Search
| Leader | 00000nz a2200037n 45 0 | ||
|---|---|---|---|
| 001 | WKP|Q57245256 (VIAF cluster) (Authority/Source Record) | ||
| 003 | WKP | ||
| 005 | 20241120235759.0 | ||
| 008 | 241120nneanz||abbn n and d | ||
| 035 | ‡a (WKP)Q57245256 | ||
| 024 | ‡a 0000-0003-2923-8365 ‡2 orcid | ||
| 024 | ‡a 9133183900 ‡2 scopus | ||
| 035 | ‡a (OCoLC)Q57245256 | ||
| 100 | 0 | ‡a Gareth Jones ‡9 nl ‡9 es ‡9 ast | |
| 375 | ‡a 1 ‡2 iso5218 | ||
| 400 | 0 | ‡a Gareth J. F. Jones ‡9 fr ‡9 nn ‡9 is ‡9 de ‡9 da ‡9 kl ‡9 nb ‡9 fo | |
| 400 | 0 | ‡a Gareth J. F. Jones ‡c information retrieval researcher, Dublin City University ‡9 en | |
| 400 | 0 | ‡a Gareth J. F. Jones ‡c forskare ‡9 sv | |
| 670 | ‡a Author's A comparison of query translation methods for English-Japanese cross-language information retrieval | ||
| 670 | ‡a Author's A comparison of query translation methods for English-Japanese cross-language information retrieval (poster abstract) | ||
| 670 | ‡a Author's A Comprehensive Survey of Facet Ranking Approaches Used in Faceted Search Systems | ||
| 670 | ‡a Author's A Semantic Event Detection Approach for Soccer Video based on Perception Concepts and Finiste State Machines | ||
| 670 | ‡a Author's A user-centered approach to rushes summarisation via highlight-detected keyframes | ||
| 670 | ‡a Author's Adaptation of machine translation for multilingual information retrieval in the medical domain. | ||
| 670 | ‡a Author's An investigation of decompounding for cross-language patent search | ||
| 670 | ‡a Author's An LDA-smoothed relevance model for document expansion | ||
| 670 | ‡a Author's Bengali | ||
| 670 | ‡a Author's Bengali (Bangla) Information Retrieval | ||
| 670 | ‡a Author's Combining Relevance Information in a Synchronous Collaborative Information Retrieval Environment | ||
| 670 | ‡a Author's Constructing a SenseCam visual diary as a media process | ||
| 670 | ‡a Author's iBingo mobile collaborative search | ||
| 670 | ‡a Author's Investigating keyframe selection methods in the novel domain of passively captured visual lifelogs | ||
| 670 | ‡a Author's LLM-based Automated Web Retrieval and Text Classification of Food Sharing Initiatives | ||
| 670 | ‡a Author's Making results fit into 40 characters | ||
| 670 | ‡a Author's Measuring the impact of temporal context on video retrieval | ||
| 670 | ‡a Author's MemoriEase 2.0: A Conversational Lifelog Retrieve System for LSC'24 | ||
| 670 | ‡a Author's MemoriQA: A Question-Answering Lifelog Dataset | ||
| 670 | ‡a Author's Multi-platform image search using tag enrichment | ||
| 670 | ‡a Author's My digital photos | ||
| 670 | ‡a Author's Patent query reduction using pseudo relevance feedback | ||
| 670 | ‡a Author's Query recovery of short user queries | ||
| 670 | ‡a Author's Retrieval of similar chess positions | ||
| 670 | ‡a Author's Rushes video summarization using a collaborative approach | ||
| 670 | ‡a Author's TopicVis | ||
| 670 | ‡a Author's United we fall, divided we stand | ||
| 670 | ‡a Author's Utilizing sub-topical structure of documents for information retrieval | ||
| 670 | ‡a Author's Video Semantic Content Analysis based on Ontology | ||
| 909 | ‡a (orcid) 0000000329238365 ‡9 1 | ||
| 909 | ‡a (scopus) 9133183900 ‡9 1 | ||
| 919 | ‡a comparisonofquerytranslationmethodsforenglishjapanesecrosslanguageinformationretrieval ‡A A comparison of query translation methods for English-Japanese cross-language information retrieval ‡9 1 | ||
