VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q42622290 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000158.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q42622290‏
024 ‎‡a 0000-0001-6425-4673‏ ‎‡2 orcid‏
024 ‎‡a 7401950686‏ ‎‡2 scopus‏
024 ‎‡a 57201562727‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q42622290‏
100 0 ‎‡a خواكين إم. ري‏ ‎‡9 ar‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Joaquín M. Rey‏ ‎‡c investigador‏ ‎‡9 ast‏
400 0 ‎‡a Joaquín M. Rey‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Joaquín M. Rey‏ ‎‡c investigador‏ ‎‡9 es‏
400 0 ‎‡a Joaquín M. Rey‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's A simple random amplified polymorphic DNA genotyping method for field isolates of Dermatophilus congolensis‏
670 ‎‡a Author's A zoonotic ringworm outbreak caused by a dysgonic strain of Microsporum canis from stray cats‏
670 ‎‡a Author's Aetiology of caprine contagious agalactia syndrome in Extremadura, Spain.‏
670 ‎‡a Author's An indirect fluorescent antibody technique for detection of anti-Dermatophilus congolensis antibodies in sheep‏
670 ‎‡a Author's Bovine tuberculosis in wild boar (Sus scrofa), red deer (Cervus elaphus) and cattle (Bos taurus) in a Mediterranean ecosystem (1992-2004).‏
670 ‎‡a Author's Characterisation of an extracellular serine protease gene‏
670 ‎‡a Author's Characterisation of an extracellular serine protease gene (nasp gene) from Dermatophilus congolensis.‏
670 ‎‡a Author's Characterization of Escherichia coli O157:H7 strains isolated from patients in Cáceres, Extremadura (Spain) (2006-2007)‏
670 ‎‡a Author's [Clinical and pathogenic aspects of infections due to Escherichia coli O157:H7 and other verocytotoxigenic E. coli].‏
670 ‎‡a Author's Detection and characterisation of O157:H7 and non-O157 Shiga toxin-producing Escherichia coli in wild boars.‏
670 ‎‡a Author's Detection and characterisation of Shiga toxin-producing Escherichia coli other than Escherichia coli O157:H7 in wild ruminants‏
670 ‎‡a Author's Development of a real-time SYBR Green PCR assay for the rapid detection of Dermatophilus congolensis.‏
670 ‎‡a Author's Evaluation of endotoxaemia in the prognosis and treatment of scouring merino lambs.‏
670 ‎‡a Author's Evaluation of randomly amplified polymorphic DNA and pulsed field gel electrophoresis techniques for molecular typing of Dermatophilus congolensis.‏
670 ‎‡a Author's Fatal outbreak of systemic pasteurellosis in a wild boar‏
670 ‎‡a Author's Fatal outbreak of systemic pasteurellosis in a wild boar (Sus scrofa) population from southwest Spain.‏
670 ‎‡a Author's How does the microbial load affect the quality of equine cool-stored semen?‏
670 ‎‡a Author's Identification of an alkaline ceramidase gene from Dermatophilus congolensis‏
670 ‎‡a Author's In vitro studies of Dermatophilus congolensis antimicrobial susceptibility by determining minimal inhibitory and bacteriocidal concentrations‏
