VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q37605455 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000035.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q37605455‏
024 ‎‡a 0000-0003-3343-2822‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q37605455‏
100 0 ‎‡a Antonio J Pérez-Pulido‏ ‎‡c investigador‏ ‎‡9 ast‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Antonio J Pérez-Pulido‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Antonio J Pérez-Pulido‏ ‎‡c investigador‏ ‎‡9 es‏
400 0 ‎‡a Antonio J. Pérez-Pulido‏ ‎‡c ricercatore‏ ‎‡9 it‏
400 0 ‎‡a Antonio J Pérez-Pulido‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
400 0 ‎‡a Antonio J Pérez-Pulido‏ ‎‡c investigador‏ ‎‡9 pt‏
670 ‎‡a Author's A biclustering algorithm for extracting bit-patterns from binary datasets‏
670 ‎‡a Author's AnABlast: a new in silico strategy for the genome-wide search of novel genes and fossil regions‏
670 ‎‡a Author's AnABlast: Re-searching for Protein-Coding Sequences in Genomic Regions‏
670 ‎‡a Author's Ancient evolutionary signals of protein-coding sequences allow the discovery of new genes in the Drosophila melanogaster genome‏
670 ‎‡a Author's Automated selection of homologs to track the evolutionary history of proteins‏
670 ‎‡a Author's Autophagic dysfunction in Papillon Lefèvre syndrome is restored by recombinant Cathepsin C treatment.‏
670 ‎‡a Author's Classification of protein motifs based on subcellular localization uncovers evolutionary relationships at both sequence and functional levels.‏
670 ‎‡a Author's CRISPR sequences are sometimes erroneously translated and can contaminate public databases with spurious proteins containing spaced repeats‏
670 ‎‡a Author's Draft Genome Sequences of Six Lactobacillus pentosus Strains Isolated from Brines of Traditionally Fermented Spanish-Style Green Table Olives.‏
670 ‎‡a Author's Gene annotation from scientific literature using mappings between keyword systems‏
670 ‎‡a Author's Genome editing in animals with minimal PAM CRISPR-Cas9 enzymes‏
670 ‎‡a Author's Genomic analysis of the nitrate-respiring Sphingopyxis granuli (formerly Sphingomonas macrogoltabida) strain TFA.‏
670 ‎‡a Author's Identification of O-mannosylated virulence factors in Ustilago maydis‏
670 ‎‡a Author's Insight into Potential Probiotic Markers Predicted in Lactobacillus pentosus MP-10 Genome Sequence‏
670 ‎‡a Author's Intelligent client for integrating bioinformatics services‏
670 ‎‡a Author's Interoperability with Moby 1.0--it's better than sharing your toothbrush!‏
670 ‎‡a Author's Isolation and genomic characterization of the ibuprofen-degrading bacterium Sphingomonas strain MPO218‏
670 ‎‡a Author's MOWServ: a web client for integration of bioinformatic resources.‏
670 ‎‡a Author's Mpg2 interacts and cooperates with Mpg1 to maintain yeast glycosylation.‏
670 ‎‡a Author's Multiple Genome Sequences of Lactobacillus pentosus Strains Isolated from Biofilms on the Skin of Fermented Green Table Olives‏
670 ‎‡a Author's Mutation in cytochrome b gene of mitochondrial DNA in a family with fibromyalgia is associated with NLRP3-inflammasome activation‏
670 ‎‡a Author's NLRP3 inflammasome inhibition by MCC950 in aged mice improves health via enhanced autophagy and PPARα activity‏
670 ‎‡a Author's NLRP3 inflammasome suppression improves longevity and prevents cardiac aging in male mice‏
