk factors of neurological disability and impairment in children living in rural Kenya‏
670 ‎‡a Author's Prevalence of active convulsive epilepsy in sub-Saharan Africa and associated risk factors: cross-sectional and case-control studies‏
670 ‎‡a Author's Prognostic indicators of life-threatening malaria are associated with distinct parasite variant antigen profiles‏
670 ‎‡a Author's Prognostic value of circulating pigmented cells in African children with malaria‏
670 ‎‡a Author's Psychometric evaluation of the Major Depression Inventory among young people living in Coastal Kenya‏
670 ‎‡a Author's Randomized trial of volume expansion with albumin or saline in children with severe malaria: preliminary evidence of albumin benefit‏
670 ‎‡a Author's Ready-to-use food supplement, with or without arginine and citrulline, with daily chloroquine in Tanzanian children with sickle-cell disease: a double-blind, random order crossover trial.‏
670 ‎‡a Author's Research and open access from low- and middle-income countries‏
670 ‎‡a Author's Response to diazepam in children with malaria-induced seizures.‏
670 ‎‡a Author's Response to volume resuscitation in children with severe malaria‏
670 ‎‡a Author's Retinopathy, histidine-rich protein-2 and perfusion pressure in cerebral malaria‏
670 ‎‡a Author's Review Article: blood-brain barrier in falciparum malaria.‏
670 ‎‡a Author's Risk factors associated with the epilepsy treatment gap in Kilifi, Kenya: a cross-sectional study‏
670 ‎‡a Author's Risk factors for high cerebral blood flow velocity and death in Kenyan children with Sickle Cell Anaemia: role of haemoglobin oxygen saturation and febrile illness‏
670 ‎‡a Author's Risk factors for persisting neurological and cognitive impairments following cerebral malaria.‏
670 ‎‡a Author's Second assessment of NeuroAIDS in Africa‏
670 ‎‡a Author's Seizure disorders among relatives of Kenyan children with severe falciparum malaria‏
670 ‎‡a Author's Seizures in 204 comatose children: incidence and outcome‏
670 ‎‡a Author's Serum tumour necrosis factor in children suffering from Plasmodium falciparum infection in Kilifi District, Kenya‏
670 ‎‡a Author's Severe anaemia in children living in a malaria endemic area of Kenya‏
670 ‎‡a Author's Severe falciparum malaria and acquired childhood language disorder‏
670 ‎‡a Author's Severe falciparum malaria in children: current understanding of pathophysiology and supportive treatment‏
670 ‎‡a Author's Socio-cultural determinants of health-seeking behaviour on the Kenyan coast: a qualitative study‏
670 ‎‡a Author's Socioeconomic status, anthropometric status, and psychomotor development of Kenyan children from resource-limited settings: a path-analytic study‏
670 ‎‡a Author's Speech and Language Disorders in Kenyan Children: Adapting Tools for Regions with Few Assessment Resources‏
670 ‎‡a Author's Speech and language sequelae of severe malaria in Kenyan children‏
670 ‎‡a Author's Standardized data collection for multi-center clinical studies of severe malaria in African children: establishing the SMAC network‏
670 ‎‡a Author's Standards for epidemiologic studies and surveillance of epilepsy‏
670 ‎‡a Author's Status epilepticus in resource-poor countries‏
670 ‎‡a Author's Status epilepticus in sub-Saharan Africa: New findings.‏
670 ‎‡a Author's Survey of rehabilitation support for children 0-15 years in a rural part of Kenya‏
670 ‎‡a Author's The challenges and innovations for therapy in children with epilepsy.‏
670 ‎‡a Author's The challenges of managing children with epilepsy in Africa‏
670 ‎‡a Author's The continuing role of ICNA in Africa: how to tackle autism?‏
670 ‎‡a Author's The disposition of intramuscular artemether in children with cerebral malaria; a preliminary study‏
670 ‎‡a Author's The effect ofPlasmodium falciparumon cognition: a systematic review‏
670 ‎‡a Author's The epilepsy treatment gap in developing countries: a systematic review of the magnitude, causes, and intervention strategies‏
670 ‎‡a Author's The incidence, aetiology and outcome of acute seizures in children admitted to a rural Kenyan district hospital‏
670 ‎‡a Author's The INTERGROWTH-21st Project Neurodevelopment Package: a novel method for the multi-dimensional assessment of neurodevelopment in pre-school age children‏
670 ‎‡a Author's The Lambaréné Organ Dysfunction Score‏
670 ‎‡a Author's The Lambaréné Organ Dysfunction Score (LODS) is a simple clinical predictor of fatal malaria in African children‏
670 ‎‡a Author's The primary prevention of epilepsy: A report of the Prevention Task Force of the International League Against Epilepsy.‏
670 ‎‡a Author's The role for osmotic agents in children with acute encephalopathies: a systematic review‏
670 ‎‡a Author's The role of ICNA in Africa‏
670 ‎‡a Author's The role of sequential administration of sulphadoxine/pyrimethamine following quinine in the treatment of severe falciparum malaria in children‏
670 ‎‡a Author's The role of weight for age and disease stage in poor psychomotor outcome of HIV-infected children in Kilifi, Kenya‏
670 ‎‡a Author's The tympanic membrane displacement analyser for monitoring intracranial pressure in children‏
670 ‎‡a Author's The validation of a three-stage screening methodology for detecting active convulsive epilepsy in population-based studies in health and demographic surveillance systems‏
670 ‎‡a Author's Towards optimal regimens of parenteral quinine for young African children with cerebral malaria: the importance of unbound quinine concentration‏
670 ‎‡a Author's Traditional healers and epilepsy treatment on the Kenyan coast‏
670 ‎‡a Author's Tricuspid regurgitant jet velocity and hospitalization in Tanzanian children with sickle cell anemia‏
670 ‎‡a Author's UK health performance: findings of the Global Burden of Disease Study 2010.‏
670 ‎‡a Author's Undue regulatory control on phenobarbital--an important yet overlooked reason for the epilepsy treatment gap.‏
670 ‎‡a Author's Unexpected relationship between tympanometry and mortality in children with nontraumatic coma‏
670 ‎‡a Author's Validity and reliability of the Neurodevelopmental Screening Tool (NDST) in screening for neurodevelopmental disorders in children living in rural Kenyan coast‏
670 ‎‡a Author's Validity and reliability of the 'Ten Questions' questionnaire for detecting moderate to severe neurological impairment in children aged 6-9 years in rural Kenya‏
670 ‎‡a Author's Value of Plasmodium falciparum histidine-rich protein 2 level and malaria retinopathy in distinguishing cerebral malaria from other acute encephalopathies in Kenyan children‏
670 ‎‡a Author's Viral infections of the CNS in sub-Saharan Africa: interaction with Plasmodium falciparum‏
670 ‎‡a Author's Volume status in severe malaria: no evidence provided for the degree of filling of the intravascular compartment‏
670 ‎‡a Author's Withdrawal of older anticonvulsants for management of status epilepticus: implications for resource-poor countries‏
670 ‎‡a Author's Years lived with disability (YLDs) for 1160 sequelae of 289 diseases and injuries 1990–2010: a systematic analysis for the Global Burden of Disease Study 2010‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/viaf/309915096‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/LC|no2014112947‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/SUDOC|179334972‏
909 ‎‡a (orcid) 0000000269995507‏ ‎‡9 1‏