670 ‎‡a Author's Investigations into the seasonal presence of Mycoplasma species in fattening lambs.‏
670 ‎‡a Author's Longitudinal study of Shiga toxin-producing Escherichia coli shedding in sheep feces: persistence of specific clones in sheep flocks.‏
670 ‎‡a Author's Mannheimia haemolytica and Bibersteinia trehalosi Serotypes Isolated from Merino Breed Lambs in Extremadura (Southwestern Spain).‏
670 ‎‡a Author's Ocular lesions associated with Chlamydia suis in a wild boar piglet‏
670 ‎‡a Author's Ocular lesions associated with Chlamydia suis in a wild boar piglet (Sus scrofa) from a semi-free range population in Spain.‏
670 ‎‡a Author's Outbreak of swine erysipelas in a semi-intensive wild boar farm in Spain‏
670 ‎‡a Author's Pheno-genotypic characterisation of Escherichia coli O157:H7 isolates from domestic and wild ruminants‏
670 ‎‡a Author's Presence of Shiga toxin-producing E. coli O157:H7 in a survey of wild artiodactyls‏
670 ‎‡a Author's Prevalence, serotypes and virulence genes of Shiga toxin-producing Escherichia coli isolated from ovine and caprine milk and other dairy products in Spain‏
670 ‎‡a Author's Removal of Extended-Spectrum Beta-Lactamase-Producing Escherichia coli, ST98, in Water for Human Consumption by Black Ceramic Water Filters in Low-Income Ecuadorian Highlands‏
670 ‎‡a Author's Salmonella spp. and Shiga toxin-producing Escherichia coli prevalence in an ocellated lizard‏
670 ‎‡a Author's Salmonella spp. and Shiga toxin-producing Escherichia coli prevalence in an ocellated lizard (Timon lepidus) research center in Spain‏
670 ‎‡a Author's Serotypes, virulence genes, and intimin types of Shiga toxin (verotoxin)-producing Escherichia coli isolates from healthy sheep in Spain.‏
670 ‎‡a Author's Shiga toxin-producing Escherichia coli O157:H7 from extensive cattle of the fighting bulls breed.‏
670 ‎‡a Author's Spread of Antimicrobial Resistance by Salmonella enterica Serovar Choleraesuis between Close Domestic and Wild Environments‏
670 ‎‡a Author's Subtilase cytotoxin encoding genes are present in human, sheep and deer intimin-negative, Shiga toxin-producing Escherichia coli O128:H2‏
909 ‎‡a (scopus) 57201562727‏ ‎‡9 1‏
909 ‎‡a (scopus) 7401950686‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000164254673‏ ‎‡9 1‏
919 ‎‡a bovinetuberculosisinwildboarsusscrofareddeercervuselaphusandcattlebostaurusinamediterraneanecosystem1992‏ ‎‡A Bovine tuberculosis in wild boar (Sus scrofa), red deer (Cervus elaphus) and cattle (Bos taurus) in a Mediterranean ecosystem (1992-2004).‏ ‎‡9 1‏
919 ‎‡a characterisationofanextracellularserineproteasegene‏ ‎‡A Characterisation of an extracellular serine protease gene‏ ‎‡9 1‏
919 ‎‡a characterisationofanextracellularserineproteasegenenaspgenefromdermatophiluscongolensis‏ ‎‡A Characterisation of an extracellular serine protease gene (nasp gene) from Dermatophilus congolensis.‏ ‎‡9 1‏
