WKP|Q42708155

Search

Select Field:

Select Index:

Search Terms:

Leader		00000nz a2200037n 45 0
001		WKP\|Q42708155 (VIAF cluster) (Authority/Source Record)
003		WKP
005		20241121000115.0
008		241121nneanz\|\|abbn n and d
035		‎‡a (WKP)Q42708155‏
024		‎‡a 0000-0002-3083-7595‏ ‎‡2 orcid‏
024		‎‡a 53981529400‏ ‎‡2 scopus‏
035		‎‡a (OCoLC)Q42708155‏
100	0	‎‡a Jong Hun Lee‏ ‎‡9 ast‏ ‎‡9 es‏ ‎‡9 sl‏
400	0	‎‡a Jong Hun Lee‏ ‎‡c researcher (ORCID 0000-0002-3083-7595)‏ ‎‡9 en‏
400	0	‎‡a Jong Hun Lee‏ ‎‡c onderzoeker‏ ‎‡9 nl‏
670		‎‡a Author's Antioxidant activity of Litsea cubeba‏
670		‎‡a Author's Association of aberrant DNA methylation in Apc(min/+) mice with the epithelial-mesenchymal transition and Wnt/β-catenin pathways: genome-wide analysis using MeDIP-seq‏
670		‎‡a Author's Dietary phytochemicals and cancer prevention: Nrf2 signaling, epigenetics, and cell death mechanisms in blocking cancer initiation and progression.‏
670		‎‡a Author's Epigenetic reactivation of Nrf2 in murine prostate cancer TRAMP C1 cells by natural phytochemicals Z-ligustilide and Radix angelica sinensis via promoter CpG demethylation.‏
670		‎‡a Author's Genome-wide analysis of DNA methylation in UVB- and DMBA/TPA-induced mouse skin cancer models‏
670		‎‡a Author's Identification and functional studies of a new Nrf2 partner IQGAP1: a critical role in the stability and transactivation of Nrf2.‏
670		‎‡a Author's Increased Omega-3 Fatty Acid Intake is Inversely Associated with Sarcopenic Obesity in Women but not in Men, Based on the 2014-2018 Korean National Health and Nutrition Examination Survey‏
670		‎‡a Author's Neuroprotective Secondary Metabolite Produced by an Endophytic Fungus, Neosartorya fischeri JS0553, Isolated from Glehnia littoralis‏
670		‎‡a Author's Nrf2 knockout enhances intestinal tumorigenesis in Apc‏
670		‎‡a Author's Nrf2 knockout enhances intestinal tumorigenesis in Apc(min/+) mice due to attenuation of anti-oxidative stress pathway while potentiates inflammation.‏
670		‎‡a Author's Nrf2 null enhances UVB-induced skin inflammation and extracellular matrix damages‏
670		‎‡a Author's Pharmacodynamics of curcumin as DNA hypomethylation agent in restoring the expression of Nrf2 via promoter CpGs demethylation.‏
670		‎‡a Author's Pharmacogenetics, pharmacogenomics and epigenetics of Nrf2-regulated xenobiotic-metabolizing enzymes and transporters by dietary phytochemical and cancer chemoprevention.‏
670		‎‡a Author's Requirement and epigenetics reprogramming of Nrf2 in suppression of tumor promoter TPA-induced mouse skin cell transformation by sulforaphane‏