909 ‎‡a (scopus) 35465836500‏ ‎‡9 1‏
912 ‎‡a yearslivedwithdisabilityyldsfor1160sequelaeof289diseasesandinjuries19902010asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Years lived with disability (YLDs) for 1160 sequelae of 289 diseases and injuries 1990–2010: a systematic analysis for the Global Burden of Disease Study 2010‏ ‎‡9 1‏
912 ‎‡a changesinhealthinenglandwithanalysisbyenglishregionsandareasofdeprivation19902013asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Changes in health in England, with analysis by English regions and areas of deprivation, 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013‏ ‎‡9 1‏
912 ‎‡a commonvaluesinassessinghealthoutcomesfromdiseaseandinjurydisabilityweightsmeasurementstudyfortheglobalburdenofdiseasestudy‏ ‎‡A Common values in assessing health outcomes from disease and injury: disability weights measurement study for the Global Burden of Disease Study 2010.‏ ‎‡9 1‏
912 ‎‡a disabilityadjustedlifeyearsdalysfor291diseasesandinjuriesin21regions19902010asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Disability-adjusted life years (DALYs) for 291 diseases and injuries in 21 regions, 1990-2010: a systematic analysis for the Global Burden of Disease Study 2010‏ ‎‡9 1‏
912 ‎‡a globalregionalandnationalagesexspecificmortalityfor282causesofdeathin195countriesandterritories19802017asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Global, regional, and national age-sex-specific mortality for 282 causes of death in 195 countries and territories, 1980–2017: a systematic analysis for the Global Burden of Disease Study 2017‏ ‎‡9 1‏
912 ‎‡a globalregionalandnationalcomparativeriskassessmentof79behaviouralenvironmentalandoccupationalandmetabolicrisksorclustersofrisksin188countries19902013asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Global, regional, and national comparative risk assessment of 79 behavioural, environmental and occupational, and metabolic risks or clusters of risks in 188 countries, 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013‏ ‎‡9 1‏
912 ‎‡a globalregionalandnationaldisabilityadjustedlifeyearsdalysfor306diseasesandinjuriesandhealthylifeexpectancyhalefor188countries19902013quantifyingtheepidemiologicaltransition‏ ‎‡A Global, regional, and national disability-adjusted life years (DALYs) for 306 diseases and injuries and healthy life expectancy (HALE) for 188 countries, 1990-2013: quantifying the epidemiological transition‏ ‎‡9 1‏
912 ‎‡a globalregionalandnationalincidenceandmortalityforhivtuberculosisandmalariaduring19902013asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Global, regional, and national incidence and mortality for HIV, tuberculosis, and malaria during 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013.‏ ‎‡9 1‏
912 ‎‡a globalregionalandnationallevelsandcausesofmaternalmortalityduring19902013asystematicanalysisfortheglobalburdenofdiseasestudy‏ ‎‡A Global, regional, and national levels and causes of maternal mortality during 1990-2013: a systematic analysis for the Global Burden of Disease Study 2013.‏ ‎‡9 1‏
912 ‎‡a malaria‏ ‎‡A Malaria‏ ‎‡9 1‏
919 ‎‡a ukhealthperformancefindingsoftheglobalburdenofdiseasestudy‏ ‎‡A UK health performance: findings of the Global Burden of Disease Study 2010.‏ ‎‡9 1‏
919 ‎‡a withdrawalofolderanticonvulsantsformanagementofstatusepilepticusimplicationsforresourcepoorcountries‏ ‎‡A Withdrawal of older anticonvulsants for management of status epilepticus: implications for resource-poor countries‏ ‎‡9 1‏
919 ‎‡a volumestatusinseveremalarianoevidenceprovidedforthedegreeoffillingoftheintravascularcompartment‏ ‎‡A Volume status in severe malaria: no evidence provided for the degree of filling of the intravascular compartment‏ ‎‡9 1‏
919 ‎‡a viralinfectionsofthecnsinsubsaharanafricainteractionwithplasmodiumfalciparum‏ ‎‡A Viral infections of the CNS in sub-Saharan Africa: interaction with Plasmodium falciparum‏ ‎‡9 1‏
919 ‎‡a valueofplasmodiumfalciparumhistidinerichprotein2levelandmalariaretinopathyindistinguishingcerebralmalariafromotheracuteencephalopathiesinkenyanchildren‏ ‎‡A Value of Plasmodium falciparum histidine-rich protein 2 level and malaria retinopathy in distinguishing cerebral malaria from other acute encephalopathies in Kenyan children‏ ‎‡9 1‏
919 ‎‡a validityandreliabilityofthe10questionsquestionnairefordetectingmoderatetosevereneurologicalimpairmentinchildrenaged69yearsinruralkenya‏ ‎‡A Validity and reliability of the 'Ten Questions' questionnaire for detecting moderate to severe neurological impairment in children aged 6-9 years in rural Kenya‏ ‎‡9 1‏
919 ‎‡a validityandreliabilityoftheneurodevelopmentalscreeningtoolndstinscreeningforneurodevelopmentaldisordersinchildrenlivinginruralkenyancoast‏ ‎‡A Validity and reliability of the Neurodevelopmental Screening Tool (NDST) in screening for neurodevelopmental disorders in children living in rural Kenyan coast‏ ‎‡9 1‏
919 ‎‡a unexpectedrelationshipbetweentympanometryandmortalityinchildrenwithnontraumaticcoma‏ ‎‡A Unexpected relationship between tympanometry and mortality in children with nontraumatic coma‏ ‎‡9 1‏
919 ‎‡a undueregulatorycontrolonphenobarbitalanimportantyetoverlookedreasonfortheepilepsytreatmentgap‏ ‎‡A Undue regulatory control on phenobarbital--an important yet overlooked reason for the epilepsy treatment gap.‏ ‎‡9 1‏
919 ‎‡a comparisonoforalartesunateandartemetherantimalarialbioactivitiesinacutefalciparummalaria‏ ‎‡A A comparison of oral artesunate and artemether antimalarial bioactivities in acute falciparum malaria‏ ‎‡9 1‏
919 ‎‡a randomizedcontroltrialofphototherapyand20albuminversusphototherapyandsalineinkilifikenya‏ ‎‡A A randomized control trial of phototherapy and 20% albumin versus phototherapy and saline in Kilifi, Kenya‏ ‎‡9 1‏
919 ‎‡a singledoseofintramuscularsulfadoxinepyrimethamineasanadjuncttoquinineinthetreatmentofseveremalariapharmacokineticsandefficacy‏ ‎‡A A single dose of intramuscular sulfadoxine-pyrimethamine as an adjunct to quinine in the treatment of severe malaria: pharmacokinetics and efficacy‏ ‎‡9 1‏
919 ‎‡a systematicreviewofresearchonautismspectrumdisordersinsubsaharanafrica‏ ‎‡A A Systematic Review of Research on Autism Spectrum Disorders in Sub-Saharan Africa‏ ‎‡9 1‏
919 ‎‡a 10yearreviewofthesicklecellprograminmuhimbilinationalhospitaltanzania‏ ‎‡A A ten year review of the sickle cell program in Muhimbili National Hospital, Tanzania‏ ‎‡9 1‏
919 ‎‡a abnormalintraauralpressurewavesassociatedwithdeathinafricanchildrenwithacutenontraumaticcoma‏ ‎‡A Abnormal intra-aural pressure waves associated with death in African children with acute nontraumatic coma‏ ‎‡9 1‏
919 ‎‡a accuracyofclinicalstrokescoresfordistinguishingstrokesubtypesinresourcepoorsettingsasystematicreviewofdiagnostictestaccuracy‏ ‎‡A Accuracy of clinical stroke scores for distinguishing stroke subtypes in resource poor settings: A systematic review of diagnostic test accuracy‏ ‎‡9 1‏
919 ‎‡a activeconvulsiveepilepsyinaruraldistrictofkenyaastudyofprevalenceandpossibleriskfactors‏ ‎‡A Active convulsive epilepsy in a rural district of Kenya: a study of prevalence and possible risk factors‏ ‎‡9 1‏
919 ‎‡a acutebacterialmeningitisinchildrenadmittedtoaruralkenyanhospitalincreasingantibioticresistanceandoutcome‏ ‎‡A Acute bacterial meningitis in children admitted to a rural Kenyan hospital: increasing antibiotic resistance and outcome‏ ‎‡9 1‏