670 ‎‡a Author's orthoFind Facilitates the Discovery of Homologous and Orthologous Proteins‏
670 ‎‡a Author's Pangenome of Acinetobacter baumannii uncovers two groups of genomes, one of them with genes involved in CRISPR/Cas defence systems associated with the absence of plasmids and exclusive genes for biofilm formation‏
670 ‎‡a Author's Pantothenate Rescues Iron Accumulation in Pantothenate Kinase-Associated Neurodegeneration Depending on the Type of Mutation‏
670 ‎‡a Author's PlantFuncSSR: Integrating First and Next Generation Transcriptomics for Mining of SSR-Functional Domains Markers‏
670 ‎‡a Author's Proteome-wide search for PP2A substrates in fission yeast.‏
670 ‎‡a Author's Reading the Evolution of Compartmentalization in the Ribosome Assembly Toolbox: The YRG Protein Family‏
670 ‎‡a Author's Semirna: searching for plant miRNAs using target sequences‏
670 ‎‡a Author's Sma3s: a three-step modular annotator for large sequence datasets‏
670 ‎‡a Author's Sma3s: A universal tool for easy functional annotation of proteomes and transcriptomes‏
670 ‎‡a Author's The HIV type 1 protease L10I minor mutation decreases replication capacity and confers resistance to protease inhibitors‏
670 ‎‡a Author's The transcriptional response to the olive fruit fly (Bactrocera oleae) reveals extended differences between tolerant and susceptible olive (Olea europaea L.) varieties‏
670 ‎‡a Author's Update on XplorMed: A web server for exploring scientific literature‏
670 ‎‡a Author's Virulence role of the outer membrane protein CarO in carbapenem-resistant <i>Acinetobacter baumannii</i>‏
670 ‎‡a Author's Yeast as a biosensor of detoxification: a tool for identifying new compounds that revert multidrug resistance.‏
909 ‎‡a (orcid) 0000000333432822‏ ‎‡9 1‏
919 ‎‡a biclusteringalgorithmforextractingbitpatternsfrombinarydatasets‏ ‎‡A A biclustering algorithm for extracting bit-patterns from binary datasets‏ ‎‡9 1‏
919 ‎‡a anablastanewinsilicostrategyforthegenomewidesearchofnovelgenesandfossilregions‏ ‎‡A AnABlast: a new in silico strategy for the genome-wide search of novel genes and fossil regions‏ ‎‡9 1‏
919 ‎‡a anablastresearchingforproteincodingsequencesingenomicregions‏ ‎‡A AnABlast: Re-searching for Protein-Coding Sequences in Genomic Regions‏ ‎‡9 1‏
919 ‎‡a ancientevolutionarysignalsofproteincodingsequencesallowthediscoveryofnewgenesinthedrosophilamelanogastergenome‏ ‎‡A Ancient evolutionary signals of protein-coding sequences allow the discovery of new genes in the Drosophila melanogaster genome‏ ‎‡9 1‏
919 ‎‡a automatedselectionofhomologstotracktheevolutionaryhistoryofproteins‏ ‎‡A Automated selection of homologs to track the evolutionary history of proteins‏ ‎‡9 1‏
919 ‎‡a autophagicdysfunctioninpapillonlefevresyndromeisrestoredbyrecombinantcathepsin100treatment‏ ‎‡A Autophagic dysfunction in Papillon Lefèvre syndrome is restored by recombinant Cathepsin C treatment.‏ ‎‡9 1‏
919 ‎‡a classificationofproteinmotifsbasedonsubcellularlocalizationuncoversevolutionaryrelationshipsatbothsequenceandfunctionallevels‏ ‎‡A Classification of protein motifs based on subcellular localization uncovers evolutionary relationships at both sequence and functional levels.‏ ‎‡9 1‏
919 ‎‡a crisprsequencesaresometimeserroneouslytranslatedandcancontaminatepublicdatabaseswithspuriousproteinscontainingspacedrepeats‏ ‎‡A CRISPR sequences are sometimes erroneously translated and can contaminate public databases with spurious proteins containing spaced repeats‏ ‎‡9 1‏