670		‎‡a Author's Synthesis of 13-(substituted benzyl) berberine and berberrubine derivatives as antifungal agents.‏
670		‎‡a Author's The Ras GTPase-activating-like protein IQGAP1 mediates Nrf2 protein activation via the mitogen-activated protein kinase/extracellular signal-regulated kinase‏
670		‎‡a Author's The Ras GTPase-activating-like protein IQGAP1 mediates Nrf2 protein activation via the mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) kinase (MEK)-ERK pathway.‏
909		‎‡a (scopus) 53981529400‏ ‎‡9 1‏
909		‎‡a (orcid) 0000000230837595‏ ‎‡9 1‏
919		‎‡a nrf2knockoutenhancesintestinaltumorigenesisinapc‏ ‎‡A Nrf2 knockout enhances intestinal tumorigenesis in Apc‏ ‎‡9 1‏
919		‎‡a neuroprotectivesecondarymetaboliteproducedbyanendophyticfungusneosartoryafischerijs0553isolatedfromglehnialittoralis‏ ‎‡A Neuroprotective Secondary Metabolite Produced by an Endophytic Fungus, Neosartorya fischeri JS0553, Isolated from Glehnia littoralis‏ ‎‡9 1‏
919		‎‡a increased Omega 3fattyacidintakeisinverselyassociatedwithsarcopenicobesityinwomenbutnotinmenbasedonthe20142018koreannationalhealthandnutritionexaminationsurvey‏ ‎‡A Increased Omega-3 Fatty Acid Intake is Inversely Associated with Sarcopenic Obesity in Women but not in Men, Based on the 2014-2018 Korean National Health and Nutrition Examination Survey‏ ‎‡9 1‏
919		‎‡a identificationandfunctionalstudiesofanewnrf2partneriqgap1acriticalroleinthestabilityandtransactivationofnrf2‏ ‎‡A Identification and functional studies of a new Nrf2 partner IQGAP1: a critical role in the stability and transactivation of Nrf2.‏ ‎‡9 1‏
919		‎‡a genomewideanalysisofdnamethylationinuvbanddmbatpainducedmouseskincancermodels‏ ‎‡A Genome-wide analysis of DNA methylation in UVB- and DMBA/TPA-induced mouse skin cancer models‏ ‎‡9 1‏
919		‎‡a epigeneticreactivationofnrf2inmurineprostatecancertrampc1cellsbynaturalphytochemicalszligustilideandradixangelicasinensisviapromotercpgdemethylation‏ ‎‡A Epigenetic reactivation of Nrf2 in murine prostate cancer TRAMP C1 cells by natural phytochemicals Z-ligustilide and Radix angelica sinensis via promoter CpG demethylation.‏ ‎‡9 1‏
919		‎‡a dietaryphytochemicalsandcancerpreventionnrf2signalingepigeneticsandcelldeathmechanismsinblockingcancerinitiationandprogression‏ ‎‡A Dietary phytochemicals and cancer prevention: Nrf2 signaling, epigenetics, and cell death mechanisms in blocking cancer initiation and progression.‏ ‎‡9 1‏
919		‎‡a associationofaberrantdnamethylationinapcmin+micewiththeepithelialmesenchymaltransitionandwntβcateninpathwaysgenomewideanalysisusingmedipseq‏ ‎‡A Association of aberrant DNA methylation in Apc(min/+) mice with the epithelial-mesenchymal transition and Wnt/β-catenin pathways: genome-wide analysis using MeDIP-seq‏ ‎‡9 1‏
