VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q51094321 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235919.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q51094321‏
024 ‎‡a 0000-0002-7503-1245‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q51094321‏
100 0 ‎‡a Francisco Fabregat-Santiago‏ ‎‡9 ast‏ ‎‡9 es‏ ‎‡9 sl‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Francisco Fabregat-Santiago‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Francisco Fabregat-Santiago‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's A perspective on the production of dye-sensitized solar modules‏
670 ‎‡a Author's A review of recent results on electrochemical determination of the density of electronic states of nanostructured metal-oxide semiconductors and organic hole conductors‏
670 ‎‡a Author's Analysis of bio-anode performance through electrochemical impedance spectroscopy.‏
670 ‎‡a Author's Analysis of cyclic voltammograms of electrochromic a-WO3 films from voltage-dependent equilibrium capacitance measurements‏
670 ‎‡a Author's Analysis of the Origin of Open Circuit Voltage in Dye Solar Cells‏
670 ‎‡a Author's Anomalous transport effects in the impedance of porous film electrodes‏
670 ‎‡a Author's Anomalous transport on polymeric porous film electrodes in the dopant-induced insulator-to-conductor transition analyzed by electrochemical impedance‏
670 ‎‡a Author's Bandgap modulation in efficient n-thiophene absorbers for dye solar cell sensitization.‏
670 ‎‡a Author's Carbon Counter-Electrode-Based Quantum-Dot-Sensitized Solar Cells with Certified Efficiency Exceeding 11.‏
670 ‎‡a Author's Carrier density and interfacial kinetics of mesoporous TiO2 in aqueous electrolyte determined by impedance spectroscopy‏
670 ‎‡a Author's Characteristics of high efficiency dye-sensitized solar cells‏
670 ‎‡a Author's Characterization of nanostructured hybrid and organic solar cells by impedance spectroscopy‏
670 ‎‡a Author's Chemical capacitance of nanoporous-nanocrystalline TiO2in a room temperature ionic liquid‏
670 ‎‡a Author's Chemical Effects of Tin Oxide Nanoparticles in Polymer Electrolytes-Based Dye-Sensitized Solar Cells‏
670 ‎‡a Author's Competitive Photoelectrochemical Methanol and Water Oxidation with Hematite Electrodes‏
670 ‎‡a Author's Correlation between Photovoltaic Performance and Impedance Spectroscopy of Dye-Sensitized Solar Cells Based on Ionic Liquids‏
670 ‎‡a Author's Cyclic Voltammetry Studies of Nanoporous Semiconductors. Capacitive and Reactive Properties of Nanocrystalline TiO2Electrodes in Aqueous Electrolyte‏
670 ‎‡a Author's Decoupling of Transport, Charge Storage, and Interfacial Charge Transfer in the Nanocrystalline TiO2/Electrolyte System by Impedance Methods‏
670 ‎‡a Author's Deleterious Effect of Negative Capacitance on the Performance of Halide Perovskite Solar Cells‏
670 ‎‡a Author's Design and characterization of alkoxy-wrapped push–pull porphyrins for dye-sensitized solar cells‏
670 ‎‡a Author's Determination of carrier density of ZnO nanowires by electrochemical techniques‏
670 ‎‡a Author's Determination of electron and hole energy levels in mesoporous nanocrystalline TiO2 solid-state dye solar cell‏
670 ‎‡a Author's Determination of the humidity of soil by monitoring the conductivity with indium tin oxide glass electrodes‏
670 ‎‡a Author's Diffusion-Recombination Impedance Model for Solar Cells with Disorder and Nonlinear Recombination‏
670 ‎‡a Author's Doping saturation in dye-sensitized solar cells based on ZnO:Ga nanostructured photoanodes‏
670 ‎‡a Author's Doubling Exponent Models for the Analysis of Porous Film Electrodes by Impedance. Relaxation of TiO2Nanoporous in Aqueous Solution‏
670 ‎‡a Author's Dye versus Quantum Dots in Sensitized Solar Cells: Participation of Quantum Dot Absorber in the Recombination Process‏
670 ‎‡a Author's Dynamic behaviour of viologen-activated nanostructured TiO2: correlation between kinetics of charging and coloration‏
670 ‎‡a Author's Dynamic Processes in the Coloration of WO[sub 3] by Lithium Insertion‏
670 ‎‡a Author's Effect of Environmental Humidity on the Electrical Properties of Lead Halide Perovskites‏
670 ‎‡a Author's EFFECT OF THE CHROMOPHORES STRUCTURES ON THE PERFORMANCE OF SOLID-STATE DYE SENSITIZED SOLAR CELLS‏
670 ‎‡a Author's Effect of trap density on the dielectric response of varistor ceramics‏
670 ‎‡a Author's Electrochemical and photoelectrochemical investigation of water oxidation with hematite electrodes‏
670 ‎‡a Author's Electron injection and scaffold effects in perovskite solar cells‏
670 ‎‡a Author's Electron Lifetime in Dye-Sensitized Solar Cells: Theory and Interpretation of Measurements‏