919 ‎‡a acuteseizuresattributabletofalciparummalariainanendemicareaonthekenyancoast‏ ‎‡A Acute seizures attributable to falciparum malaria in an endemic area on the Kenyan coast‏ ‎‡9 1‏
919 ‎‡a agespatialandtemporalvariationsinhospitaladmissionswithmalariainkilificountykenyaa25yearlongitudinalobservationalstudy‏ ‎‡A Age, Spatial, and Temporal Variations in Hospital Admissions with Malaria in Kilifi County, Kenya: A 25-Year Longitudinal Observational Study‏ ‎‡9 1‏
919 ‎‡a increaseintheburdenofneonataladmissionstoaruraldistricthospitalinkenyaover19years‏ ‎‡A An increase in the burden of neonatal admissions to a rural district hospital in Kenya over 19 years‏ ‎‡9 1‏
919 ‎‡a observationalstudyofchildrenwithsicklecelldiseaseinkilifikenya‏ ‎‡A An observational study of children with sickle cell disease in Kilifi, Kenya‏ ‎‡9 1‏
919 ‎‡a openrandomizedtrialofartemetherversusquinineinthetreatmentofcerebralmalariainafricanchildren‏ ‎‡A An open randomized trial of artemether versus quinine in the treatment of cerebral malaria in African children‏ ‎‡9 1‏
919 ‎‡a antibodiestovoltagegatedcalciumchannelsinchildrenwithfalciparummalaria‏ ‎‡A Antibodies to voltage-gated calcium channels in children with falciparum malaria‏ ‎‡9 1‏
919 ‎‡a antimalarialdrugsandtheprevalenceofmentalandneurologicalmanifestationsasystematicreviewandmetaanalysis‏ ‎‡A Antimalarial drugs and the prevalence of mental and neurological manifestations: A systematic review and meta-analysis.‏ ‎‡9 1‏
919 ‎‡a assessmentofseveremalnutritionamonghospitalizedchildreninruralkenyacomparisonofweightforheightandmidupperarmcircumference‏ ‎‡A Assessment of severe malnutrition among hospitalized children in rural Kenya: comparison of weight for height and mid upper arm circumference‏ ‎‡9 1‏
919 ‎‡a attitudesandpracticesoffamiliesandhealthcarepersonneltowardchildrenwithepilepsyinkilifikenya‏ ‎‡A Attitudes and practices of families and health care personnel toward children with epilepsy in Kilifi, Kenya‏ ‎‡9 1‏
919 ‎‡a atypicalbrainresponsetonoveltyinruralafricanchildrenwithahistoryofseverefalciparummalaria‏ ‎‡A Atypical brain response to novelty in rural African children with a history of severe falciparum malaria‏ ‎‡9 1‏
919 ‎‡a auditoryandvisualnoveltyprocessinginnormallydevelopingkenyanchildren‏ ‎‡A Auditory and visual novelty processing in normally-developing Kenyan children‏ ‎‡9 1‏
919 ‎‡a autismspectrumdisordersinsubsaharanafrica‏ ‎‡A Autism spectrum disorders in sub-Saharan Africa.‏ ‎‡9 1‏
919 ‎‡a axonalandastrocyteinjurymarkersinthecerebrospinalfluidofkenyanchildrenwithseveremalaria‏ ‎‡A Axonal and astrocyte injury markers in the cerebrospinal fluid of Kenyan children with severe malaria‏ ‎‡9 1‏
919 ‎‡a bacteraemiainsicklecellanaemiaisassociatedwithlowhaemoglobinareportof890admissionstoatertiaryhospitalintanzania‏ ‎‡A Bacteraemia in sickle cell anaemia is associated with low haemoglobin: a report of 890 admissions to a tertiary hospital in Tanzania‏ ‎‡9 1‏
919 ‎‡a behavioralproblemsinchildrenwithepilepsyinruralkenya‏ ‎‡A Behavioral problems in children with epilepsy in rural Kenya.‏ ‎‡9 1‏
919 ‎‡a behaviouralcomorbidityintanzanianchildrenwithepilepsyacommunitybasedcasecontrolstudy‏ ‎‡A Behavioural comorbidity in Tanzanian children with epilepsy: a community-based case-control study‏ ‎‡9 1‏
919 ‎‡a bothheterozygousandhomozygous Alpha +thalassemiasprotectagainstsevereandfatalplasmodiumfalciparummalariaonthecoastofkenya‏ ‎‡A Both heterozygous and homozygous Alpha + thalassemias protect against severe and fatal Plasmodium falciparum malaria on the coast of Kenya.‏ ‎‡9 1‏
919 ‎‡a braindamageafterneonataltetanusinaruralkenyanhospital‏ ‎‡A Brain damage after neonatal tetanus in a rural Kenyan hospital‏ ‎‡9 1‏
919 ‎‡a burdencausesandoutcomesofpeoplewithepilepsyadmittedtoaruralhospitalinkenya‏ ‎‡A Burden, causes, and outcomes of people with epilepsy admitted to a rural hospital in Kenya‏ ‎‡9 1‏
919 ‎‡a burdenfeaturesandoutcomeofneurologicalinvolvementinacutefalciparummalariainkenyanchildren‏ ‎‡A Burden, features, and outcome of neurological involvement in acute falciparum malaria in Kenyan children‏ ‎‡9 1‏
919 ‎‡a burdenofepilepsyinruralkenyameasuredindisabilityadjustedlifeyears‏ ‎‡A Burden of epilepsy in rural Kenya measured in disability-adjusted life years‏ ‎‡9 1‏
919 ‎‡a canerythropoietinbeusedtopreventbraindamageincerebralmalaria‏ ‎‡A Can erythropoietin be used to prevent brain damage in cerebral malaria?‏ ‎‡9 1‏
919 ‎‡a caregiverperceptionsofchildrenwhohavecomplexcommunicationneedsfollowingahomebasedinterventionusingaugmentativeandalternativecommunicationinruralkenyaaninterventionnote‏ ‎‡A Caregiver perceptions of children who have complex communication needs following a home-based intervention using augmentative and alternative communication in rural Kenya: an intervention note‏ ‎‡9 1‏
919 ‎‡a caringforchildrenwithdisabilitiesinkilifikenyawhatisthecarersexperience‏ ‎‡A Caring for children with disabilities in Kilifi, Kenya: what is the carer's experience?‏ ‎‡9 1‏
919 ‎‡a causesandoutcomeofyounginfantadmissionstoakenyandistricthospital‏ ‎‡A Causes and outcome of young infant admissions to a Kenyan district hospital‏ ‎‡9 1‏
919 ‎‡a cerebralmalariawhatisunarousablecoma‏ ‎‡A Cerebral malaria: what is unarousable coma?‏ ‎‡9 1‏
919 ‎‡a cerebrospinalfluidmarkerstodistinguishbacterialmeningitisfromcerebralmalariainchildren‏ ‎‡A Cerebrospinal fluid markers to distinguish bacterial meningitis from cerebral malaria in children.‏ ‎‡9 1‏
919 ‎‡a changingtrendsinincidenceandaetiologyofchildhoodacutenontraumaticcomaoveraperiodofchangingmalariatransmissioninruralcoastalkenyaaretrospectiveanalysis‏ ‎‡A Changing trends in incidence and aetiology of childhood acute non-traumatic coma over a period of changing malaria transmission in rural coastal Kenya: a retrospective analysis‏ ‎‡9 1‏
919 ‎‡a childneurologypracticeandneurologicaldisordersineastafrica‏ ‎‡A Child neurology practice and neurological disorders in East Africa‏ ‎‡9 1‏
919 ‎‡a childneurologyservicesinafrica‏ ‎‡A Child neurology services in africa‏ ‎‡9 1‏
919 ‎‡a childhoodacutenontraumaticcomaaetiologyandchallengesinmanagementinresourcepoorcountriesofafricaandasia‏ ‎‡A Childhood acute non-traumatic coma: aetiology and challenges in management in resource-poor countries of Africa and Asia‏ ‎‡9 1‏
919 ‎‡a childhooddeathsinafricausesandlimitationsofverbalautopsies‏ ‎‡A Childhood deaths in Africa: uses and limitations of verbal autopsies‏ ‎‡9 1‏
919 ‎‡a childrenatriskfordevelopmentaldelaycanberecognisedbystuntingbeingunderweightillhealthlittlematernalschoolingorhighgravidity‏ ‎‡A Children at risk for developmental delay can be recognised by stunting, being underweight, ill health, little maternal schooling or high gravidity‏ ‎‡9 1‏
919 ‎‡a childrenwithseveremalnutritioncanthoseathighestriskofdeathbeidentifiedwiththewhoprotocol‏ ‎‡A Children with severe malnutrition: can those at highest risk of death be identified with the WHO protocol?‏ ‎‡9 1‏
919 ‎‡a chloramphenicolpharmacokineticsinafricanchildrenwithseveremalaria‏ ‎‡A Chloramphenicol pharmacokinetics in African children with severe malaria‏ ‎‡9 1‏
919 ‎‡a clinicalandneurophysiologicfeaturesofactiveconvulsiveepilepsyinruralkenyaapopulationbasedstudy‏ ‎‡A Clinical and neurophysiologic features of active convulsive epilepsy in rural Kenya: a population-based study‏ ‎‡9 1‏