919		‎‡a antioxidantactivityoflitseacubeba‏ ‎‡A Antioxidant activity of Litsea cubeba‏ ‎‡9 1‏
919		‎‡a rasgtpaseactivatinglikeproteiniqgap1mediatesnrf2proteinactivationviathemitogenactivatedproteinkinaseextracellularsignalregulatedkinaseerkkinasemekerkpathway‏ ‎‡A The Ras GTPase-activating-like protein IQGAP1 mediates Nrf2 protein activation via the mitogen-activated protein kinase/extracellular signal-regulated kinase (ERK) kinase (MEK)-ERK pathway.‏ ‎‡9 1‏
919		‎‡a rasgtpaseactivatinglikeproteiniqgap1mediatesnrf2proteinactivationviathemitogenactivatedproteinkinaseextracellularsignalregulatedkinase‏ ‎‡A The Ras GTPase-activating-like protein IQGAP1 mediates Nrf2 protein activation via the mitogen-activated protein kinase/extracellular signal-regulated kinase‏ ‎‡9 1‏
919		‎‡a synthesisof13substitutedbenzylberberineandberberrubinederivativesasantifungalagents‏ ‎‡A Synthesis of 13-(substituted benzyl) berberine and berberrubine derivatives as antifungal agents.‏ ‎‡9 1‏
919		‎‡a requirementandepigeneticsreprogrammingofnrf2insuppressionoftumorpromotertpainducedmouseskincelltransformationbysulforaphane‏ ‎‡A Requirement and epigenetics reprogramming of Nrf2 in suppression of tumor promoter TPA-induced mouse skin cell transformation by sulforaphane‏ ‎‡9 1‏
919		‎‡a pharmacogeneticspharmacogenomicsandepigeneticsofnrf2regulatedxenobioticmetabolizingenzymesandtransportersbydietaryphytochemicalandcancerchemoprevention‏ ‎‡A Pharmacogenetics, pharmacogenomics and epigenetics of Nrf2-regulated xenobiotic-metabolizing enzymes and transporters by dietary phytochemical and cancer chemoprevention.‏ ‎‡9 1‏
919		‎‡a pharmacodynamicsofcurcuminasdnahypomethylationagentinrestoringtheexpressionofnrf2viapromotercpgsdemethylation‏ ‎‡A Pharmacodynamics of curcumin as DNA hypomethylation agent in restoring the expression of Nrf2 via promoter CpGs demethylation.‏ ‎‡9 1‏
919		‎‡a nrf2nullenhancesuvbinducedskininflammationandextracellularmatrixdamages‏ ‎‡A Nrf2 null enhances UVB-induced skin inflammation and extracellular matrix damages‏ ‎‡9 1‏
919		‎‡a nrf2knockoutenhancesintestinaltumorigenesisinapcmin+miceduetoattenuationofantioxidativestresspathwaywhilepotentiatesinflammation‏ ‎‡A Nrf2 knockout enhances intestinal tumorigenesis in Apc(min/+) mice due to attenuation of anti-oxidative stress pathway while potentiates inflammation.‏ ‎‡9 1‏
996		‎‡2 DNB\|122070606X‏
996		‎‡2 ISNI\|0000000512358840‏
996		‎‡2 ISNI\|0000000464914135‏
996		‎‡2 ISNI\|0000000513541639‏