| 919 | ‡a comparisonofquerytranslationmethodsforenglishjapanesecrosslanguageinformationretrievalposterabstract ‡A A comparison of query translation methods for English-Japanese cross-language information retrieval (poster abstract) ‡9 1 | ||
| 919 | ‡a comprehensivesurveyoffacetrankingapproachesusedinfacetedsearchsystems ‡A A Comprehensive Survey of Facet Ranking Approaches Used in Faceted Search Systems ‡9 1 | ||
| 919 | ‡a semanticeventdetectionapproachforsoccervideobasedonperceptionconceptsandfinistestatemachines ‡A A Semantic Event Detection Approach for Soccer Video based on Perception Concepts and Finiste State Machines ‡9 1 | ||
| 919 | ‡a usercenteredapproachtorushessummarisationviahighlightdetectedkeyframes ‡A A user-centered approach to rushes summarisation via highlight-detected keyframes ‡9 1 | ||
| 919 | ‡a adaptationofmachinetranslationformultilingualinformationretrievalinthemedicaldomain ‡A Adaptation of machine translation for multilingual information retrieval in the medical domain. ‡9 1 | ||
| 919 | ‡a investigationofdecompoundingforcrosslanguagepatentsearch ‡A An investigation of decompounding for cross-language patent search ‡9 1 | ||
| 919 | ‡a ldasmoothedrelevancemodelfordocumentexpansion ‡A An LDA-smoothed relevance model for document expansion ‡9 1 | ||
| 919 | ‡a bengali ‡A Bengali ‡9 1 | ||
| 919 | ‡a bengalibanglainformationretrieval ‡A Bengali (Bangla) Information Retrieval ‡9 1 | ||
| 919 | ‡a combiningrelevanceinformationinasynchronouscollaborativeinformationretrievalenvironment ‡A Combining Relevance Information in a Synchronous Collaborative Information Retrieval Environment ‡9 1 | ||
| 919 | ‡a constructingasensecamvisualdiaryasamediaprocess ‡A Constructing a SenseCam visual diary as a media process ‡9 1 | ||
| 919 | ‡a ibingomobilecollaborativesearch ‡A iBingo mobile collaborative search ‡9 1 | ||
| 919 | ‡a investigatingkeyframeselectionmethodsinthenoveldomainofpassivelycapturedvisuallifelogs ‡A Investigating keyframe selection methods in the novel domain of passively captured visual lifelogs ‡9 1 | ||
| 919 | ‡a llmbasedautomatedwebretrievalandtextclassificationoffoodsharinginitiatives ‡A LLM-based Automated Web Retrieval and Text Classification of Food Sharing Initiatives ‡9 1 | ||
| 919 | ‡a makingresultsfitinto40characters ‡A Making results fit into 40 characters ‡9 1 | ||
| 919 | ‡a measuringtheimpactoftemporalcontextonvideoretrieval ‡A Measuring the impact of temporal context on video retrieval ‡9 1 | ||
| 919 | ‡a memoriease20aconversationallifelogretrievesystemforlsc24 ‡A MemoriEase 2.0: A Conversational Lifelog Retrieve System for LSC'24 ‡9 1 | ||
| 919 | ‡a memoriqaaquestionansweringlifelogdataset ‡A MemoriQA: A Question-Answering Lifelog Dataset ‡9 1 | ||
| 919 | ‡a multiplatformimagesearchusingtagenrichment ‡A Multi-platform image search using tag enrichment ‡9 1 | ||
| 919 | ‡a mydigitalphotos ‡A My digital photos ‡9 1 | ||
| 919 | ‡a patentqueryreductionusingpseudorelevancefeedback ‡A Patent query reduction using pseudo relevance feedback ‡9 1 | ||
| 919 | ‡a queryrecoveryofshortuserqueries ‡A Query recovery of short user queries ‡9 1 | ||
| 919 | ‡a retrievalofsimilarchesspositions ‡A Retrieval of similar chess positions ‡9 1 | ||
| 919 | ‡a rushesvideosummarizationusingacollaborativeapproach ‡A Rushes video summarization using a collaborative approach ‡9 1 | ||
| 919 | ‡a topicvis ‡A TopicVis ‡9 1 | ||
| 919 | ‡a unitedwefalldividedwestand ‡A United we fall, divided we stand ‡9 1 | ||