670 ‎‡a Author's Electron-Transfer Kinetics through Interfaces between Electron-Transport and Ion-Transport Layers in Solid-State Dye-Sensitized Solar Cells Utilizing Solid Polymer Electrolyte‏
670 ‎‡a Author's Electron Transport and Recombination in Solid-State Dye Solar Cell with Spiro-OMeTAD as Hole Conductor‏
670 ‎‡a Author's Electron Transport in Dye-Sensitized Solar Cells Based on ZnO Nanotubes: Evidence for Highly Efficient Charge Collection and Exceptionally Rapid Dynamics†‏
670 ‎‡a Author's Electron trapping induced electrostatic adsorption of cations: a general factor leading to photoactivity decay of nanostructured TiO2‏
670 ‎‡a Author's Electronic conductivity in nanostructured TiO2 films permeated with electrolyte‏
670 ‎‡a Author's Elucidating capacitance and resistance terms in confined electroactive molecular layers‏
670 ‎‡a Author's Energetic factors governing injection, regeneration and recombination in dye solar cells with phthalocyanine sensitizers‏
670 ‎‡a Author's Enhanced Carrier Transport Distance in Colloidal PbS Quantum-Dot-Based Solar Cells Using ZnO Nanowires‏
670 ‎‡a Author's Enhanced diffusion through porous nanoparticle optical multilayers‏
670 ‎‡a Author's Erratum: Selective contacts drive charge extraction in quantum dot solids via asymmetry in carrier transfer kinetics‏
670 ‎‡a Author's Exploring Graphene Quantum Dots/TiO2 interface in photoelectrochemical reactions: Solar to fuel conversion‏
670 ‎‡a Author's Factors determining the photovoltaic performance of a CdSe quantum dot sensitized solar cell: the role of the linker molecule and of the counter electrode‏
670 ‎‡a Author's Frequency dispersion in electrochromic devices and conducting polymer electrodes: A generalized transmission line approach‏
670 ‎‡a Author's From Flat to Nanostructured Photovoltaics: Balance between Thickness of the Absorber and Charge Screening in Sensitized Solar Cells‏
670 ‎‡a Author's General Working Principles of CH3NH3PbX3 Perovskite Solar Cells‏
670 ‎‡a Author's Harnessing Infrared Photons for Photoelectrochemical Hydrogen Generation. A PbS Quantum Dot Based "Quasi-Artificial Leaf".‏
670 ‎‡a Author's High carrier density and capacitance in TiO2 nanotube arrays induced by electrochemical doping.‏
670 ‎‡a Author's Hole conductivity and acceptor density of p-type CuGaO2 nanoparticles determined by impedance spectroscopy: The effect of Mg doping‏
670 ‎‡a Author's Hydrazine sensors development based on a glassy carbon electrode modified with a nanostructured TiO2 films by electrochemical approach‏
670 ‎‡a Author's Identifying charge and mass transfer resistances of an oxygen reducing biocathode‏
670 ‎‡a Author's Impedance Spectroscopy Analysis of the Effect of TiO2 Blocking Layers on the Efficiency of Dye Sensitized Solar Cells‏
670 ‎‡a Author's Impedance Spectroscopy in Molecular Devices‏
670 ‎‡a Author's Impedance spectroscopy of thin-film CdTe/CdS solar cells under varied illumination‏
670 ‎‡a Author's Impedance spectroscopy study of dye-sensitized solar cells with undoped spiro-OMeTAD as hole conductor‏
670 ‎‡a Author's Implications of the negative capacitance observed at forward bias in nanocomposite and polycrystalline solar cells.‏
670 ‎‡a Author's In situ Biofilm Quantification in Bioelectrochemical Systems by using Optical Coherence Tomography‏
670 ‎‡a Author's Influence of electrolyte in transport and recombination in dye-sensitized solar cells studied by impedance spectroscopy‏
670 ‎‡a Author's Injection and Recombination in Dye-Sensitized Solar Cells with a Broadband Absorbance Metal-Free Sensitizer Based on Oligothienylvinylene‏
670 ‎‡a Author's Interfacial engineering of quantum dot-sensitized TiO2 fibrous electrodes for futuristic photoanodes in photovoltaic applications‏
670 ‎‡a Author's Interpretation of Cyclic Voltammetry Measurements of Thin Semiconductor Films for Solar Fuel Applications‏
670 ‎‡a Author's Joint Photophysical and Electrical Analyses on the Influence of Conjugation Order in D-π-A Photosensitizers of Mesoscopic Titania Solar Cells‏
670 ‎‡a Author's Mechanism of carrier accumulation in perovskite thin-absorber solar cells‏
670 ‎‡a Author's Modeling and characterization of extremely thin absorber‏
670 ‎‡a Author's Modeling and characterization of extremely thin absorber (eta) solar cells based on ZnO nanowires‏
670 ‎‡a Author's Modelling the electric potential distribution in the dark in nanoporous semiconductor electrodes‏
670 ‎‡a Author's Mott-Schottky Analysis of Nanoporous Semiconductor Electrodes in Dielectric State Deposited on SnO[sub 2]‏
670 ‎‡a Author's Mott-Schottky Analysis of Nanoporous Semiconductor Electrodes in Dielectric State Deposited on SnO[sub 2](F) Conducting Substrates‏