996		‎‡2 RERO\|A003507271‏
996		‎‡2 RERO\|A003507272‏
996		‎‡2 ISNI\|0000000377491859‏
996		‎‡2 ISNI\|0000000464888723‏
996		‎‡2 BNF\|12736844‏
996		‎‡2 ISNI\|0000000505750350‏
996		‎‡2 ISNI\|0000000464817212‏
996		‎‡2 ISNI\|0000000426077129‏
996		‎‡2 ISNI\|0000000473886789‏
996		‎‡2 ISNI\|0000000494089623‏
996		‎‡2 ISNI\|0000000040023654‏
996		‎‡2 ISNI\|0000000476967939‏
996		‎‡2 ISNI\|0000000474004346‏
996		‎‡2 ISNI\|0000000513528063‏
996		‎‡2 ISNI\|000000049416278X‏
996		‎‡2 LC\|n 84218241‏
996		‎‡2 ISNI\|0000000492385947‏
996		‎‡2 ISNI\|0000000473590144‏
996		‎‡2 LC\|no 94028189‏
996		‎‡2 ISNI\|0000000493004202‏
996		‎‡2 ISNI\|0000000464666581‏
996		‎‡2 ISNI\|0000000467781593‏
996		‎‡2 ISNI\|0000000047415423‏
996		‎‡2 ISNI\|0000000473850284‏
996		‎‡2 ISNI\|0000000505547299‏
996		‎‡2 ISNI\|0000000049813409‏
996		‎‡2 ISNI\|0000000071469093‏
996		‎‡2 ISNI\|0000000459352246‏
996		‎‡2 DNB\|1156332605‏
996		‎‡2 ISNI\|0000000473797161‏
996		‎‡2 LC\|n 2018015698‏
996		‎‡2 ISNI\|0000000473783659‏
996		‎‡2 ISNI\|0000000512771205‏
996		‎‡2 ISNI\|0000000513802819‏
996		‎‡2 ISNI\|0000000465182976‏
996		‎‡2 ISNI\|0000000479286274‏
996		‎‡2 DNB\|1232244996‏
996		‎‡2 ISNI\|0000000484956519‏
996		‎‡2 ISNI\|000000046097881X‏
996		‎‡2 ISNI\|0000000464374829‏
996		‎‡2 ISNI\|0000000476697051‏
996		‎‡2 DNB\|128501499‏
996		‎‡2 ISNI\|0000000397571071‏
996		‎‡2 ISNI\|0000000512522356‏
996		‎‡2 BIBSYS\|11018796‏
996		‎‡2 ISNI\|0000000473804261‏
996		‎‡2 LC\|no2010039255‏
996		‎‡2 ISNI\|0000000480116133‏
996		‎‡2 ISNI\|0000000050248515‏
996		‎‡2 SUDOC\|243280955‏
996		‎‡2 NII\|DA15019658‏
996		‎‡2 ISNI\|0000000493348398‏
996		‎‡2 ISNI\|000000049406387X‏
996		‎‡2 ISNI\|000000046437460X‏
996		‎‡2 ISNI\|0000000493422041‏
996		‎‡2 CAOONL\|ncf10163644‏
996		‎‡2 ISNI\|0000000473875342‏
996		‎‡2 ISNI\|0000000473880651‏
996		‎‡2 ISNI\|0000000508333800‏
996		‎‡2 SUDOC\|14033145X‏
996		‎‡2 ISNI\|0000000512744063‏
996		‎‡2 LC\|no2010165368‏
996		‎‡2 ISNI\|000000047927285X‏
996		‎‡2 ISNI\|000000049769321X‏
996		‎‡2 ISNI\|0000000467775580‏
996		‎‡2 ISNI\|0000000474078126‏
996		‎‡2 ISNI\|0000000477221194‏
996		‎‡2 DNB\|1154393011‏
996		‎‡2 ISNI\|0000000464815639‏
996		‎‡2 ISNI\|0000000467780275‏
996		‎‡2 ISNI\|0000000492251156‏
996		‎‡2 ISNI\|000000046467010X‏
996		‎‡2 ISNI\|0000000475915221‏
996		‎‡2 ISNI\|0000000512344748‏
996		‎‡2 ISNI\|0000000465118624‏
996		‎‡2 SUDOC\|133409120‏
996		‎‡2 ISNI\|0000000480270368‏
996		‎‡2 NII\|DA09863491‏
996		‎‡2 ISNI\|0000000492319464‏
996		‎‡2 LC\|n 2024184187‏
996		‎‡2 ISNI\|0000000473812368‏
996		‎‡2 ISNI\|000000049405560X‏
996		‎‡2 ISNI\|0000000503691393‏