919 ‎‡a clinicalindicatorsofbacterialmeningitisamongneonatesandyounginfantsinruralkenya‏ ‎‡A Clinical indicators of bacterial meningitis among neonates and young infants in rural Kenya‏ ‎‡9 1‏
919 ‎‡a closingthementalhealthtreatmentgapinsouthafricaareviewofcostsandcosteffectiveness‏ ‎‡A Closing the mental health treatment gap in South Africa: a review of costs and cost-effectiveness‏ ‎‡9 1‏
919 ‎‡a cognitionandbehaviorinaprevalentcohortofchildrenwithepilepsyinruralnortherntanzaniaa3yearfollowupstudy‏ ‎‡A Cognition and behavior in a prevalent cohort of children with epilepsy in rural northern Tanzania: A three-year follow-up study.‏ ‎‡9 1‏
919 ‎‡a cognitivedeficitsfollowingexposuretopneumococcalmeningitisaneventrelatedpotentialstudy‏ ‎‡A Cognitive deficits following exposure to pneumococcal meningitis: an event-related potential study‏ ‎‡9 1‏
919 ‎‡a communityhealthworkerstoimproveadherencetoantiseizuremedicationinruralsouthafricaisitcosteffective‏ ‎‡A Community health workers to improve adherence to anti-seizure medication in rural South Africa: Is it cost-effective?‏ ‎‡9 1‏
919 ‎‡a communityperceptionsofdevelopmentalandbehavioralproblemsexperiencedbychildrenlivingwithepilepsyonthekenyancoastaqualitativestudy‏ ‎‡A Community perceptions of developmental and behavioral problems experienced by children living with epilepsy on the Kenyan coast: A qualitative study‏ ‎‡9 1‏
919 ‎‡a comparisonofaxillaryrectalandtympanictemperaturemeasurementsinchildrenadmittedwithmalaria‏ ‎‡A Comparison of axillary, rectal and tympanic temperature measurements in children admitted with malaria‏ ‎‡9 1‏
919 ‎‡a computerizedtomographyscanofthebraininacommunitystudyofneurologicalimpairmentinkenya‏ ‎‡A Computerized tomography scan of the brain in a community study of neurological impairment in Kenya.‏ ‎‡9 1‏
919 ‎‡a congenitalandneonatalmalariainaruralkenyandistricthospitalan8yearanalysis‏ ‎‡A Congenital and neonatal malaria in a rural Kenyan district hospital: an eight-year analysis‏ ‎‡9 1‏
919 ‎‡a congenitalmicrocephalyunrelatedtoflavivirusexposureincoastalkenya‏ ‎‡A Congenital microcephaly unrelated to flavivirus exposure in coastal Kenya‏ ‎‡9 1‏
919 ‎‡a continuouseegmonitoringinkenyanchildrenwithnontraumaticcoma‏ ‎‡A Continuous EEG monitoring in Kenyan children with non-traumatic coma‏ ‎‡9 1‏
919 ‎‡a cysticercosisandepilepsyinruraltanzaniaacommunitybasedcasecontrolandimagingstudy‏ ‎‡A Cysticercosis and epilepsy in rural Tanzania: a community-based case-control and imaging study‏ ‎‡9 1‏
919 ‎‡a determinationoflorazepaminplasmafromchildrenbyhighperformanceliquidchromatographywithuvdetection‏ ‎‡A Determination of lorazepam in plasma from children by high-performance liquid chromatography with UV detection‏ ‎‡9 1‏
919 ‎‡a determinationofmidazolamanditsmajormetabolite1hydroxymidazolambyhighperformanceliquidchromatographyelectrospraymassspectrometryinplasmafromchildren‏ ‎‡A Determination of midazolam and its major metabolite 1'-hydroxymidazolam by high-performance liquid chromatography-electrospray mass spectrometry in plasma from children‏ ‎‡9 1‏
919 ‎‡a determinationofparaldehydebygaschromatographyinwholebloodfromchildren‏ ‎‡A Determination of paraldehyde by gas chromatography in whole blood from children‏ ‎‡9 1‏
919 ‎‡a developmentandvalidationofthekilifiepilepsybeliefsandattitudescale‏ ‎‡A Development and validation of the Kilifi Epilepsy Beliefs and Attitude Scale‏ ‎‡9 1‏
919 ‎‡a developmentandvalidationofthekilifistigmascaleforepilepsyinkenya‏ ‎‡A Development and validation of the Kilifi Stigma Scale for Epilepsy in Kenya‏ ‎‡9 1‏
919 ‎‡a developmentalimpairmentsfollowingseverefalciparummalariainchildren‏ ‎‡A Developmental impairments following severe falciparum malaria in children‏ ‎‡9 1‏
919 ‎‡a developmentalinventoriesusingilliterateparentsasinformantscommunicativedevelopmentinventory401adaptationfor2kenyanlanguages‏ ‎‡A Developmental inventories using illiterate parents as informants: Communicative Development Inventory (CDI) adaptation for two Kenyan languages‏ ‎‡9 1‏
919 ‎‡a diagnosisandmanagementoftheneurologicalcomplicationsoffalciparummalaria‏ ‎‡A Diagnosis and management of the neurological complications of falciparum malaria‏ ‎‡9 1‏
919 ‎‡a diagnosisofacutebacterialmeningitisinchildrenatadistricthospitalinsubsaharanafrica‏ ‎‡A Diagnosis of acute bacterial meningitis in children at a district hospital in sub-Saharan Africa.‏ ‎‡9 1‏
919 ‎‡a dohelminthscauseepilepsy‏ ‎‡A Do helminths cause epilepsy?‏ ‎‡9 1‏
919 ‎‡a earlyproductionofthepassivein2easternbantulanguages‏ ‎‡A Early production of the passive in two Eastern Bantu languages‏ ‎‡9 1‏
919 ‎‡a effectofafallinmalariatransmissiononmorbidityandmortalityinkilifikenya‏ ‎‡A Effect of a fall in malaria transmission on morbidity and mortality in Kilifi, Kenya‏ ‎‡9 1‏
919 ‎‡a electroencephalographicfeaturesofconvulsiveepilepsyinafricaamulticentrestudyofprevalencepatternandassociatedfactors‏ ‎‡A Electroencephalographic features of convulsive epilepsy in Africa: A multicentre study of prevalence, pattern and associated factors‏ ‎‡9 1‏
919 ‎‡a emergencytriageassessmentforhypoxaemiainneonatesandyoungchildreninakenyanhospitalanobservationalstudy‏ ‎‡A Emergency triage assessment for hypoxaemia in neonates and young children in a Kenyan hospital: an observational study.‏ ‎‡9 1‏
919 ‎‡a epidemiologycausesandtreatmentofepilepsyinsubsaharanafrica‏ ‎‡A Epidemiology, causes, and treatment of epilepsy in sub-Saharan Africa‏ ‎‡9 1‏
919 ‎‡a epilepsyinpoorregionsoftheworld‏ ‎‡A Epilepsy in poor regions of the world‏ ‎‡9 1‏
919 ‎‡a epilepsyisubiquitousbutmoredevastatinginthepoorerregionsoftheworldorisit‏ ‎‡A Epilepsy is ubiquitous, but more devastating in the poorer regions of the world... or is it?‏ ‎‡9 1‏
919 ‎‡a epilepticseizuresandmalariainkenyanchildren‏ ‎‡A Epileptic seizures and malaria in Kenyan children‏ ‎‡9 1‏
919 ‎‡a estimationoftheburdenofactiveandlifetimeepilepsyametaanalyticapproach‏ ‎‡A Estimation of the burden of active and life-time epilepsy: a meta-analytic approach‏ ‎‡9 1‏
919 ‎‡a evaluationofkilifiepilepsyeducationprogrammearandomizedcontrolledtrial‏ ‎‡A Evaluation of Kilifi epilepsy education programme: a randomized controlled trial‏ ‎‡9 1‏
919 ‎‡a excesschildmortalityafterdischargefromhospitalinkilifikenyaaretrospectivecohortanalysis‏ ‎‡A Excess child mortality after discharge from hospital in Kilifi, Kenya: a retrospective cohort analysis‏ ‎‡9 1‏
919 ‎‡a expandingaccesstomentalhealthcareamissingingredient‏ ‎‡A Expanding access to mental health care: a missing ingredient.‏ ‎‡9 1‏
919 ‎‡a exposuretomultipleparasitesisassociatedwiththeprevalenceofactiveconvulsiveepilepsyinsubsaharanafrica‏ ‎‡A Exposure to multiple parasites is associated with the prevalence of active convulsive epilepsy in sub-Saharan Africa‏ ‎‡9 1‏
919 ‎‡a falciparummalariainchildren‏ ‎‡A Falciparum malaria in children‏ ‎‡9 1‏
919 ‎‡a fetalhemoglobinisassociatedwithperipheraloxygensaturationinsicklecelldiseaseintanzania‏ ‎‡A Fetal Hemoglobin is Associated with Peripheral Oxygen Saturation in Sickle Cell Disease in Tanzania‏ ‎‡9 1‏
919 ‎‡a fosphenytoinforseizurepreventioninchildhoodcomainafricaarandomizedclinicaltrial‏ ‎‡A Fosphenytoin for seizure prevention in childhood coma in Africa: a randomized clinical trial‏ ‎‡9 1‏
919 ‎‡a fractionofallhospitaladmissionsanddeathsattributabletomalnutritionamongchildreninruralkenya‏ ‎‡A Fraction of all hospital admissions and deaths attributable to malnutrition among children in rural Kenya‏ ‎‡9 1‏