919 ‎‡a characterizationofescherichiacolio157h7strainsisolatedfrompatientsincaceresextremaduraspain2006‏ ‎‡A Characterization of Escherichia coli O157:H7 strains isolated from patients in Cáceres, Extremadura (Spain) (2006-2007)‏ ‎‡9 1‏
919 ‎‡a clinicalandpathogenicaspectsofinfectionsduetoescherichiacolio157h7andotherverocytotoxigenicecoli‏ ‎‡A [Clinical and pathogenic aspects of infections due to Escherichia coli O157:H7 and other verocytotoxigenic E. coli].‏ ‎‡9 1‏
919 ‎‡a detectionandcharacterisationofo157h7andnono157shigatoxinproducingescherichiacoliinwildboars‏ ‎‡A Detection and characterisation of O157:H7 and non-O157 Shiga toxin-producing Escherichia coli in wild boars.‏ ‎‡9 1‏
919 ‎‡a detectionandcharacterisationofshigatoxinproducingescherichiacoliotherthanescherichiacolio157h7inwildruminants‏ ‎‡A Detection and characterisation of Shiga toxin-producing Escherichia coli other than Escherichia coli O157:H7 in wild ruminants‏ ‎‡9 1‏
919 ‎‡a developmentofarealtimesybrgreenpcrassayfortherapiddetectionofdermatophiluscongolensis‏ ‎‡A Development of a real-time SYBR Green PCR assay for the rapid detection of Dermatophilus congolensis.‏ ‎‡9 1‏
919 ‎‡a evaluationofendotoxaemiaintheprognosisandtreatmentofscouringmerinolambs‏ ‎‡A Evaluation of endotoxaemia in the prognosis and treatment of scouring merino lambs.‏ ‎‡9 1‏
919 ‎‡a indirectfluorescentantibodytechniquefordetectionofantidermatophiluscongolensisantibodiesinsheep‏ ‎‡A An indirect fluorescent antibody technique for detection of anti-Dermatophilus congolensis antibodies in sheep‏ ‎‡9 1‏
919 ‎‡a evaluationofrandomlyamplifiedpolymorphicdnaandpulsedfieldgelelectrophoresistechniquesformoleculartypingofdermatophiluscongolensis‏ ‎‡A Evaluation of randomly amplified polymorphic DNA and pulsed field gel electrophoresis techniques for molecular typing of Dermatophilus congolensis.‏ ‎‡9 1‏
919 ‎‡a fataloutbreakofsystemicpasteurellosisinawildboar‏ ‎‡A Fatal outbreak of systemic pasteurellosis in a wild boar‏ ‎‡9 1‏
919 ‎‡a fataloutbreakofsystemicpasteurellosisinawildboarsusscrofapopulationfromsouthwestspain‏ ‎‡A Fatal outbreak of systemic pasteurellosis in a wild boar (Sus scrofa) population from southwest Spain.‏ ‎‡9 1‏
919 ‎‡a aetiologyofcaprinecontagiousagalactiasyndromeinextremaduraspain‏ ‎‡A Aetiology of caprine contagious agalactia syndrome in Extremadura, Spain.‏ ‎‡9 1‏
919 ‎‡a howdoesthemicrobialloadaffectthequalityofequinecoolstoredsemen‏ ‎‡A How does the microbial load affect the quality of equine cool-stored semen?‏ ‎‡9 1‏
919 ‎‡a zoonoticringwormoutbreakcausedbyadysgonicstrainofmicrosporumcanisfromstraycats‏ ‎‡A A zoonotic ringworm outbreak caused by a dysgonic strain of Microsporum canis from stray cats‏ ‎‡9 1‏
919 ‎‡a identificationofanalkalineceramidasegenefromdermatophiluscongolensis‏ ‎‡A Identification of an alkaline ceramidase gene from Dermatophilus congolensis‏ ‎‡9 1‏
919 ‎‡a simplerandomamplifiedpolymorphicdnagenotypingmethodforfieldisolatesofdermatophiluscongolensis‏ ‎‡A A simple random amplified polymorphic DNA genotyping method for field isolates of Dermatophilus congolensis‏ ‎‡9 1‏