670 ‎‡a Author's Nature of the Schottky-type barrier of highly dense SnO2 systems displaying nonohmic behavior‏
670 ‎‡a Author's Near-IR sensitization of wide band gap oxide semiconductor by axially anchored Si-naphthalocyanines‏
670 ‎‡a Author's Origin of efficiency enhancement in Nb2O5 coated titanium dioxide nanorod based dye sensitized solar cells‏
670 ‎‡a Author's Overcoming Charge Collection Limitation at Solid/Liquid Interface by a Controllable Crystal Deficient Overlayer‏
670 ‎‡a Author's Panchromatic Solar-to-H2 Conversion by a Hybrid Quantum Dots–Dye Dual Absorber Tandem Device‏
670 ‎‡a Author's Photoelectrochemical and Impedance Spectroscopic Investigation of Water Oxidation with “Co–Pi” -Coated Hematite Electrodes‏
670 ‎‡a Author's Platinum-coated nanostructured oxides for active catalytic electrodes‏
670 ‎‡a Author's Quantification of bio-anode capacitance in bioelectrochemical systems using Electrochemical Impedance Spectroscopy‏
670 ‎‡a Author's Quantum Dot Based Heterostructures for Unassisted Photoelectrochemical Hydrogen Generation‏
670 ‎‡a Author's Recombination in Quantum Dot Sensitized Solar Cells‏
670 ‎‡a Author's Relaxation processes in the coloration of amorphous WO3 thin films studied by combined impedance and electro-optical measurements‏
670 ‎‡a Author's Role of the Selective Contacts in the Performance of Lead Halide Perovskite Solar Cells‏
670 ‎‡a Author's Selective contacts drive charge extraction in quantum dot solids via asymmetry in carrier transfer kinetics‏
670 ‎‡a Author's SiO2 Aerogel Templated, Porous TiO2 Photoanodes for Enhanced Performance in Dye-Sensitized Solar Cells Containing a Ni(III)/(IV) Bis(dicarbollide) Shuttle‏
670 ‎‡a Author's Stability of dye-sensitized solar cells under extended thermal stress.‏
670 ‎‡a Author's Surface Polarization Model for the Dynamic Hysteresis of Perovskite Solar Cells.‏
670 ‎‡a Author's Surface Recombination and Collection Efficiency in Perovskite Solar Cells from Impedance Analysis‏
670 ‎‡a Author's Switching behaviour in lightly doped polymeric porous film electrodes. Improving distributed impedance models for mixed conduction conditions‏
670 ‎‡a Author's Temperature effects in dye-sensitized solar cells‏
670 ‎‡a Author's The combination of a polymer–carbon composite electrode with a high-absorptivity ruthenium dye achieves an efficient dye-sensitized solar cell based on a thiolate–disulfide redox couple‏
670 ‎‡a Author's The origin of slow electron recombination processes in dye-sensitized solar cells with alumina barrier coatings‏
670 ‎‡a Author's Theoretical models for ac impedance of finite diffusion layers exhibiting low frequency dispersion‏
670 ‎‡a Author's Three-channel transmission line impedance model for mesoscopic oxide electrodes functionalized with a conductive coating.‏
670 ‎‡a Author's Three dimensional-TiO2 nanotube array photoanode architectures assembled on a thin hollow nanofibrous backbone and their performance in quantum dot-sensitized solar cells‏
670 ‎‡a Author's TiO2 Nanotubes for Solar Water Splitting: Vacuum Annealing and Zr Doping Enhance Water Oxidation Kinetics‏
670 ‎‡a Author's Understanding the Role of Underlayers and Overlayers in Thin Film Hematite Photoanodes‏
670 ‎‡a Author's Water Oxidation at Hematite Photoelectrodes: The Role of Surface States‏
670 ‎‡a Author's Water Oxidation at Hematite Photoelectrodes with an Iridium-Based Catalyst‏
909 ‎‡a (orcid) 0000000275031245‏ ‎‡9 1‏
919 ‎‡a carboncounterelectrodebasedquantumdotsensitizedsolarcellswithcertifiedefficiencyexceeding11‏ ‎‡A Carbon Counter-Electrode-Based Quantum-Dot-Sensitized Solar Cells with Certified Efficiency Exceeding 11.‏ ‎‡9 1‏
919 ‎‡a characteristicsofhighefficiencydyesensitizedsolarcells‏ ‎‡A Characteristics of high efficiency dye-sensitized solar cells‏ ‎‡9 1‏
919 ‎‡a characterizationofnanostructuredhybridandorganicsolarcellsbyimpedancespectroscopy‏ ‎‡A Characterization of nanostructured hybrid and organic solar cells by impedance spectroscopy‏ ‎‡9 1‏
919 ‎‡a chemicalcapacitanceofnanoporousnanocrystallinetio2inaroomtemperatureionicliquid‏ ‎‡A Chemical capacitance of nanoporous-nanocrystalline TiO2in a room temperature ionic liquid‏ ‎‡9 1‏
919 ‎‡a chemicaleffectsoftinoxidenanoparticlesinpolymerelectrolytesbaseddyesensitizedsolarcells‏ ‎‡A Chemical Effects of Tin Oxide Nanoparticles in Polymer Electrolytes-Based Dye-Sensitized Solar Cells‏ ‎‡9 1‏
919 ‎‡a competitivephotoelectrochemicalmethanolandwateroxidationwithhematiteelectrodes‏ ‎‡A Competitive Photoelectrochemical Methanol and Water Oxidation with Hematite Electrodes‏ ‎‡9 1‏