996		‎‡2 ISNI\|0000000505917210‏
996		‎‡2 ISNI\|0000000463565666‏
996		‎‡2 ISNI\|0000000512530444‏
996		‎‡2 ISNI\|0000000461115055‏
996		‎‡2 ISNI\|0000000463274009‏
996		‎‡2 ISNI\|0000000407797075‏
996		‎‡2 ISNI\|0000000474873947‏
996		‎‡2 BNF\|16125814‏
996		‎‡2 LC\|n 2007180318‏
996		‎‡2 ISNI\|0000000492038291‏
996		‎‡2 DNB\|171065603‏
996		‎‡2 ISNI\|0000000467641283‏
996		‎‡2 ISNI\|0000000467666747‏
996		‎‡2 ISNI\|0000000494061903‏
996		‎‡2 NII\|DA17650612‏
996		‎‡2 BIBSYS\|90150658‏
996		‎‡2 ISNI\|0000000467822455‏
996		‎‡2 ISNI\|0000000493871509‏
996		‎‡2 LC\|n 2020180802‏
996		‎‡2 NTA\|37402166X‏
996		‎‡2 ISNI\|0000000492182162‏
996		‎‡2 NDL\|01137519‏
996		‎‡2 LC\|n 2001114266‏
996		‎‡2 ISNI\|0000000461106810‏
996		‎‡2 DNB\|13583080X‏
996		‎‡2 ISNI\|0000000476711466‏
996		‎‡2 SUDOC\|243288700‏
996		‎‡2 DNB\|127933816‏
996		‎‡2 DNB\|1158717652‏
996		‎‡2 ISNI\|0000000465033583‏
996		‎‡2 ISNI\|0000000492418569‏
996		‎‡2 ISNI\|0000000504796840‏
996		‎‡2 ISNI\|0000000050910011‏
996		‎‡2 ISNI\|0000000468167747‏
996		‎‡2 ISNI\|0000000474239022‏
996		‎‡2 ISNI\|0000000502761791‏
996		‎‡2 J9U\|987007413693805171‏
996		‎‡2 ISNI\|0000000492134259‏
996		‎‡2 NDL\|00991136‏
996		‎‡2 ISNI\|0000000512520852‏
996		‎‡2 ISNI\|0000000513307957‏
996		‎‡2 ISNI\|0000000468167982‏
996		‎‡2 NLA\|000035165079‏
996		‎‡2 ISNI\|000000046334330X‏
996		‎‡2 ISNI\|0000000477407220‏
996		‎‡2 DNB\|1030178151‏
996		‎‡2 ISNI\|0000000512256510‏
996		‎‡2 ISNI\|0000000464927315‏
996		‎‡2 ISNI\|0000000516852918‏
996		‎‡2 ISNI\|0000000465084524‏
996		‎‡2 ISNI\|000000047388162X‏
996		‎‡2 ISNI\|0000000054548064‏
996		‎‡2 ISNI\|0000000467643676‏
996		‎‡2 ISNI\|0000000516883351‏
996		‎‡2 ISNI\|0000000467848102‏
996		‎‡2 J9U\|987007323253505171‏
996		‎‡2 LC\|nb2007010609‏
996		‎‡2 ISNI\|0000000459421870‏
996		‎‡2 ISNI\|0000000467671482‏
996		‎‡2 ISNI\|0000000473804077‏
996		‎‡2 NUKAT\|n 2016065299‏
996		‎‡2 NII\|DA07092095‏
996		‎‡2 ISNI\|000000049318678X‏
996		‎‡2 ISNI\|000000047387012X‏
996		‎‡2 ISNI\|0000000494060193‏
996		‎‡2 ISNI\|0000000505062961‏
996		‎‡2 ISNI\|0000000053061983‏
996		‎‡2 LC\|n 82079520‏
996		‎‡2 ISNI\|0000000479207484‏
996		‎‡2 LC\|no2019023554‏
996		‎‡2 BIBSYS\|9029721‏
996		‎‡2 ISNI\|0000000477408805‏
996		‎‡2 ISNI\|0000000464633659‏
996		‎‡2 ISNI\|0000000492405311‏
996		‎‡2 BIBSYS\|2063395‏
996		‎‡2 ISNI\|0000000473530379‏
996		‎‡2 ISNI\|0000000493189657‏
996		‎‡2 PLWABN\|9810705278205606‏
996		‎‡2 ISNI\|0000000516853080‏
996		‎‡2 LC\|no2013078397‏
996		‎‡2 ISNI\|0000000468325733‏
996		‎‡2 ISNI\|000000046508222X‏
996		‎‡2 ISNI\|0000000483379203‏