919 ‎‡a invitrostudiesofdermatophiluscongolensisantimicrobialsusceptibilitybydeterminingminimalinhibitoryandbacteriocidalconcentrations‏ ‎‡A In vitro studies of Dermatophilus congolensis antimicrobial susceptibility by determining minimal inhibitory and bacteriocidal concentrations‏ ‎‡9 1‏
919 ‎‡a investigationsintotheseasonalpresenceofmycoplasmaspeciesinfatteninglambs‏ ‎‡A Investigations into the seasonal presence of Mycoplasma species in fattening lambs.‏ ‎‡9 1‏
919 ‎‡a longitudinalstudyofshigatoxinproducingescherichiacolisheddinginsheepfecespersistenceofspecificclonesinsheepflocks‏ ‎‡A Longitudinal study of Shiga toxin-producing Escherichia coli shedding in sheep feces: persistence of specific clones in sheep flocks.‏ ‎‡9 1‏
919 ‎‡a mannheimiahaemolyticaandbibersteiniatrehalosiserotypesisolatedfrommerinobreedlambsinextremadurasouthwesternspain‏ ‎‡A Mannheimia haemolytica and Bibersteinia trehalosi Serotypes Isolated from Merino Breed Lambs in Extremadura (Southwestern Spain).‏ ‎‡9 1‏
919 ‎‡a ocularlesionsassociatedwithchlamydiasuisinawildboarpiglet‏ ‎‡A Ocular lesions associated with Chlamydia suis in a wild boar piglet‏ ‎‡9 1‏
919 ‎‡a ocularlesionsassociatedwithchlamydiasuisinawildboarpigletsusscrofafromasemifreerangepopulationinspain‏ ‎‡A Ocular lesions associated with Chlamydia suis in a wild boar piglet (Sus scrofa) from a semi-free range population in Spain.‏ ‎‡9 1‏
919 ‎‡a outbreakofswineerysipelasinasemiintensivewildboarfarminspain‏ ‎‡A Outbreak of swine erysipelas in a semi-intensive wild boar farm in Spain‏ ‎‡9 1‏
919 ‎‡a phenogenotypiccharacterisationofescherichiacolio157h7isolatesfromdomesticandwildruminants‏ ‎‡A Pheno-genotypic characterisation of Escherichia coli O157:H7 isolates from domestic and wild ruminants‏ ‎‡9 1‏
919 ‎‡a presenceofshigatoxinproducingecolio157h7inasurveyofwildartiodactyls‏ ‎‡A Presence of Shiga toxin-producing E. coli O157:H7 in a survey of wild artiodactyls‏ ‎‡9 1‏
919 ‎‡a prevalenceserotypesandvirulencegenesofshigatoxinproducingescherichiacoliisolatedfromovineandcaprinemilkandotherdairyproductsinspain‏ ‎‡A Prevalence, serotypes and virulence genes of Shiga toxin-producing Escherichia coli isolated from ovine and caprine milk and other dairy products in Spain‏ ‎‡9 1‏
919 ‎‡a removalofextendedspectrumbetalactamaseproducingescherichiacolist98inwaterforhumanconsumptionbyblackceramicwaterfiltersinlowincomeecuadorianhighlands‏ ‎‡A Removal of Extended-Spectrum Beta-Lactamase-Producing Escherichia coli, ST98, in Water for Human Consumption by Black Ceramic Water Filters in Low-Income Ecuadorian Highlands‏ ‎‡9 1‏
919 ‎‡a salmonellasppandshigatoxinproducingescherichiacoliprevalenceinanocellatedlizard‏ ‎‡A Salmonella spp. and Shiga toxin-producing Escherichia coli prevalence in an ocellated lizard‏ ‎‡9 1‏
919 ‎‡a salmonellasppandshigatoxinproducingescherichiacoliprevalenceinanocellatedlizardtimonlepidusresearchcenterinspain‏ ‎‡A Salmonella spp. and Shiga toxin-producing Escherichia coli prevalence in an ocellated lizard (Timon lepidus) research center in Spain‏ ‎‡9 1‏