919 ‎‡a draftgenomesequencesof6lactobacilluspentosusstrainsisolatedfrombrinesoftraditionallyfermentedspanishstylegreentableolives‏ ‎‡A Draft Genome Sequences of Six Lactobacillus pentosus Strains Isolated from Brines of Traditionally Fermented Spanish-Style Green Table Olives.‏ ‎‡9 1‏
919 ‎‡a geneannotationfromscientificliteratureusingmappingsbetweenkeywordsystems‏ ‎‡A Gene annotation from scientific literature using mappings between keyword systems‏ ‎‡9 1‏
919 ‎‡a genomeeditinginanimalswithminimalpamcrisprcas9enzymes‏ ‎‡A Genome editing in animals with minimal PAM CRISPR-Cas9 enzymes‏ ‎‡9 1‏
919 ‎‡a genomicanalysisofthenitraterespiringsphingopyxisgranuliformerlysphingomonasmacrogoltabidastraintfa‏ ‎‡A Genomic analysis of the nitrate-respiring Sphingopyxis granuli (formerly Sphingomonas macrogoltabida) strain TFA.‏ ‎‡9 1‏
919 ‎‡a identificationofomannosylatedvirulencefactorsinustilagomaydis‏ ‎‡A Identification of O-mannosylated virulence factors in Ustilago maydis‏ ‎‡9 1‏
919 ‎‡a insightintopotentialprobioticmarkerspredictedinlactobacilluspentosusmp10genomesequence‏ ‎‡A Insight into Potential Probiotic Markers Predicted in Lactobacillus pentosus MP-10 Genome Sequence‏ ‎‡9 1‏
919 ‎‡a intelligentclientforintegratingbioinformaticsservices‏ ‎‡A Intelligent client for integrating bioinformatics services‏ ‎‡9 1‏
919 ‎‡a interoperabilitywithmoby10itsbetterthansharingyourtoothbrush‏ ‎‡A Interoperability with Moby 1.0--it's better than sharing your toothbrush!‏ ‎‡9 1‏
919 ‎‡a isolationandgenomiccharacterizationoftheibuprofendegradingbacteriumsphingomonasstrainmpo218‏ ‎‡A Isolation and genomic characterization of the ibuprofen-degrading bacterium Sphingomonas strain MPO218‏ ‎‡9 1‏
919 ‎‡a mowservawebclientforintegrationofbioinformaticresources‏ ‎‡A MOWServ: a web client for integration of bioinformatic resources.‏ ‎‡9 1‏
919 ‎‡a mpg2interactsandcooperateswithmpg1tomaintainyeastglycosylation‏ ‎‡A Mpg2 interacts and cooperates with Mpg1 to maintain yeast glycosylation.‏ ‎‡9 1‏
919 ‎‡a multiplegenomesequencesoflactobacilluspentosusstrainsisolatedfrombiofilmsontheskinoffermentedgreentableolives‏ ‎‡A Multiple Genome Sequences of Lactobacillus pentosus Strains Isolated from Biofilms on the Skin of Fermented Green Table Olives‏ ‎‡9 1‏
919 ‎‡a mutationincytochromebgeneofmitochondrialdnainafamilywithfibromyalgiaisassociatedwithnlrp3inflammasomeactivation‏ ‎‡A Mutation in cytochrome b gene of mitochondrial DNA in a family with fibromyalgia is associated with NLRP3-inflammasome activation‏ ‎‡9 1‏
919 ‎‡a nlrp3inflammasomeinhibitionbymcc950inagedmiceimproveshealthviaenhancedautophagyandpparαactivity‏ ‎‡A NLRP3 inflammasome inhibition by MCC950 in aged mice improves health via enhanced autophagy and PPARα activity‏ ‎‡9 1‏
919 ‎‡a nlrp3inflammasomesuppressionimproveslongevityandpreventscardiacaginginmalemice‏ ‎‡A NLRP3 inflammasome suppression improves longevity and prevents cardiac aging in male mice‏ ‎‡9 1‏
919 ‎‡a orthofindfacilitatesthediscoveryofhomologousandorthologousproteins‏ ‎‡A orthoFind Facilitates the Discovery of Homologous and Orthologous Proteins‏ ‎‡9 1‏
919 ‎‡a pangenomeofacinetobacterbaumanniiuncovers2groupsofgenomes1ofthemwithgenesinvolvedincrisprcasdefencesystemsassociatedwiththeabsenceofplasmidsandexclusivegenesforbiofilmformation‏ ‎‡A Pangenome of Acinetobacter baumannii uncovers two groups of genomes, one of them with genes involved in CRISPR/Cas defence systems associated with the absence of plasmids and exclusive genes for biofilm formation‏ ‎‡9 1‏