996		‎‡2 ISNI\|0000000463421320‏
996		‎‡2 J9U\|987007415718105171‏
996		‎‡2 ISNI\|0000000493271394‏
996		‎‡2 NDL\|001109589‏
996		‎‡2 ISNI\|0000000477778259‏
996		‎‡2 PLWABN\|9810558831005606‏
996		‎‡2 LC\|n 80094424‏
996		‎‡2 ISNI\|0000000493187213‏
996		‎‡2 ISNI\|0000000492026362‏
996		‎‡2 BIBSYS\|90623538‏
996		‎‡2 DNB\|13722091X‏
996		‎‡2 ISNI\|0000000463246315‏
996		‎‡2 ISNI\|000000046325784X‏
996		‎‡2 ISNI\|0000000138343672‏
996		‎‡2 ISNI\|0000000493186819‏
996		‎‡2 ISNI\|0000000503605168‏
996		‎‡2 J9U\|987007375967905171‏
996		‎‡2 ISNI\|0000000508334977‏
996		‎‡2 ISNI\|0000000468730464‏
996		‎‡2 ISNI\|0000000513221264‏
996		‎‡2 NII\|DA15419237‏
996		‎‡2 ISNI\|0000000063484517‏
996		‎‡2 ISNI\|000000050503440X‏
996		‎‡2 ISNI\|0000000465119678‏
996		‎‡2 ISNI\|0000000474790068‏
996		‎‡2 ISNI\|0000000509050642‏
996		‎‡2 ISNI\|0000000493140976‏
996		‎‡2 ISNI\|0000000513533479‏
996		‎‡2 ISNI\|0000000463437066‏
996		‎‡2 PLWABN\|9813295778305606‏
996		‎‡2 BNF\|14409600‏
996		‎‡2 ISNI\|0000000467641523‏
996		‎‡2 ISNI\|000000046446463X‏
996		‎‡2 LC\|n 90652293‏
996		‎‡2 ISNI\|0000000463408468‏
996		‎‡2 BIBSYS\|90233075‏
996		‎‡2 ISNI\|0000000494053700‏
996		‎‡2 DNB\|1057807141‏
996		‎‡2 ISNI\|000000048018315X‏
996		‎‡2 ISNI\|0000000083198462‏
996		‎‡2 ISNI\|0000000465126800‏
996		‎‡2 PLWABN\|9810597976005606‏
996		‎‡2 NII\|DA16162872‏
996		‎‡2 DNB\|1140073931‏
996		‎‡2 ISNI\|0000000381706904‏
996		‎‡2 ISNI\|0000000492613954‏
996		‎‡2 ISNI\|0000000463367723‏
996		‎‡2 ISNI\|0000000468351018‏
996		‎‡2 LC\|n 2007182355‏
996		‎‡2 ISNI\|0000000474004100‏
996		‎‡2 ISNI\|0000000505331236‏
996		‎‡2 ISNI\|0000000479746920‏
996		‎‡2 ISNI\|0000000505052448‏
996		‎‡2 ISNI\|0000000039251115‏
996		‎‡2 ISNI\|0000000459472440‏
996		‎‡2 DNB\|1049250095‏
996		‎‡2 ISNI\|0000000493239925‏
996		‎‡2 ISNI\|0000000491281644‏
996		‎‡2 ISNI\|0000000468167229‏
996		‎‡2 LC\|no2011159231‏
996		‎‡2 ISNI\|0000000505433195‏
996		‎‡2 ISNI\|0000000464293850‏
996		‎‡2 ISNI\|0000000468249734‏
996		‎‡2 ISNI\|0000000492076319‏
996		‎‡2 ISNI\|0000000511241747‏
996		‎‡2 ISNI\|0000000464605017‏
996		‎‡2 ISNI\|000000047396787X‏
996		‎‡2 ISNI\|0000000473915973‏
996		‎‡2 ISNI\|0000000463409305‏
996		‎‡2 NUKAT\|n 2016173616‏
996		‎‡2 ISNI\|0000000464479487‏
996		‎‡2 BIBSYS\|98029465‏
996		‎‡2 ISNI\|000000049323397X‏
996		‎‡2 ISNI\|0000000467643027‏
996		‎‡2 ISNI\|0000000459421862‏
996		‎‡2 ISNI\|0000000021976273‏
996		‎‡2 ISNI\|0000000461106351‏
996		‎‡2 LC\|no2018017003‏
996		‎‡2 ISNI\|0000000460872265‏
996		‎‡2 ISNI\|0000000511643535‏
997		‎‡a 0 0 lived 0 0‏ ‎‡9 1‏

VIAF

Virtual International Authority File

Search