919 ‎‡a serotypesvirulencegenesandintimintypesofshigatoxinverotoxinproducingescherichiacoliisolatesfromhealthysheepinspain‏ ‎‡A Serotypes, virulence genes, and intimin types of Shiga toxin (verotoxin)-producing Escherichia coli isolates from healthy sheep in Spain.‏ ‎‡9 1‏
919 ‎‡a shigatoxinproducingescherichiacolio157h7fromextensivecattleofthefightingbullsbreed‏ ‎‡A Shiga toxin-producing Escherichia coli O157:H7 from extensive cattle of the fighting bulls breed.‏ ‎‡9 1‏
919 ‎‡a spreadofantimicrobialresistancebysalmonellaentericaserovarcholeraesuisbetweenclosedomesticandwildenvironments‏ ‎‡A Spread of Antimicrobial Resistance by Salmonella enterica Serovar Choleraesuis between Close Domestic and Wild Environments‏ ‎‡9 1‏
919 ‎‡a subtilasecytotoxinencodinggenesarepresentinhumansheepanddeerintiminnegativeshigatoxinproducingescherichiacolio128h2‏ ‎‡A Subtilase cytotoxin encoding genes are present in human, sheep and deer intimin-negative, Shiga toxin-producing Escherichia coli O128:H2‏ ‎‡9 1‏
943 ‎‡a 200x‏ ‎‡A 2007‏ ‎‡9 2‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 RERO|A016639314‏
996 ‎‡2 SUDOC|132360861‏
996 ‎‡2 SUDOC|240098153‏
996 ‎‡2 DNB|1197572236‏
996 ‎‡2 RERO|A016821383‏
996 ‎‡2 ISNI|0000000001985455‏
996 ‎‡2 DNB|1107560926‏
996 ‎‡2 BNF|13288062‏
996 ‎‡2 LC|n 00145777‏
996 ‎‡2 ISNI|0000000059382059‏
996 ‎‡2 NUKAT|n 2019023336‏
996 ‎‡2 PLWABN|9812785171505606‏
996 ‎‡2 LC|n 2004091415‏
996 ‎‡2 NTA|069964696‏
996 ‎‡2 DNB|1035423952‏
996 ‎‡2 LC|no 91028821‏
996 ‎‡2 SUDOC|280233922‏
996 ‎‡2 SUDOC|154025844‏
996 ‎‡2 SUDOC|169443418‏
996 ‎‡2 ISNI|0000000021547786‏
996 ‎‡2 SUDOC|091962072‏
996 ‎‡2 JPG|500117554‏
996 ‎‡2 ISNI|0000000048009283‏
996 ‎‡2 ISNI|0000000117685091‏
996 ‎‡2 RERO|A003740728‏
996 ‎‡2 NII|DA09563170‏
996 ‎‡2 RERO|A006118448‏
996 ‎‡2 BNC|981058614814406706‏
996 ‎‡2 LC|no2021122970‏
996 ‎‡2 NTA|237373947‏
996 ‎‡2 LC|no2005073254‏
996 ‎‡2 SUDOC|158144910‏
996 ‎‡2 BNE|XX1699274‏
996 ‎‡2 LC|no2024070659‏
996 ‎‡2 LC|n 2021020170‏
996 ‎‡2 LC|n 82149225‏
996 ‎‡2 ISNI|0000000060033702‏
996 ‎‡2 BNE|XX1540262‏
996 ‎‡2 LC|n 2015025094‏
996 ‎‡2 BNF|13006892‏
996 ‎‡2 PLWABN|9810603547405606‏
996 ‎‡2 BNC|981058510790006706‏
996 ‎‡2 JPG|500625081‏
996 ‎‡2 SUDOC|264817192‏
996 ‎‡2 DNB|1158756127‏
996 ‎‡2 LC|n 80025167‏
996 ‎‡2 NUKAT|n 2013138071‏
996 ‎‡2 ISNI|0000000514273509‏
996 ‎‡2 SUDOC|144268248‏
996 ‎‡2 BIBSYS|15005261‏
996 ‎‡2 ISNI|0000000032285902‏
996 ‎‡2 BNE|XX1415350‏
996 ‎‡2 DNB|1157703305‏
996 ‎‡2 ISNI|0000000394152074‏
996 ‎‡2 BIBSYS|2129207‏
996 ‎‡2 BNE|XX1051176‏
996 ‎‡2 ISNI|0000000030182272‏
996 ‎‡2 RERO|A018153009‏
996 ‎‡2 BLBNB|000182327‏
996 ‎‡2 ISNI|0000000003023401‏
996 ‎‡2 RERO|A013542461‏
996 ‎‡2 BLBNB|000480139‏
996 ‎‡2 ISNI|0000000041499240‏
996 ‎‡2 ISNI|0000000448102348‏
996 ‎‡2 NTA|369588088‏
996 ‎‡2 SUDOC|160570468‏
996 ‎‡2 BNF|10794839‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