919 ‎‡a pantothenaterescuesironaccumulationinpantothenatekinaseassociatedneurodegenerationdependingonthetypeofmutation‏ ‎‡A Pantothenate Rescues Iron Accumulation in Pantothenate Kinase-Associated Neurodegeneration Depending on the Type of Mutation‏ ‎‡9 1‏
919 ‎‡a plantfuncssrintegrating1andnextgenerationtranscriptomicsforminingofssrfunctionaldomainsmarkers‏ ‎‡A PlantFuncSSR: Integrating First and Next Generation Transcriptomics for Mining of SSR-Functional Domains Markers‏ ‎‡9 1‏
919 ‎‡a proteomewidesearchforpp2asubstratesinfissionyeast‏ ‎‡A Proteome-wide search for PP2A substrates in fission yeast.‏ ‎‡9 1‏
919 ‎‡a readingtheevolutionofcompartmentalizationintheribosomeassemblytoolboxtheyrgproteinfamily‏ ‎‡A Reading the Evolution of Compartmentalization in the Ribosome Assembly Toolbox: The YRG Protein Family‏ ‎‡9 1‏
919 ‎‡a semirnasearchingforplantmirnasusingtargetsequences‏ ‎‡A Semirna: searching for plant miRNAs using target sequences‏ ‎‡9 1‏
919 ‎‡a sma3sa3stepmodularannotatorforlargesequencedatasets‏ ‎‡A Sma3s: a three-step modular annotator for large sequence datasets‏ ‎‡9 1‏
919 ‎‡a sma3sauniversaltoolforeasyfunctionalannotationofproteomesandtranscriptomes‏ ‎‡A Sma3s: A universal tool for easy functional annotation of proteomes and transcriptomes‏ ‎‡9 1‏
919 ‎‡a hivtype1proteasel10iminormutationdecreasesreplicationcapacityandconfersresistancetoproteaseinhibitors‏ ‎‡A The HIV type 1 protease L10I minor mutation decreases replication capacity and confers resistance to protease inhibitors‏ ‎‡9 1‏
919 ‎‡a transcriptionalresponsetotheolivefruitflybactroceraoleaerevealsextendeddifferencesbetweentolerantandsusceptibleoliveoleaeuropaea50varieties‏ ‎‡A The transcriptional response to the olive fruit fly (Bactrocera oleae) reveals extended differences between tolerant and susceptible olive (Olea europaea L.) varieties‏ ‎‡9 1‏
919 ‎‡a updateonxplormedawebserverforexploringscientificliterature‏ ‎‡A Update on XplorMed: A web server for exploring scientific literature‏ ‎‡9 1‏
919 ‎‡a virulenceroleoftheoutermembraneproteincaroincarbapenemresistant1acinetobacterbaumannii1‏ ‎‡A Virulence role of the outer membrane protein CarO in carbapenem-resistant <i>Acinetobacter baumannii</i>‏ ‎‡9 1‏
919 ‎‡a yeastasabiosensorofdetoxificationatoolforidentifyingnewcompoundsthatrevertmultidrugresistance‏ ‎‡A Yeast as a biosensor of detoxification: a tool for identifying new compounds that revert multidrug resistance.‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 LC|n 2007023821‏
996 ‎‡2 BNC|981058610633006706‏
996 ‎‡2 BIBSYS|4030044‏
996 ‎‡2 NKC|mub20241214355‏
996 ‎‡2 BNE|XX1320367‏
996 ‎‡2 BNE|XX4866613‏
996 ‎‡2 BNC|981058594881906706‏
996 ‎‡2 RERO|A008833646‏
996 ‎‡2 J9U|987012503059805171‏
996 ‎‡2 BNE|XX1110756‏
996 ‎‡2 BNF|17812799‏
996 ‎‡2 BNE|XX1044420‏
996 ‎‡2 DNB|119439077‏
996 ‎‡2 ISNI|0000000476404300‏
996 ‎‡2 BNC|981058514374106706‏
996 ‎‡2 BNE|XX1140241‏
996 ‎‡2 BNE|XX1432552‏
996 ‎‡2 BNC|981058514636006706‏
996 ‎‡2 BNE|XX1059436‏
996 ‎‡2 BNE|XX924779‏
996 ‎‡2 SUDOC|161456235‏
996 ‎‡2 LC|no2006065141‏
996 ‎‡2 PLWABN|9810570052205606‏
996 ‎‡2 BNE|XX4442047‏
996 ‎‡2 BNE|XX1789866‏
996 ‎‡2 BNE|XX885011‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