919 ‎‡a geneticsoffetalhemoglobinintanzanianandbritishpatientswithsicklecellanemia‏ ‎‡A Genetics of fetal hemoglobin in Tanzanian and British patients with sickle cell anemia‏ ‎‡9 1‏
919 ‎‡a genomewideanalysisofthehostresponsetomalariainkenyanchildren‏ ‎‡A Genomewide analysis of the host response to malaria in Kenyan children‏ ‎‡9 1‏
919 ‎‡a globalargininebioavailabilityintanzaniansicklecellanaemiapatientsatsteadystateanestedcasecontrolstudyofdeathsversussurvivors‏ ‎‡A Global arginine bioavailability in Tanzanian sickle cell anaemia patients at steady-state: a nested case control study of deaths versus survivors‏ ‎‡9 1‏
919 ‎‡a globalproteomicanalysisofplasmafrommiceinfectedwithplasmodiumbergheiankausing2dimensionalgelelectrophoresisandmatrixassistedlaserdesorptionionizationtimeofflightmassspectrometry‏ ‎‡A Global proteomic analysis of plasma from mice infected with Plasmodium berghei ANKA using two dimensional gel electrophoresis and matrix assisted laser desorption ionization-time of flight mass spectrometry.‏ ‎‡9 1‏
919 ‎‡a growthparametersandchildhoodepilepsyinhaidistricttanzaniaacommunitybasedstudy‏ ‎‡A Growth parameters and childhood epilepsy in Hai District, Tanzania: a community-based study‏ ‎‡9 1‏
919 ‎‡a haptoglobin Alpha thalassaemiaandglucose6phosphatedehydrogenasepolymorphismsandriskofabnormaltranscranialdoppleramongpatientswithsicklecellanaemiaintanzania‏ ‎‡A Haptoglobin, Alpha -thalassaemia and glucose-6-phosphate dehydrogenase polymorphisms and risk of abnormal transcranial Doppler among patients with sickle cell anaemia in Tanzania.‏ ‎‡9 1‏
919 ‎‡a haptoglobinhp22genotype Alpha thalassaemiaandacuteseizuresinchildrenlivinginamalariaendemicarea‏ ‎‡A Haptoglobin HP2-2 genotype, Alpha -thalassaemia and acute seizures in children living in a malaria-endemic area.‏ ‎‡9 1‏
919 ‎‡a healthriskbehavioramongperinatallyhivexposeduninfectedadolescentsasystematicreview‏ ‎‡A Health risk behavior among perinatally HIV exposed uninfected adolescents: A systematic review‏ ‎‡9 1‏
919 ‎‡a healthriskbehaviouramongadolescentslivingwithhivinsubsaharanafricaasystematicreviewandmetaanalysis‏ ‎‡A Health Risk Behaviour among Adolescents Living with HIV in Sub-Saharan Africa: A Systematic Review and Meta-Analysis‏ ‎‡9 1‏
919 ‎‡a hematologicalandgeneticpredictorsofdaytimehemoglobinsaturationintanzanianchildrenwithandwithoutsicklecellanemia‏ ‎‡A Hematological and Genetic Predictors of Daytime Hemoglobin Saturation in Tanzanian Children with and without Sickle Cell Anemia‏ ‎‡9 1‏
919 ‎‡a highlevelsoferythropoietinareassociatedwithprotectionagainstneurologicalsequelaeinafricanchildrenwithcerebralmalaria‏ ‎‡A High levels of erythropoietin are associated with protection against neurological sequelae in African children with cerebral malaria.‏ ‎‡9 1‏
919 ‎‡a homozygosityandriskofchildhooddeathduetoinvasivebacterialdisease‏ ‎‡A Homozygosity and risk of childhood death due to invasive bacterial disease‏ ‎‡9 1‏
919 ‎‡a hypokalemiainchildrenwithseverefalciparummalaria‏ ‎‡A Hypokalemia in children with severe falciparum malaria‏ ‎‡9 1‏
919 ‎‡a identificationofpeoplewithdisabilitiesusingparticipatoryruralappraisalandkeyinformantsapragmaticapproachwithactionpotentialpromotingvalidityandlowcost‏ ‎‡A Identification of people with disabilities using participatory rural appraisal and key informants: a pragmatic approach with action potential promoting validity and low cost‏ ‎‡9 1‏
919 ‎‡a identifyingchildrenwithneurologicalimpairmentanddisabilityinresourcepoorcountries‏ ‎‡A Identifying children with neurological impairment and disability in resource-poor countries.‏ ‎‡9 1‏
919 ‎‡a impairedeverydaymemoryassociatedwithencephalopathyofseveremalariatheroleofseizuresandhippocampaldamage‏ ‎‡A Impaired everyday memory associated with encephalopathy of severe malaria: the role of seizures and hippocampal damage‏ ‎‡9 1‏
919 ‎‡a impairmentofexecutivefunctioninkenyanchildrenexposedtoseverefalciparummalariawithneurologicalinvolvement‏ ‎‡A Impairment of executive function in Kenyan children exposed to severe falciparum malaria with neurological involvement‏ ‎‡9 1‏
919 ‎‡a incidenceandoutcomeofconvulsivestatusepilepticusinkenyanchildrenacohortstudy‏ ‎‡A Incidence and outcome of convulsive status epilepticus in Kenyan children: a cohort study‏ ‎‡9 1‏
919 ‎‡a incidenceandriskfactorsforneonataltetanusinadmissionstokilificountyhospitalkenya‏ ‎‡A Incidence and risk factors for neonatal tetanus in admissions to Kilifi County Hospital, Kenya.‏ ‎‡9 1‏
919 ‎‡a incidencecausesandphenotypesofacuteseizuresinkenyanchildrenpostthemalariadeclineperiod‏ ‎‡A Incidence, causes and phenotypes of acute seizures in Kenyan children post the malaria-decline period‏ ‎‡9 1‏
919 ‎‡a incidenceofconvulsiveepilepsyinaruralareainkenya‏ ‎‡A Incidence of convulsive epilepsy in a rural area in Kenya‏ ‎‡9 1‏
919 ‎‡a incidenceofepilepsyasystematicreviewandmetaanalysis‏ ‎‡A Incidence of epilepsy: a systematic review and meta-analysis.‏ ‎‡9 1‏
919 ‎‡a incidenceremissionandmortalityofconvulsiveepilepsyinruralnortheastsouthafrica‏ ‎‡A Incidence, Remission and Mortality of Convulsive Epilepsy in Rural Northeast South Africa‏ ‎‡9 1‏
919 ‎‡a increasedprevalenceofepilepsyassociatedwithseverefalciparummalariainchildren‏ ‎‡A Increased prevalence of epilepsy associated with severe falciparum malaria in children‏ ‎‡9 1‏
919 ‎‡a indicatorsofacutebacterialmeningitisinchildrenataruralkenyandistricthospital‏ ‎‡A Indicators of acute bacterial meningitis in children at a rural Kenyan district hospital‏ ‎‡9 1‏
919 ‎‡a indicatorsoflifethreateningmalariainafricanchildren‏ ‎‡A Indicators of life-threatening malaria in African children‏ ‎‡9 1‏
919 ‎‡a interactionbetweenplasmodiumfalciparumandhumanimmunodeficiencyvirustype1onthecentralnervoussystemofafricanchildren‏ ‎‡A Interaction between Plasmodium falciparum and human immunodeficiency virus type 1 on the central nervous system of African children.‏ ‎‡9 1‏
919 ‎‡a intracranialpressureinafricanchildrenwithcerebralmalaria‏ ‎‡A Intracranial pressure in African children with cerebral malaria‏ ‎‡9 1‏
919 ‎‡a investigatingtheevidenceofbehavioralcognitiveandpsychiatricendophenotypesinautismasystematicreview‏ ‎‡A Investigating the Evidence of Behavioral, Cognitive, and Psychiatric Endophenotypes in Autism: A Systematic Review‏ ‎‡9 1‏
919 ‎‡a investigationofpracticestosupportthecomplexcommunicationneedsofchildrenwithhearingimpairmentandcerebralpalsyinaruraldistrictofkenyaacaseseries‏ ‎‡A Investigation of practices to support the complex communication needs of children with hearing impairment and cerebral palsy in a rural district of Kenya: a case series‏ ‎‡9 1‏
919 ‎‡a irondeficiencyandacuteseizuresresultsfromchildrenlivinginruralkenyaandametaanalysis‏ ‎‡A Iron deficiency and acute seizures: results from children living in rural Kenya and a meta-analysis‏ ‎‡9 1‏
919 ‎‡a lackofassociationofinterferonregulatoryfactor1withseveremalariainaffectedchildparentaltriostudiesacross3africanpopulations‏ ‎‡A Lack of association of interferon regulatory factor 1 with severe malaria in affected child-parental trio studies across three African populations‏ ‎‡9 1‏
919 ‎‡a lifethreateninghyponatraemiaandneurotoxicityduringchemotherapyforburkittslymphoma‏ ‎‡A Life-threatening hyponatraemia and neurotoxicity during chemotherapy for Burkitt's lymphoma.‏ ‎‡9 1‏