919 ‎‡a correlationbetweenphotovoltaicperformanceandimpedancespectroscopyofdyesensitizedsolarcellsbasedonionicliquids‏ ‎‡A Correlation between Photovoltaic Performance and Impedance Spectroscopy of Dye-Sensitized Solar Cells Based on Ionic Liquids‏ ‎‡9 1‏
919 ‎‡a cyclicvoltammetrystudiesofnanoporoussemiconductorscapacitiveandreactivepropertiesofnanocrystallinetio2electrodesinaqueouselectrolyte‏ ‎‡A Cyclic Voltammetry Studies of Nanoporous Semiconductors. Capacitive and Reactive Properties of Nanocrystalline TiO2Electrodes in Aqueous Electrolyte‏ ‎‡9 1‏
919 ‎‡a decouplingoftransportchargestorageandinterfacialchargetransferinthenanocrystallinetio2electrolytesystembyimpedancemethods‏ ‎‡A Decoupling of Transport, Charge Storage, and Interfacial Charge Transfer in the Nanocrystalline TiO2/Electrolyte System by Impedance Methods‏ ‎‡9 1‏
919 ‎‡a deleteriouseffectofnegativecapacitanceontheperformanceofhalideperovskitesolarcells‏ ‎‡A Deleterious Effect of Negative Capacitance on the Performance of Halide Perovskite Solar Cells‏ ‎‡9 1‏
919 ‎‡a interpretationofcyclicvoltammetrymeasurementsofthinsemiconductorfilmsforsolarfuelapplications‏ ‎‡A Interpretation of Cyclic Voltammetry Measurements of Thin Semiconductor Films for Solar Fuel Applications‏ ‎‡9 1‏
919 ‎‡a designandcharacterizationofalkoxywrappedpushpullporphyrinsfordyesensitizedsolarcells‏ ‎‡A Design and characterization of alkoxy-wrapped push–pull porphyrins for dye-sensitized solar cells‏ ‎‡9 1‏
919 ‎‡a interfacialengineeringofquantumdotsensitizedtio2fibrouselectrodesforfuturisticphotoanodesinphotovoltaicapplications‏ ‎‡A Interfacial engineering of quantum dot-sensitized TiO2 fibrous electrodes for futuristic photoanodes in photovoltaic applications‏ ‎‡9 1‏
919 ‎‡a injectionandrecombinationindyesensitizedsolarcellswithabroadbandabsorbancemetalfreesensitizerbasedonoligothienylvinylene‏ ‎‡A Injection and Recombination in Dye-Sensitized Solar Cells with a Broadband Absorbance Metal-Free Sensitizer Based on Oligothienylvinylene‏ ‎‡9 1‏
919 ‎‡a influenceofelectrolyteintransportandrecombinationindyesensitizedsolarcellsstudiedbyimpedancespectroscopy‏ ‎‡A Influence of electrolyte in transport and recombination in dye-sensitized solar cells studied by impedance spectroscopy‏ ‎‡9 1‏
919 ‎‡a determinationofcarrierdensityofznonanowiresbyelectrochemicaltechniques‏ ‎‡A Determination of carrier density of ZnO nanowires by electrochemical techniques‏ ‎‡9 1‏
919 ‎‡a insitubiofilmquantificationinbioelectrochemicalsystemsbyusingopticalcoherencetomography‏ ‎‡A In situ Biofilm Quantification in Bioelectrochemical Systems by using Optical Coherence Tomography‏ ‎‡9 1‏
919 ‎‡a implicationsofthenegativecapacitanceobservedatforwardbiasinnanocompositeandpolycrystallinesolarcells‏ ‎‡A Implications of the negative capacitance observed at forward bias in nanocomposite and polycrystalline solar cells.‏ ‎‡9 1‏
919 ‎‡a impedancespectroscopystudyofdyesensitizedsolarcellswithundopedspiroometadasholeconductor‏ ‎‡A Impedance spectroscopy study of dye-sensitized solar cells with undoped spiro-OMeTAD as hole conductor‏ ‎‡9 1‏
919 ‎‡a determinationofelectronandholeenergylevelsinmesoporousnanocrystallinetio2solidstatedyesolarcell‏ ‎‡A Determination of electron and hole energy levels in mesoporous nanocrystalline TiO2 solid-state dye solar cell‏ ‎‡9 1‏
919 ‎‡a impedancespectroscopyofthinfilmcdtecdssolarcellsundervariedillumination‏ ‎‡A Impedance spectroscopy of thin-film CdTe/CdS solar cells under varied illumination‏ ‎‡9 1‏
919 ‎‡a impedancespectroscopyinmoleculardevices‏ ‎‡A Impedance Spectroscopy in Molecular Devices‏ ‎‡9 1‏
919 ‎‡a impedancespectroscopyanalysisoftheeffectoftio2blockinglayersontheefficiencyofdyesensitizedsolarcells‏ ‎‡A Impedance Spectroscopy Analysis of the Effect of TiO2 Blocking Layers on the Efficiency of Dye Sensitized Solar Cells‏ ‎‡9 1‏
919 ‎‡a determinationofthehumidityofsoilbymonitoringtheconductivitywithindiumtinoxideglasselectrodes‏ ‎‡A Determination of the humidity of soil by monitoring the conductivity with indium tin oxide glass electrodes‏ ‎‡9 1‏
919 ‎‡a identifyingchargeandmasstransferresistancesofanoxygenreducingbiocathode‏ ‎‡A Identifying charge and mass transfer resistances of an oxygen reducing biocathode‏ ‎‡9 1‏
919 ‎‡a hydrazinesensorsdevelopmentbasedonaglassycarbonelectrodemodifiedwithananostructuredtio2filmsbyelectrochemicalapproach‏ ‎‡A Hydrazine sensors development based on a glassy carbon electrode modified with a nanostructured TiO2 films by electrochemical approach‏ ‎‡9 1‏
919 ‎‡a holeconductivityandacceptordensityofptypecugao2nanoparticlesdeterminedbyimpedancespectroscopytheeffectofmgdoping‏ ‎‡A Hole conductivity and acceptor density of p-type CuGaO2 nanoparticles determined by impedance spectroscopy: The effect of Mg doping‏ ‎‡9 1‏