919 ‎‡a likelyhealthoutcomesforuntreatedacutefebrileillnessinthetropicsindecisionandeconomicmodelsadelphisurvey‏ ‎‡A Likely health outcomes for untreated acute febrile illness in the tropics in decision and economic models; a Delphi survey‏ ‎‡9 1‏
919 ‎‡a longtermneurodevelopmentaloutcomesafterintrauterineandneonatalinsultsasystematicreview‏ ‎‡A Long-term neurodevelopmental outcomes after intrauterine and neonatal insults: a systematic review‏ ‎‡9 1‏
919 ‎‡a longtermoutcomesofsurvivorsofneonatalinsultsasystematicreviewandmetaanalysis‏ ‎‡A Long-term outcomes of survivors of neonatal insults: A systematic review and meta-analysis‏ ‎‡9 1‏
919 ‎‡a malariainpatientswithsicklecellanemiaburdenriskfactorsandoutcomeattheoutpatientclinicandduringhospitalization‏ ‎‡A Malaria in patients with sickle cell anemia: burden, risk factors, and outcome at the outpatient clinic and during hospitalization‏ ‎‡9 1‏
919 ‎‡a maternalandneonataltetanus‏ ‎‡A Maternal and neonatal tetanus‏ ‎‡9 1‏
919 ‎‡a monitoringpsychomotordevelopmentinaresourcelimitedsettinganevaluationofthekilifidevelopmentalinventory‏ ‎‡A Monitoring psychomotor development in a resource-limited setting: an evaluation of the Kilifi Developmental Inventory.‏ ‎‡9 1‏
919 ‎‡a mortalityamongkenyanchildrenadmittedtoaruraldistricthospitalonweekendsascomparedwithweekdays‏ ‎‡A Mortality among Kenyan children admitted to a rural district hospital on weekends as compared with weekdays‏ ‎‡9 1‏
919 ‎‡a mortalityinsicklecellanemiainafricaaprospectivecohortstudyintanzania‏ ‎‡A Mortality in sickle cell anemia in Africa: a prospective cohort study in Tanzania‏ ‎‡9 1‏
919 ‎‡a neonataljaundiceanddevelopmentalimpairmentamonginfantsinkilifikenya‏ ‎‡A Neonatal jaundice and developmental impairment among infants in Kilifi, Kenya‏ ‎‡9 1‏
919 ‎‡a neonatalseizuresinaruralkenyandistricthospitalaetiologyincidenceandoutcomeofhospitalization‏ ‎‡A Neonatal seizures in a rural Kenyan District Hospital: aetiology, incidence and outcome of hospitalization.‏ ‎‡9 1‏
919 ‎‡a neonatalseverebacterialinfectionimpairmentestimatesinsouthasiasubsaharanafricaandlatinamericafor‏ ‎‡A Neonatal severe bacterial infection impairment estimates in South Asia, sub-Saharan Africa, and Latin America for 2010‏ ‎‡9 1‏
919 ‎‡a neurocognitiveimpairmentfollowingacquiredcentralnervoussysteminfectionsinchildhoodasystematicreview‏ ‎‡A Neuro-cognitive impairment following acquired central nervous system infections in childhood: a systematic review‏ ‎‡9 1‏
919 ‎‡a neurodevelopmentaldisordersinlowandmiddleincomecountries‏ ‎‡A Neurodevelopmental disorders in low- and middle-income countries‏ ‎‡9 1‏
919 ‎‡a neurologicalanddevelopmentaloutcomeofneonataljaundiceandsepsisinruralkenya‏ ‎‡A Neurological and developmental outcome of neonatal jaundice and sepsis in rural Kenya‏ ‎‡9 1‏
919 ‎‡a neurologicalaspectsoftropicaldisease‏ ‎‡A Neurological aspects of tropical disease‏ ‎‡9 1‏
919 ‎‡a neurologicalmanifestationsoffalciparummalaria‏ ‎‡A Neurological manifestations of falciparum malaria‏ ‎‡9 1‏
919 ‎‡a newclassificationofacutepapilledemainchildrenwithseveremalaria‏ ‎‡A New classification of acute papilledema in children with severe malaria.‏ ‎‡9 1‏
919 ‎‡a nocturnalhaemoglobinoxygendesaturationinurbanandruraleastafricanpaediatriccohortswithandwithoutsicklecellanaemiaacrosssectionalstudy‏ ‎‡A Nocturnal haemoglobin oxygen desaturation in urban and rural East African paediatric cohorts with and without sickle cell anaemia: a cross-sectional study‏ ‎‡9 1‏
919 ‎‡a nutritionalstatushospitalizationandmortalityamongpatientswithsicklecellanemiaintanzania‏ ‎‡A Nutritional status, hospitalization and mortality among patients with sickle cell anemia in Tanzania‏ ‎‡9 1‏
919 ‎‡a oxidativestressanderythrocytedamageinkenyanchildrenwithsevereplasmodiumfalciparummalaria‏ ‎‡A Oxidative stress and erythrocyte damage in Kenyan children with severe Plasmodium falciparum malaria.‏ ‎‡9 1‏
919 ‎‡a packagesofcareforepilepsyinlowandmiddleincomecountries‏ ‎‡A Packages of care for epilepsy in low- and middle-income countries‏ ‎‡9 1‏
919 ‎‡a paediatriccomascales‏ ‎‡A Paediatric coma scales.‏ ‎‡9 1‏
919 ‎‡a paediatricneurologyadvancesonmanyfronts‏ ‎‡A Paediatric neurology: advances on many fronts‏ ‎‡9 1‏
919 ‎‡a parasiticdisorders‏ ‎‡A Parasitic disorders‏ ‎‡9 1‏
919 ‎‡a parentsandprofessionalsperceptionsoncausesandtreatmentoptionsforautismspectrumdisordersasdinamulticulturalcontextonthekenyancoast‏ ‎‡A Parents' and professionals' perceptions on causes and treatment options for Autism Spectrum Disorders (ASD) in a multicultural context on the Kenyan Coast‏ ‎‡9 1‏
919 ‎‡a parvovirusb19infectionandsevereanaemiainkenyanchildrenaretrospectivecasecontrolstudy‏ ‎‡A Parvovirus B19 infection and severe anaemia in Kenyan children: a retrospective case control study‏ ‎‡9 1‏
919 ‎‡a patternsofneurobehavioralfunctioninginschoolagedsurvivorsofneonataljaundiceandhypoxicischemicencephalopathyinkilifikenyaacrosssectionalstudy‏ ‎‡A Patterns of neurobehavioral functioning in school-aged survivors of neonatal jaundice and hypoxic-ischemic encephalopathy in Kilifi, Kenya: A cross-sectional study‏ ‎‡9 1‏
919 ‎‡a periodicityandspacetimeclusteringofseverechildhoodmalariaonthecoastofkenya‏ ‎‡A Periodicity and space-time clustering of severe childhood malaria on the coast of Kenya‏ ‎‡9 1‏
919 ‎‡a persistentneurocognitiveimpairmentsassociatedwithseverefalciparummalariainkenyanchildren‏ ‎‡A Persistent neurocognitive impairments associated with severe falciparum malaria in Kenyan children.‏ ‎‡9 1‏
919 ‎‡a perturbationsinelectrolytelevelsinkenyanchildrenwithseveremalariacomplicatedbyacidosis‏ ‎‡A Perturbations in electrolyte levels in kenyan children with severe malaria complicated by acidosis‏ ‎‡9 1‏
919 ‎‡a perturbationsofcerebralhemodynamicsinkenyanswithcerebralmalaria‏ ‎‡A Perturbations of cerebral hemodynamics in Kenyans with cerebral malaria‏ ‎‡9 1‏
919 ‎‡a pharmacokineticsandanticonvulsanteffectsofdiazepaminchildrenwithseverefalciparummalariaandconvulsions‏ ‎‡A Pharmacokinetics and anticonvulsant effects of diazepam in children with severe falciparum malaria and convulsions.‏ ‎‡9 1‏
919 ‎‡a pharmacokineticsandclinicaleffectofphenobarbitalinchildrenwithseverefalciparummalariaandconvulsions‏ ‎‡A Pharmacokinetics and clinical effect of phenobarbital in children with severe falciparum malaria and convulsions.‏ ‎‡9 1‏
919 ‎‡a pharmacokineticsandclinicaleffectsofphenytoinandfosphenytoininchildrenwithseveremalariaandstatusepilepticus‏ ‎‡A Pharmacokinetics and clinical effects of phenytoin and fosphenytoin in children with severe malaria and status epilepticus.‏ ‎‡9 1‏
919 ‎‡a pharmacokineticsandclinicalefficacyoflorazepaminchildrenwithseveremalariaandconvulsions‏ ‎‡A Pharmacokinetics and clinical efficacy of lorazepam in children with severe malaria and convulsions.‏ ‎‡9 1‏
919 ‎‡a phase3trialsrequiredtoresolveclinicalequipoiseoveroptimalfluidmanagementinchildrenwithseveremalaria‏ ‎‡A Phase III trials required to resolve clinical equipoise over optimal fluid management in children with severe malaria‏ ‎‡9 1‏
919 ‎‡a plasmodiumfalciparumandthebrain‏ ‎‡A Plasmodium falciparum and the brain‏ ‎‡9 1‏
919 ‎‡a plasmodiumfalciparumvargeneexpressionismodifiedbyhostimmunity‏ ‎‡A Plasmodium falciparum var gene expression is modified by host immunity‏ ‎‡9 1‏
919 ‎‡a positiveselectionofacd36nonsensevariantinsubsaharanafricabutnoassociationwithseveremalariaphenotypes‏ ‎‡A Positive selection of a CD36 nonsense variant in sub-saharan Africa, but no association with severe malaria phenotypes‏ ‎‡9 1‏
919 ‎‡a pretransfusionmanagementofchildrenwithseveremalarialanaemiaarandomisedcontrolledtrialofintravascularvolumeexpansion‏ ‎‡A Pre-transfusion management of children with severe malarial anaemia: a randomised controlled trial of intravascular volume expansion‏ ‎‡9 1‏
919 ‎‡a prematuremortalityinactiveconvulsiveepilepsyinruralkenyacausesandassociatedfactors‏ ‎‡A Premature mortality in active convulsive epilepsy in rural Kenya: causes and associated factors‏ ‎‡9 1‏
919 ‎‡a prematuremortalityinepilepsyandtheroleofpsychiatriccomorbidityatotalpopulationstudy‏ ‎‡A Premature mortality in epilepsy and the role of psychiatric comorbidity: a total population study‏ ‎‡9 1‏
919 ‎‡a prevalenceandriskfactorsforactiveconvulsiveepilepsyinruralnortheastsouthafrica‏ ‎‡A Prevalence and risk factors for active convulsive epilepsy in rural northeast South Africa‏ ‎‡9 1‏
919 ‎‡a prevalenceandriskfactorsofneurologicaldisabilityandimpairmentinchildrenlivinginruralkenya‏ ‎‡A Prevalence and risk factors of neurological disability and impairment in children living in rural Kenya‏ ‎‡9 1‏
919 ‎‡a prevalenceofactiveconvulsiveepilepsyinsubsaharanafricaandassociatedriskfactorscrosssectionalandcasecontrolstudies‏ ‎‡A Prevalence of active convulsive epilepsy in sub-Saharan Africa and associated risk factors: cross-sectional and case-control studies‏ ‎‡9 1‏
919 ‎‡a prognosticindicatorsoflifethreateningmalariaareassociatedwithdistinctparasitevariantantigenprofiles‏ ‎‡A Prognostic indicators of life-threatening malaria are associated with distinct parasite variant antigen profiles‏ ‎‡9 1‏
919 ‎‡a prognosticvalueofcirculatingpigmentedcellsinafricanchildrenwithmalaria‏ ‎‡A Prognostic value of circulating pigmented cells in African children with malaria‏ ‎‡9 1‏
919 ‎‡a psychometricevaluationofthemajordepressioninventoryamongyoungpeoplelivingincoastalkenya‏ ‎‡A Psychometric evaluation of the Major Depression Inventory among young people living in Coastal Kenya‏ ‎‡9 1‏
919 ‎‡a randomizedtrialofvolumeexpansionwithalbuminorsalineinchildrenwithseveremalariapreliminaryevidenceofalbuminbenefit‏ ‎‡A Randomized trial of volume expansion with albumin or saline in children with severe malaria: preliminary evidence of albumin benefit‏ ‎‡9 1‏
919 ‎‡a readytousefoodsupplementwithorwithoutarginineandcitrullinewithdailychloroquineintanzanianchildrenwithsicklecelldiseaseadoubleblindrandomordercrossovertrial‏ ‎‡A Ready-to-use food supplement, with or without arginine and citrulline, with daily chloroquine in Tanzanian children with sickle-cell disease: a double-blind, random order crossover trial.‏ ‎‡9 1‏
919 ‎‡a researchandopenaccessfromlowandmiddleincomecountries‏ ‎‡A Research and open access from low- and middle-income countries‏ ‎‡9 1‏
919 ‎‡a responsetodiazepaminchildrenwithmalariainducedseizures‏ ‎‡A Response to diazepam in children with malaria-induced seizures.‏ ‎‡9 1‏
919 ‎‡a responsetovolumeresuscitationinchildrenwithseveremalaria‏ ‎‡A Response to volume resuscitation in children with severe malaria‏ ‎‡9 1‏
919 ‎‡a retinopathyhistidinerichprotein2andperfusionpressureincerebralmalaria‏ ‎‡A Retinopathy, histidine-rich protein-2 and perfusion pressure in cerebral malaria‏ ‎‡9 1‏
919 ‎‡a reviewarticlebloodbrainbarrierinfalciparummalaria‏ ‎‡A Review Article: blood-brain barrier in falciparum malaria.‏ ‎‡9 1‏
919 ‎‡a riskfactorsassociatedwiththeepilepsytreatmentgapinkilifikenyaacrosssectionalstudy‏ ‎‡A Risk factors associated with the epilepsy treatment gap in Kilifi, Kenya: a cross-sectional study‏ ‎‡9 1‏
919 ‎‡a riskfactorsforhighcerebralbloodflowvelocityanddeathinkenyanchildrenwithsicklecellanaemiaroleofhaemoglobinoxygensaturationandfebrileillness‏ ‎‡A Risk factors for high cerebral blood flow velocity and death in Kenyan children with Sickle Cell Anaemia: role of haemoglobin oxygen saturation and febrile illness‏ ‎‡9 1‏
919 ‎‡a riskfactorsforpersistingneurologicalandcognitiveimpairmentsfollowingcerebralmalaria‏ ‎‡A Risk factors for persisting neurological and cognitive impairments following cerebral malaria.‏ ‎‡9 1‏
919 ‎‡a 2assessmentofneuroaidsinafrica‏ ‎‡A Second assessment of NeuroAIDS in Africa‏ ‎‡9 1‏
919 ‎‡a seizuredisordersamongrelativesofkenyanchildrenwithseverefalciparummalaria‏ ‎‡A Seizure disorders among relatives of Kenyan children with severe falciparum malaria‏ ‎‡9 1‏
919 ‎‡a seizuresin204comatosechildrenincidenceandoutcome‏ ‎‡A Seizures in 204 comatose children: incidence and outcome‏ ‎‡9 1‏
919 ‎‡a serumtumournecrosisfactorinchildrensufferingfromplasmodiumfalciparuminfectioninkilifidistrictkenya‏ ‎‡A Serum tumour necrosis factor in children suffering from Plasmodium falciparum infection in Kilifi District, Kenya‏ ‎‡9 1‏
919 ‎‡a severeanaemiainchildrenlivinginamalariaendemicareaofkenya‏ ‎‡A Severe anaemia in children living in a malaria endemic area of Kenya‏ ‎‡9 1‏
919 ‎‡a severefalciparummalariaandacquiredchildhoodlanguagedisorder‏ ‎‡A Severe falciparum malaria and acquired childhood language disorder‏ ‎‡9 1‏
919 ‎‡a severefalciparummalariainchildrencurrentunderstandingofpathophysiologyandsupportivetreatment‏ ‎‡A Severe falciparum malaria in children: current understanding of pathophysiology and supportive treatment‏ ‎‡9 1‏
919 ‎‡a socioculturaldeterminantsofhealthseekingbehaviouronthekenyancoastaqualitativestudy‏ ‎‡A Socio-cultural determinants of health-seeking behaviour on the Kenyan coast: a qualitative study‏ ‎‡9 1‏
919 ‎‡a socioeconomicstatusanthropometricstatusandpsychomotordevelopmentofkenyanchildrenfromresourcelimitedsettingsapathanalyticstudy‏ ‎‡A Socioeconomic status, anthropometric status, and psychomotor development of Kenyan children from resource-limited settings: a path-analytic study‏ ‎‡9 1‏
919 ‎‡a speechandlanguagedisordersinkenyanchildrenadaptingtoolsforregionswithfewassessmentresources‏ ‎‡A Speech and Language Disorders in Kenyan Children: Adapting Tools for Regions with Few Assessment Resources‏ ‎‡9 1‏
919 ‎‡a speechandlanguagesequelaeofseveremalariainkenyanchildren‏ ‎‡A Speech and language sequelae of severe malaria in Kenyan children‏ ‎‡9 1‏
919 ‎‡a standardizeddatacollectionformulticenterclinicalstudiesofseveremalariainafricanchildrenestablishingthesmacnetwork‏ ‎‡A Standardized data collection for multi-center clinical studies of severe malaria in African children: establishing the SMAC network‏ ‎‡9 1‏
919 ‎‡a standardsforepidemiologicstudiesandsurveillanceofepilepsy‏ ‎‡A Standards for epidemiologic studies and surveillance of epilepsy‏ ‎‡9 1‏
919 ‎‡a statusepilepticusinresourcepoorcountries‏ ‎‡A Status epilepticus in resource-poor countries‏ ‎‡9 1‏
919 ‎‡a statusepilepticusinsubsaharanafricanewfindings‏ ‎‡A Status epilepticus in sub-Saharan Africa: New findings.‏ ‎‡9 1‏
919 ‎‡a surveyofrehabilitationsupportforchildren015yearsinaruralpartofkenya‏ ‎‡A Survey of rehabilitation support for children 0-15 years in a rural part of Kenya‏ ‎‡9 1‏
919 ‎‡a challengesandinnovationsfortherapyinchildrenwithepilepsy‏ ‎‡A The challenges and innovations for therapy in children with epilepsy.‏ ‎‡9 1‏
919 ‎‡a challengesofmanagingchildrenwithepilepsyinafrica‏ ‎‡A The challenges of managing children with epilepsy in Africa‏ ‎‡9 1‏
919 ‎‡a continuingroleoficnainafricahowtotackleautism‏ ‎‡A The continuing role of ICNA in Africa: how to tackle autism?‏ ‎‡9 1‏