919 ‎‡a diffusionrecombinationimpedancemodelforsolarcellswithdisorderandnonlinearrecombination‏ ‎‡A Diffusion-Recombination Impedance Model for Solar Cells with Disorder and Nonlinear Recombination‏ ‎‡9 1‏
919 ‎‡a highcarrierdensityandcapacitanceintio2nanotubearraysinducedbyelectrochemicaldoping‏ ‎‡A High carrier density and capacitance in TiO2 nanotube arrays induced by electrochemical doping.‏ ‎‡9 1‏
919 ‎‡a harnessinginfraredphotonsforphotoelectrochemicalhydrogengenerationapbsquantumdotbasedquasiartificialleaf‏ ‎‡A Harnessing Infrared Photons for Photoelectrochemical Hydrogen Generation. A PbS Quantum Dot Based "Quasi-Artificial Leaf".‏ ‎‡9 1‏
919 ‎‡a generalworkingprinciplesofch3nh3pbx3perovskitesolarcells‏ ‎‡A General Working Principles of CH3NH3PbX3 Perovskite Solar Cells‏ ‎‡9 1‏
919 ‎‡a dopingsaturationindyesensitizedsolarcellsbasedonznogananostructuredphotoanodes‏ ‎‡A Doping saturation in dye-sensitized solar cells based on ZnO:Ga nanostructured photoanodes‏ ‎‡9 1‏
919 ‎‡a fromflattonanostructuredphotovoltaicsbalancebetweenthicknessoftheabsorberandchargescreeninginsensitizedsolarcells‏ ‎‡A From Flat to Nanostructured Photovoltaics: Balance between Thickness of the Absorber and Charge Screening in Sensitized Solar Cells‏ ‎‡9 1‏
919 ‎‡a frequencydispersioninelectrochromicdevicesandconductingpolymerelectrodesageneralizedtransmissionlineapproach‏ ‎‡A Frequency dispersion in electrochromic devices and conducting polymer electrodes: A generalized transmission line approach‏ ‎‡9 1‏
919 ‎‡a factorsdeterminingthephotovoltaicperformanceofacdsequantumdotsensitizedsolarcelltheroleofthelinkermoleculeandofthecounterelectrode‏ ‎‡A Factors determining the photovoltaic performance of a CdSe quantum dot sensitized solar cell: the role of the linker molecule and of the counter electrode‏ ‎‡9 1‏
919 ‎‡a doublingexponentmodelsfortheanalysisofporousfilmelectrodesbyimpedancerelaxationoftio2nanoporousinaqueoussolution‏ ‎‡A Doubling Exponent Models for the Analysis of Porous Film Electrodes by Impedance. Relaxation of TiO2Nanoporous in Aqueous Solution‏ ‎‡9 1‏
919 ‎‡a exploringgraphenequantumdotstio2interfaceinphotoelectrochemicalreactionssolartofuelconversion‏ ‎‡A Exploring Graphene Quantum Dots/TiO2 interface in photoelectrochemical reactions: Solar to fuel conversion‏ ‎‡9 1‏
919 ‎‡a erratumselectivecontactsdrivechargeextractioninquantumdotsolidsviaasymmetryincarriertransferkinetics‏ ‎‡A Erratum: Selective contacts drive charge extraction in quantum dot solids via asymmetry in carrier transfer kinetics‏ ‎‡9 1‏
919 ‎‡a enhanceddiffusionthroughporousnanoparticleopticalmultilayers‏ ‎‡A Enhanced diffusion through porous nanoparticle optical multilayers‏ ‎‡9 1‏
919 ‎‡a dyeversusquantumdotsinsensitizedsolarcellsparticipationofquantumdotabsorberintherecombinationprocess‏ ‎‡A Dye versus Quantum Dots in Sensitized Solar Cells: Participation of Quantum Dot Absorber in the Recombination Process‏ ‎‡9 1‏
919 ‎‡a enhancedcarriertransportdistanceincolloidalpbsquantumdotbasedsolarcellsusingznonanowires‏ ‎‡A Enhanced Carrier Transport Distance in Colloidal PbS Quantum-Dot-Based Solar Cells Using ZnO Nanowires‏ ‎‡9 1‏
919 ‎‡a energeticfactorsgoverninginjectionregenerationandrecombinationindyesolarcellswithphthalocyaninesensitizers‏ ‎‡A Energetic factors governing injection, regeneration and recombination in dye solar cells with phthalocyanine sensitizers‏ ‎‡9 1‏
919 ‎‡a elucidatingcapacitanceandresistancetermsinconfinedelectroactivemolecularlayers‏ ‎‡A Elucidating capacitance and resistance terms in confined electroactive molecular layers‏ ‎‡9 1‏
919 ‎‡a dynamicbehaviourofviologenactivatednanostructuredtio2correlationbetweenkineticsofchargingandcoloration‏ ‎‡A Dynamic behaviour of viologen-activated nanostructured TiO2: correlation between kinetics of charging and coloration‏ ‎‡9 1‏
919 ‎‡a electronicconductivityinnanostructuredtio2filmspermeatedwithelectrolyte‏ ‎‡A Electronic conductivity in nanostructured TiO2 films permeated with electrolyte‏ ‎‡9 1‏
919 ‎‡a electrontrappinginducedelectrostaticadsorptionofcationsageneralfactorleadingtophotoactivitydecayofnanostructuredtio2‏ ‎‡A Electron trapping induced electrostatic adsorption of cations: a general factor leading to photoactivity decay of nanostructured TiO2‏ ‎‡9 1‏
919 ‎‡a electrontransportindyesensitizedsolarcellsbasedonznonanotubesevidenceforhighlyefficientchargecollectionandexceptionallyrapiddynamics‏ ‎‡A Electron Transport in Dye-Sensitized Solar Cells Based on ZnO Nanotubes: Evidence for Highly Efficient Charge Collection and Exceptionally Rapid Dynamics†‏ ‎‡9 1‏
919 ‎‡a dynamicprocessesinthecolorationofwobylithiuminsertion‏ ‎‡A Dynamic Processes in the Coloration of WO[sub 3] by Lithium Insertion‏ ‎‡9 1‏
919 ‎‡a electrontransportandrecombinationinsolidstatedyesolarcellwithspiroometadasholeconductor‏ ‎‡A Electron Transport and Recombination in Solid-State Dye Solar Cell with Spiro-OMeTAD as Hole Conductor‏ ‎‡9 1‏
919 ‎‡a electrontransferkineticsthroughinterfacesbetweenelectrontransportandiontransportlayersinsolidstatedyesensitizedsolarcellsutilizingsolidpolymerelectrolyte‏ ‎‡A Electron-Transfer Kinetics through Interfaces between Electron-Transport and Ion-Transport Layers in Solid-State Dye-Sensitized Solar Cells Utilizing Solid Polymer Electrolyte‏ ‎‡9 1‏
919 ‎‡a electronlifetimeindyesensitizedsolarcellstheoryandinterpretationofmeasurements‏ ‎‡A Electron Lifetime in Dye-Sensitized Solar Cells: Theory and Interpretation of Measurements‏ ‎‡9 1‏
919 ‎‡a effectofenvironmentalhumidityontheelectricalpropertiesofleadhalideperovskites‏ ‎‡A Effect of Environmental Humidity on the Electrical Properties of Lead Halide Perovskites‏ ‎‡9 1‏
919 ‎‡a effectofthechromophoresstructuresontheperformanceofsolidstatedyesensitizedsolarcells‏ ‎‡A EFFECT OF THE CHROMOPHORES STRUCTURES ON THE PERFORMANCE OF SOLID-STATE DYE SENSITIZED SOLAR CELLS‏ ‎‡9 1‏
919 ‎‡a effectoftrapdensityonthedielectricresponseofvaristorceramics‏ ‎‡A Effect of trap density on the dielectric response of varistor ceramics‏ ‎‡9 1‏
919 ‎‡a electrochemicalandphotoelectrochemicalinvestigationofwateroxidationwithhematiteelectrodes‏ ‎‡A Electrochemical and photoelectrochemical investigation of water oxidation with hematite electrodes‏ ‎‡9 1‏
919 ‎‡a electroninjectionandscaffoldeffectsinperovskitesolarcells‏ ‎‡A Electron injection and scaffold effects in perovskite solar cells‏ ‎‡9 1‏
919 ‎‡a carrierdensityandinterfacialkineticsofmesoporoustio2inaqueouselectrolytedeterminedbyimpedancespectroscopy‏ ‎‡A Carrier density and interfacial kinetics of mesoporous TiO2 in aqueous electrolyte determined by impedance spectroscopy‏ ‎‡9 1‏
919 ‎‡a wateroxidationathematitephotoelectrodeswithaniridiumbasedcatalyst‏ ‎‡A Water Oxidation at Hematite Photoelectrodes with an Iridium-Based Catalyst‏ ‎‡9 1‏
919 ‎‡a wateroxidationathematitephotoelectrodestheroleofsurfacestates‏ ‎‡A Water Oxidation at Hematite Photoelectrodes: The Role of Surface States‏ ‎‡9 1‏
919 ‎‡a understandingtheroleofunderlayersandoverlayersinthinfilmhematitephotoanodes‏ ‎‡A Understanding the Role of Underlayers and Overlayers in Thin Film Hematite Photoanodes‏ ‎‡9 1‏
919 ‎‡a tio2nanotubesforsolarwatersplittingvacuumannealingandzrdopingenhancewateroxidationkinetics‏ ‎‡A TiO2 Nanotubes for Solar Water Splitting: Vacuum Annealing and Zr Doping Enhance Water Oxidation Kinetics‏ ‎‡9 1‏
919 ‎‡a 3dimensionaltio2nanotubearrayphotoanodearchitecturesassembledonathinhollownanofibrousbackboneandtheirperformanceinquantumdotsensitizedsolarcells‏ ‎‡A Three dimensional-TiO2 nanotube array photoanode architectures assembled on a thin hollow nanofibrous backbone and their performance in quantum dot-sensitized solar cells‏ ‎‡9 1‏
919 ‎‡a 3channeltransmissionlineimpedancemodelformesoscopicoxideelectrodesfunctionalizedwithaconductivecoating‏ ‎‡A Three-channel transmission line impedance model for mesoscopic oxide electrodes functionalized with a conductive coating.‏ ‎‡9 1‏
919 ‎‡a theoreticalmodelsforacimpedanceoffinitediffusionlayersexhibitinglowfrequencydispersion‏ ‎‡A Theoretical models for ac impedance of finite diffusion layers exhibiting low frequency dispersion‏ ‎‡9 1‏
919 ‎‡a originofslowelectronrecombinationprocessesindyesensitizedsolarcellswithaluminabarriercoatings‏ ‎‡A The origin of slow electron recombination processes in dye-sensitized solar cells with alumina barrier coatings‏ ‎‡9 1‏
919 ‎‡a combinationofapolymercarboncompositeelectrodewithahighabsorptivityrutheniumdyeachievesanefficientdyesensitizedsolarcellbasedonathiolatedisulfideredoxcouple‏ ‎‡A The combination of a polymer–carbon composite electrode with a high-absorptivity ruthenium dye achieves an efficient dye-sensitized solar cell based on a thiolate–disulfide redox couple‏ ‎‡9 1‏
919 ‎‡a temperatureeffectsindyesensitizedsolarcells‏ ‎‡A Temperature effects in dye-sensitized solar cells‏ ‎‡9 1‏
919 ‎‡a switchingbehaviourinlightlydopedpolymericporousfilmelectrodesimprovingdistributedimpedancemodelsformixedconductionconditions‏ ‎‡A Switching behaviour in lightly doped polymeric porous film electrodes. Improving distributed impedance models for mixed conduction conditions‏ ‎‡9 1‏
919 ‎‡a surfacerecombinationandcollectionefficiencyinperovskitesolarcellsfromimpedanceanalysis‏ ‎‡A Surface Recombination and Collection Efficiency in Perovskite Solar Cells from Impedance Analysis‏ ‎‡9 1‏