919 ‎‡a dispositionofintramuscularartemetherinchildrenwithcerebralmalariaapreliminarystudy‏ ‎‡A The disposition of intramuscular artemether in children with cerebral malaria; a preliminary study‏ ‎‡9 1‏
919 ‎‡a effectofplasmodiumfalciparumoncognitionasystematicreview‏ ‎‡A The effect ofPlasmodium falciparumon cognition: a systematic review‏ ‎‡9 1‏
919 ‎‡a epilepsytreatmentgapindevelopingcountriesasystematicreviewofthemagnitudecausesandinterventionstrategies‏ ‎‡A The epilepsy treatment gap in developing countries: a systematic review of the magnitude, causes, and intervention strategies‏ ‎‡9 1‏
919 ‎‡a incidenceaetiologyandoutcomeofacuteseizuresinchildrenadmittedtoaruralkenyandistricthospital‏ ‎‡A The incidence, aetiology and outcome of acute seizures in children admitted to a rural Kenyan district hospital‏ ‎‡9 1‏
919 ‎‡a intergrowth21stprojectneurodevelopmentpackageanovelmethodforthemultidimensionalassessmentofneurodevelopmentinpreschoolagechildren‏ ‎‡A The INTERGROWTH-21st Project Neurodevelopment Package: a novel method for the multi-dimensional assessment of neurodevelopment in pre-school age children‏ ‎‡9 1‏
919 ‎‡a lambareneorgandysfunctionscore‏ ‎‡A The Lambaréné Organ Dysfunction Score‏ ‎‡9 1‏
919 ‎‡a lambareneorgandysfunctionscorelodsisasimpleclinicalpredictoroffatalmalariainafricanchildren‏ ‎‡A The Lambaréné Organ Dysfunction Score (LODS) is a simple clinical predictor of fatal malaria in African children‏ ‎‡9 1‏
919 ‎‡a primarypreventionofepilepsyareportofthepreventiontaskforceoftheinternationalleagueagainstepilepsy‏ ‎‡A The primary prevention of epilepsy: A report of the Prevention Task Force of the International League Against Epilepsy.‏ ‎‡9 1‏
919 ‎‡a roleforosmoticagentsinchildrenwithacuteencephalopathiesasystematicreview‏ ‎‡A The role for osmotic agents in children with acute encephalopathies: a systematic review‏ ‎‡9 1‏
919 ‎‡a roleoficnainafrica‏ ‎‡A The role of ICNA in Africa‏ ‎‡9 1‏
919 ‎‡a roleofsequentialadministrationofsulphadoxinepyrimethaminefollowingquinineinthetreatmentofseverefalciparummalariainchildren‏ ‎‡A The role of sequential administration of sulphadoxine/pyrimethamine following quinine in the treatment of severe falciparum malaria in children‏ ‎‡9 1‏
919 ‎‡a roleofweightforageanddiseasestageinpoorpsychomotoroutcomeofhivinfectedchildreninkilifikenya‏ ‎‡A The role of weight for age and disease stage in poor psychomotor outcome of HIV-infected children in Kilifi, Kenya‏ ‎‡9 1‏
919 ‎‡a tympanicmembranedisplacementanalyserformonitoringintracranialpressureinchildren‏ ‎‡A The tympanic membrane displacement analyser for monitoring intracranial pressure in children‏ ‎‡9 1‏
919 ‎‡a validationofa3stagescreeningmethodologyfordetectingactiveconvulsiveepilepsyinpopulationbasedstudiesinhealthanddemographicsurveillancesystems‏ ‎‡A The validation of a three-stage screening methodology for detecting active convulsive epilepsy in population-based studies in health and demographic surveillance systems‏ ‎‡9 1‏
919 ‎‡a towardsoptimalregimensofparenteralquinineforyoungafricanchildrenwithcerebralmalariatheimportanceofunboundquinineconcentration‏ ‎‡A Towards optimal regimens of parenteral quinine for young African children with cerebral malaria: the importance of unbound quinine concentration‏ ‎‡9 1‏
919 ‎‡a traditionalhealersandepilepsytreatmentonthekenyancoast‏ ‎‡A Traditional healers and epilepsy treatment on the Kenyan coast‏ ‎‡9 1‏
919 ‎‡a tricuspidregurgitantjetvelocityandhospitalizationintanzanianchildrenwithsicklecellanemia‏ ‎‡A Tricuspid regurgitant jet velocity and hospitalization in Tanzanian children with sickle cell anemia‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2010‏ ‎‡9 10‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 LC|nb2011027665
996 ‎‡2 SUDOC|243026188
996 ‎‡2 NUKAT|n 2009122814
996 ‎‡2 SUDOC|162366736
996 ‎‡2 NII|DA13682763
996 ‎‡2 BIBSYS|90745898
996 ‎‡2 RERO|A003638038
996 ‎‡2 ISNI|0000000048891712
996 ‎‡2 NII|DA10864312
996 ‎‡2 BIBSYS|3052227
996 ‎‡2 LC|nb2014015489
996 ‎‡2 BIBSYS|90525038
996 ‎‡2 NTA|070126119
996 ‎‡2 RERO|A022770272
996 ‎‡2 J9U|987007373542505171
996 ‎‡2 JPG|500184993
996 ‎‡2 ISNI|0000000084530180
996 ‎‡2 LC|nr 93028508
996 ‎‡2 PTBNP|945672
996 ‎‡2 J9U|987007321019805171
996 ‎‡2 NII|DA00813665
996 ‎‡2 BIBSYS|8031359
996 ‎‡2 LC|n 2001088709
996 ‎‡2 LC|n 2010022669
996 ‎‡2 LC|no2012116780
996 ‎‡2 BNF|12322404
996 ‎‡2 BNF|14472365
996 ‎‡2 NDL|00904363
996 ‎‡2 PLWABN|9810682419605606
996 ‎‡2 ISNI|0000000075164107
996 ‎‡2 DNB|1055205136
996 ‎‡2 ISNI|0000000112805883
996 ‎‡2 ISNI|0000000071559507
996 ‎‡2 BIBSYS|90094860
996 ‎‡2 LC|nr 95023779
996 ‎‡2 JPG|500323179
996 ‎‡2 LC|n 81031761
996 ‎‡2 DNB|119138026
996 ‎‡2 JPG|500125554
996 ‎‡2 DNB|173559867
996 ‎‡2 LC|n 90602027
996 ‎‡2 SUDOC|19922143X
996 ‎‡2 CAOONL|ncf12120913
996 ‎‡2 BIBSYS|90067514
996 ‎‡2 BIBSYS|90732262
996 ‎‡2 ISNI|0000000364937794
996 ‎‡2 PTBNP|94314
996 ‎‡2 DNB|139503552
996 ‎‡2 NUKAT|n 2011076124
996 ‎‡2 BAV|495_105804
996 ‎‡2 J9U|987009347716505171
996 ‎‡2 SUDOC|175374570
996 ‎‡2 ISNI|0000000067324836
996 ‎‡2 SUDOC|032135491
996 ‎‡2 LC|nr 95042702
996 ‎‡2 NII|DA08525937
996 ‎‡2 BNF|14918626
996 ‎‡2 ISNI|0000000114946129
996 ‎‡2 LC|no2003051310
996 ‎‡2 SUDOC|125299745
996 ‎‡2 LC|n 83004766
996 ‎‡2 BIBSYS|3036999
996 ‎‡2 LC|nr 97028135
996 ‎‡2 LC|nr 93028510
996 ‎‡2 ISNI|000000006708852X
996 ‎‡2 ISNI|0000000032333791
996 ‎‡2 LC|no 99033005
996 ‎‡2 SUDOC|143022806
996 ‎‡2 RERO|A025531166
996 ‎‡2 NTA|068709358
996 ‎‡2 LC|n 82008325
996 ‎‡2 LC|n 2002053666
996 ‎‡2 J9U|987007323344605171
996 ‎‡2 NTA|337638330
996 ‎‡2 LC|n 84151972
996 ‎‡2 ISNI|0000000117740863
996 ‎‡2 RERO|A003638040
996 ‎‡2 NUKAT|n 2009101158
996 ‎‡2 RERO|A018825977
996 ‎‡2 LC|no2023091683
996 ‎‡2 NKC|vse2008445734
996 ‎‡2 LC|no2020130200
996 ‎‡2 NLA|000035841750
996 ‎‡2 ISNI|000000002655538X
996 ‎‡2 NTA|138492352
996 ‎‡2 EGAXA|vtls001360846
996 ‎‡2 NII|DA13669299
996 ‎‡2 BIBSYS|90195674
996 ‎‡2 ISNI|0000000436452041
996 ‎‡2 ISNI|0000000042715056
996 ‎‡2 SUDOC|034098089
996 ‎‡2 BIBSYS|6064046
996 ‎‡2 NSK|000545519
996 ‎‡2 RERO|A013230182
996 ‎‡2 KRNLK|KAC200804028
996 ‎‡2 DNB|1056451890
996 ‎‡2 LC|n 84108274
996 ‎‡2 LC|n 82209503
996 ‎‡2 ISNI|0000000512525936
996 ‎‡2 NTA|329716573
996 ‎‡2 NLA|000036069229
996 ‎‡2 BIBSYS|90126503
996 ‎‡2 LC|n 2007026591
996 ‎‡2 ISNI|0000000052370936
996 ‎‡2 ISNI|0000000051156137
996 ‎‡2 NTA|317861778
996 ‎‡2 NUKAT|n 2007153473
996 ‎‡2 BNE|XX1141118
996 ‎‡2 ISNI|0000000384488316
996 ‎‡2 BAV|495_279734
996 ‎‡2 N6I|vtls000340527
996 ‎‡2 N6I|vtls001408762
996 ‎‡2 ISNI|0000000067637517
996 ‎‡2 ISNI|0000000036620640
996 ‎‡2 NTA|314916512
996 ‎‡2 SUDOC|123854040
996 ‎‡2 CAOONL|ncf10034926
996 ‎‡2 J9U|987007265933205171
996 ‎‡2 LC|no2007086299
996 ‎‡2 ISNI|0000000039776632
996 ‎‡2 NDL|00515232
996 ‎‡2 ISNI|0000000080761694
996 ‎‡2 DNB|1053322003
996 ‎‡2 PTBNP|1713705
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏
998 ‎‡a Newton, Charles R.‏ ‎‡2 SUDOC|179334972‏ ‎‡3 suggested‏ ‎‡3 title: (0.78, 'centralnervoussysteminfectionsinchildhood', 'neurocognitiveimpairmentfollowingacquiredcentralnervoussysteminfectionsinchildhoodasystematicreview')‏
998 ‎‡a Newton, Charles R.‏ ‎‡2 LC|no2014112947‏ ‎‡3 suggested‏ ‎‡3 title: (0.78, 'centralnervoussysteminfectionsinchildhood', 'neurocognitiveimpairmentfollowingacquiredcentralnervoussysteminfectionsinchildhoodasystematicreview')‏
998 ‎‡a Newton, Charles R.‏ ‎‡2 J9U|987007321019805171‏ ‎‡3 suggested‏