919 ‎‡a surfacepolarizationmodelforthedynamichysteresisofperovskitesolarcells‏ ‎‡A Surface Polarization Model for the Dynamic Hysteresis of Perovskite Solar Cells.‏ ‎‡9 1‏
919 ‎‡a stabilityofdyesensitizedsolarcellsunderextendedthermalstress‏ ‎‡A Stability of dye-sensitized solar cells under extended thermal stress.‏ ‎‡9 1‏
919 ‎‡a sio2aerogeltemplatedporoustio2photoanodesforenhancedperformanceindyesensitizedsolarcellscontaininga234bisdicarbollideshuttle‏ ‎‡A SiO2 Aerogel Templated, Porous TiO2 Photoanodes for Enhanced Performance in Dye-Sensitized Solar Cells Containing a Ni(III)/(IV) Bis(dicarbollide) Shuttle‏ ‎‡9 1‏
919 ‎‡a selectivecontactsdrivechargeextractioninquantumdotsolidsviaasymmetryincarriertransferkinetics‏ ‎‡A Selective contacts drive charge extraction in quantum dot solids via asymmetry in carrier transfer kinetics‏ ‎‡9 1‏
919 ‎‡a roleoftheselectivecontactsintheperformanceofleadhalideperovskitesolarcells‏ ‎‡A Role of the Selective Contacts in the Performance of Lead Halide Perovskite Solar Cells‏ ‎‡9 1‏
919 ‎‡a relaxationprocessesinthecolorationofamorphouswo3thinfilmsstudiedbycombinedimpedanceandelectroopticalmeasurements‏ ‎‡A Relaxation processes in the coloration of amorphous WO3 thin films studied by combined impedance and electro-optical measurements‏ ‎‡9 1‏
919 ‎‡a recombinationinquantumdotsensitizedsolarcells‏ ‎‡A Recombination in Quantum Dot Sensitized Solar Cells‏ ‎‡9 1‏
919 ‎‡a quantumdotbasedheterostructuresforunassistedphotoelectrochemicalhydrogengeneration‏ ‎‡A Quantum Dot Based Heterostructures for Unassisted Photoelectrochemical Hydrogen Generation‏ ‎‡9 1‏
919 ‎‡a quantificationofbioanodecapacitanceinbioelectrochemicalsystemsusingelectrochemicalimpedancespectroscopy‏ ‎‡A Quantification of bio-anode capacitance in bioelectrochemical systems using Electrochemical Impedance Spectroscopy‏ ‎‡9 1‏
919 ‎‡a platinumcoatednanostructuredoxidesforactivecatalyticelectrodes‏ ‎‡A Platinum-coated nanostructured oxides for active catalytic electrodes‏ ‎‡9 1‏
919 ‎‡a photoelectrochemicalandimpedancespectroscopicinvestigationofwateroxidationwithcopicoatedhematiteelectrodes‏ ‎‡A Photoelectrochemical and Impedance Spectroscopic Investigation of Water Oxidation with “Co–Pi” -Coated Hematite Electrodes‏ ‎‡9 1‏
919 ‎‡a panchromaticsolartoh2conversionbyahybridquantumdotsdyedualabsorbertandemdevice‏ ‎‡A Panchromatic Solar-to-H2 Conversion by a Hybrid Quantum Dots–Dye Dual Absorber Tandem Device‏ ‎‡9 1‏
919 ‎‡a overcomingchargecollectionlimitationatsolidliquidinterfacebyacontrollablecrystaldeficientoverlayer‏ ‎‡A Overcoming Charge Collection Limitation at Solid/Liquid Interface by a Controllable Crystal Deficient Overlayer‏ ‎‡9 1‏
919 ‎‡a originofefficiencyenhancementinnb2o5coatedtitaniumdioxidenanorodbaseddyesensitizedsolarcells‏ ‎‡A Origin of efficiency enhancement in Nb2O5 coated titanium dioxide nanorod based dye sensitized solar cells‏ ‎‡9 1‏
919 ‎‡a nearirsensitizationofwidebandgapoxidesemiconductorbyaxiallyanchoredsinaphthalocyanines‏ ‎‡A Near-IR sensitization of wide band gap oxide semiconductor by axially anchored Si-naphthalocyanines‏ ‎‡9 1‏
919 ‎‡a natureoftheschottkytypebarrierofhighlydensesno2systemsdisplayingnonohmicbehavior‏ ‎‡A Nature of the Schottky-type barrier of highly dense SnO2 systems displaying nonohmic behavior‏ ‎‡9 1‏
919 ‎‡a mottschottkyanalysisofnanoporoussemiconductorelectrodesindielectricstatedepositedonsnofconductingsubstrates‏ ‎‡A Mott-Schottky Analysis of Nanoporous Semiconductor Electrodes in Dielectric State Deposited on SnO[sub 2](F) Conducting Substrates‏ ‎‡9 1‏
919 ‎‡a mottschottkyanalysisofnanoporoussemiconductorelectrodesindielectricstatedepositedonsno‏ ‎‡A Mott-Schottky Analysis of Nanoporous Semiconductor Electrodes in Dielectric State Deposited on SnO[sub 2]‏ ‎‡9 1‏
919 ‎‡a modellingtheelectricpotentialdistributioninthedarkinnanoporoussemiconductorelectrodes‏ ‎‡A Modelling the electric potential distribution in the dark in nanoporous semiconductor electrodes‏ ‎‡9 1‏
919 ‎‡a modelingandcharacterizationofextremelythinabsorberetasolarcellsbasedonznonanowires‏ ‎‡A Modeling and characterization of extremely thin absorber (eta) solar cells based on ZnO nanowires‏ ‎‡9 1‏
919 ‎‡a modelingandcharacterizationofextremelythinabsorber‏ ‎‡A Modeling and characterization of extremely thin absorber‏ ‎‡9 1‏
919 ‎‡a mechanismofcarrieraccumulationinperovskitethinabsorbersolarcells‏ ‎‡A Mechanism of carrier accumulation in perovskite thin-absorber solar cells‏ ‎‡9 1‏
919 ‎‡a jointphotophysicalandelectricalanalysesontheinfluenceofconjugationorderin500πaphotosensitizersofmesoscopictitaniasolarcells‏ ‎‡A Joint Photophysical and Electrical Analyses on the Influence of Conjugation Order in D-π-A Photosensitizers of Mesoscopic Titania Solar Cells‏ ‎‡9 1‏
919 ‎‡a perspectiveontheproductionofdyesensitizedsolarmodules‏ ‎‡A A perspective on the production of dye-sensitized solar modules‏ ‎‡9 1‏
919 ‎‡a reviewofrecentresultsonelectrochemicaldeterminationofthedensityofelectronicstatesofnanostructuredmetaloxidesemiconductorsandorganicholeconductors‏ ‎‡A A review of recent results on electrochemical determination of the density of electronic states of nanostructured metal-oxide semiconductors and organic hole conductors‏ ‎‡9 1‏
919 ‎‡a analysisofbioanodeperformancethroughelectrochemicalimpedancespectroscopy‏ ‎‡A Analysis of bio-anode performance through electrochemical impedance spectroscopy.‏ ‎‡9 1‏
919 ‎‡a analysisofcyclicvoltammogramsofelectrochromicawo3filmsfromvoltagedependentequilibriumcapacitancemeasurements‏ ‎‡A Analysis of cyclic voltammograms of electrochromic a-WO3 films from voltage-dependent equilibrium capacitance measurements‏ ‎‡9 1‏
919 ‎‡a analysisoftheoriginofopencircuitvoltageindyesolarcells‏ ‎‡A Analysis of the Origin of Open Circuit Voltage in Dye Solar Cells‏ ‎‡9 1‏
919 ‎‡a anomaloustransporteffectsintheimpedanceofporousfilmelectrodes‏ ‎‡A Anomalous transport effects in the impedance of porous film electrodes‏ ‎‡9 1‏
919 ‎‡a anomaloustransportonpolymericporousfilmelectrodesinthedopantinducedinsulatortoconductortransitionanalyzedbyelectrochemicalimpedance‏ ‎‡A Anomalous transport on polymeric porous film electrodes in the dopant-induced insulator-to-conductor transition analyzed by electrochemical impedance‏ ‎‡9 1‏
919 ‎‡a bandgapmodulationinefficientnthiopheneabsorbersfordyesolarcellsensitization‏ ‎‡A Bandgap modulation in efficient n-thiophene absorbers for dye solar cell sensitization.‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 ISNI|0000000066688558‏
996 ‎‡2 ISNI|000000007140111X‏
996 ‎‡2 NYNYRILM|352276‏
996 ‎‡2 ISNI|0000000029923125‏
996 ‎‡2 BIBSYS|4104874‏
996 ‎‡2 DNB|1053293658‏
996 ‎‡2 BNE|XX1752195‏
996 ‎‡2 BNCHL|10000000000000000287562‏
996 ‎‡2 SUDOC|22399099X‏
996 ‎‡2 NYNYRILM|91997‏
996 ‎‡2 ISNI|0000000071409605‏
996 ‎‡2 BNE|XX1600093‏
996 ‎‡2 BNE|XX1458962‏
996 ‎‡2 PTBNP|1908754‏
996 ‎‡2 ISNI|0000000071005301‏
996 ‎‡2 ISNI|0000000092085435‏
996 ‎‡2 LC|n 2024024826‏
996 ‎‡2 PTBNP|148243‏
996 ‎‡2 SELIBR|197221‏
996 ‎‡2 LC|ns2022000335‏
996 ‎‡2 ARBABN|000065448‏
996 ‎‡2 NTA|128705922‏
996 ‎‡2 BNE|XX4881050‏
996 ‎‡2 BNF|12566751‏
996 ‎‡2 ISNI|000000008446606X‏
996 ‎‡2 BAV|495_304354‏
996 ‎‡2 BNF|13960919‏
996 ‎‡2 DNB|101694151X‏
996 ‎‡2 BNCHL|10000000000000000070316‏
996 ‎‡2 BNF|16569413‏
996 ‎‡2 LC|n 88297868‏
996 ‎‡2 ISNI|0000000069408822‏
996 ‎‡2 ISNI|0000000116174070‏
996 ‎‡2 BNF|14002285‏
996 ‎‡2 BNE|XX1644829‏
996 ‎‡2 BNC|981058612545606706‏
996 ‎‡2 BNE|XX943375‏
996 ‎‡2 SUDOC|225343991‏
996 ‎‡2 PTBNP|1559786‏
996 ‎‡2 SUDOC|165447508‏
996 ‎‡2 LC|n 92009450‏
996 ‎‡2 SUDOC|227938224‏
996 ‎‡2 BNE|XX4915181‏
996 ‎‡2 PTBNP|112428‏
996 ‎‡2 RERO|A005993657‏
996 ‎‡2 SUDOC|034973842‏
996 ‎‡2 DNB|1034881299‏
996 ‎‡2 BNF|17968139‏
996 ‎‡2 DNB|1056464631‏
996 ‎‡2 J9U|987007439798705171‏
996 ‎‡2 NUKAT|n 2022132521‏
996 ‎‡2 LC|n 2002012591‏
996 ‎‡2 LC|no2016060967‏
996 ‎‡2 BNE|XX5378924‏
996 ‎‡2 BNC|981058517591106706‏
996 ‎‡2 BNE|XX942849‏
996 ‎‡2 SUDOC|133634078‏
996 ‎‡2 ISNI|0000000054415552‏
996 ‎‡2 DNB|1060699265‏
996 ‎‡2 LC|no2014031930‏
996 ‎‡2 DNB|153343567‏
996 ‎‡2 ISNI|0000000079759749‏
996 ‎‡2 BNE|XX4681065‏
996 ‎‡2 ISNI|000000045189602X‏
996 ‎‡2 BNC|981058612408706706‏
996 ‎‡2 DNB|1057238007‏
996 ‎‡2 PTBNP|1359961‏
996 ‎‡2 BNE|XX947757‏
996 ‎‡2 LC|no 97023610‏
996 ‎‡2 BNE|XX1138440‏
996 ‎‡2 ISNI|0000000110252525‏
996 ‎‡2 BNE|XX5750645‏
996 ‎‡2 SUDOC|031957145‏
996 ‎‡2 BNE|XX1230060‏
996 ‎‡2 BNE|XX1040413‏
996 ‎‡2 BNE|XX1060149‏
996 ‎‡2 DNB|141496673‏
996 ‎‡2 PTBNP|1883795‏
996 ‎‡2 BNE|XX5039877‏
996 ‎‡2 LC|nr 91001099‏
996 ‎‡2 LC|no 93005646‏
996 ‎‡2 ISNI|0000000433739012‏
996 ‎‡2 BNE|XX1432857‏
996 ‎‡2 ISNI|0000000060522047‏
996 ‎‡2 PTBNP|1033822‏
996 ‎‡2 J9U|987007324974805171‏
996 ‎‡2 NTA|073739812‏
996 ‎‡2 RERO|A017206483‏
996 ‎‡2 BNF|15872817‏
996 ‎‡2 BNE|XX1506891‏
996 ‎‡2 DBC|87097992050750‏
996 ‎‡2 DNB|1097285235‏
996 ‎‡2 LC|n 85044272‏
996 ‎‡2 PTBNP|194385‏
996 ‎‡2 BNE|XX5500300‏
996 ‎‡2 DNB|1057474789‏
996 ‎‡2 SUDOC|112417000‏
996 ‎‡2 DNB|1192979648‏
996 ‎‡2 NYNYRILM|16288‏
996 ‎‡2 SUDOC|203583493‏
996 ‎‡2 BNE|XX1323846‏
996 ‎‡2 RERO|A011677989‏
996 ‎‡2 BAV|495_252843‏
996 ‎‡2 LC|nb 99021610‏
996 ‎‡2 BNE|XX844873‏
996 ‎‡2 ISNI|0000000503776151‏
996 ‎‡2 BNE|XX1035074‏
996 ‎‡2 BNF|16150892‏
996 ‎‡2 BNE|XX5536122‏
996 ‎‡2 ISNI|0000000070495820‏
996 ‎‡2 ISNI|0000000067877887‏
996 ‎‡2 BNF|14488768‏
996 ‎‡2 BNE|XX1378558‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