| 919 | ‡a utilizingsubtopicalstructureofdocumentsforinformationretrieval ‡A Utilizing sub-topical structure of documents for information retrieval ‡9 1 | ||
| 919 | ‡a videosemanticcontentanalysisbasedonontology ‡A Video Semantic Content Analysis based on Ontology ‡9 1 | ||
| 946 | ‡a b ‡9 1 | ||
| 996 | ‡2 NUKAT|n 97021471 | ||
| 996 | ‡2 DNB|134285433 | ||
| 996 | ‡2 ISNI|0000000360815917 | ||
| 996 | ‡2 NII|DA00669263 | ||
| 996 | ‡2 CAOONL|ncf12110472 | ||
| 996 | ‡2 J9U|987007277499105171 | ||
| 996 | ‡2 J9U|987007376991205171 | ||
| 996 | ‡2 NII|DA02564120 | ||
| 996 | ‡2 CAOONL|ncf10532300 | ||
| 996 | ‡2 SUDOC|028580974 | ||
| 996 | ‡2 DBC|87097969538584 | ||
| 996 | ‡2 BNE|XX4810902 | ||
| 996 | ‡2 DNB|1158708173 | ||
| 996 | ‡2 NTA|185407846 | ||
| 996 | ‡2 CAOONL|ncf10628465 | ||
| 996 | ‡2 J9U|987007338024805171 | ||
| 996 | ‡2 RERO|A027360617 | ||
| 996 | ‡2 DNB|1127669885 | ||
| 996 | ‡2 NII|DA01453044 | ||
| 996 | ‡2 ISNI|0000000080402536 | ||
| 996 | ‡2 ISNI|0000000409812902 | ||
| 996 | ‡2 RERO|A027360682 | ||
| 996 | ‡2 NII|DA00887537 | ||
| 996 | ‡2 SUDOC|256014280 | ||
| 996 | ‡2 SUDOC|169169707 | ||
| 996 | ‡2 BNF|10218281 | ||
| 996 | ‡2 NDL|01107005 | ||
| 996 | ‡2 SUDOC|200035231 | ||
| 996 | ‡2 BIBSYS|90077710 | ||
| 996 | ‡2 BIBSYS|90965137 | ||
| 996 | ‡2 LC|n 82203598 | ||
| 996 | ‡2 NDL|01065750 | ||
| 996 | ‡2 NII|DA18296042 | ||
| 996 | ‡2 DNB|121677052 | ||
| 996 | ‡2 J9U|987007437338905171 | ||
| 996 | ‡2 BNCHL|10000000000000000825329 | ||
| 996 | ‡2 NTA|102058075 | ||
| 996 | ‡2 LC|n 2018008154 | ||
| 996 | ‡2 J9U|987007315624105171 | ||
| 996 | ‡2 J9U|987007281628205171 | ||
| 996 | ‡2 CAOONL|ncf11895789 | ||
| 996 | ‡2 LC|n 93106028 | ||
| 996 | ‡2 ISNI|0000000047161478 | ||
| 996 | ‡2 NSK|000720873 | ||
| 996 | ‡2 ISNI|000000008244078X | ||
| 996 | ‡2 N6I|vtls000079774 | ||
| 996 | ‡2 N6I|vtls001330881 | ||
| 996 | ‡2 SUDOC|111598141 | ||
| 996 | ‡2 J9U|987007388960305171 | ||
| 996 | ‡2 RERO|A003429624 | ||
| 996 | ‡2 RERO|A026462565 | ||
| 996 | ‡2 BNF|14463790 | ||
| 996 | ‡2 SUDOC|228912466 | ||
| 996 | ‡2 LC|no2018123821 | ||
| 996 | ‡2 LC|no2005103358 | ||
| 996 | ‡2 DNB|1190756994 | ||
| 996 | ‡2 DNB|1307418996 | ||
| 996 | ‡2 LC|n 88263647 | ||
| 996 | ‡2 N6I|vtls002595246 | ||
| 996 | ‡2 NTA|242123996 | ||
| 996 | ‡2 LC|nb2011021452 | ||
| 996 | ‡2 RERO|A008775562 | ||
| 996 | ‡2 J9U|987007279893905171 | ||
| 996 | ‡2 NKC|jo2013770175 | ||
| 996 | ‡2 ISNI|0000000114734409 | ||
| 996 | ‡2 NUKAT|n 2006085928 | ||
| 996 | ‡2 ISNI|0000000032440394 | ||
| 996 | ‡2 BIBSYS|17520 | ||
| 996 | ‡2 J9U|987007331660505171 | ||
| 996 | ‡2 B2Q|0001188887 | ||
| 996 | ‡2 RERO|A027360664 | ||
| 996 | ‡2 ISNI|0000000109099498 | ||
| 996 | ‡2 SELIBR|389797 | ||
| 996 | ‡2 LC|nb2013017181 | ||
| 996 | ‡2 NKC|jcu20221142537 | ||
| 996 | ‡2 LIH|LNB:BP_p_I;=B_h_ | ||
| 996 | ‡2 LIH|LNB:DG_k_Y;=B_l_ | ||
| 996 | ‡2 LC|nb2009015615 | ||
| 996 | ‡2 LC|no2011089758 | ||
| 996 | ‡2 LC|n 89631755 | ||
| 996 | ‡2 LC|no2010033366 | ||
| 996 | ‡2 BIBSYS|90094504 | ||
| 996 | ‡2 RERO|A027360665 | ||
| 996 | ‡2 NUKAT|n 2023093103 | ||
| 996 | ‡2 SUDOC|258152389 | ||
| 996 | ‡2 LC|nb2009004840 | ||
| 996 | ‡2 DNB|131693190 | ||
| 996 | ‡2 SUDOC|070371032 | ||
| 996 | ‡2 BIBSYS|13048075 | ||
| 996 | ‡2 NUKAT|nx2023357931 | ||
| 996 | ‡2 PTBNP|1906592 | ||
| 996 | ‡2 SUDOC|075106132 | ||
| 996 | ‡2 CAOONL|ncf10715828 | ||
| 996 | ‡2 NDL|01139813 | ||
| 996 | ‡2 LC|n 80061284 | ||
| 996 | ‡2 NKC|pna2013770521 | ||
| 996 | ‡2 SUDOC|253765528 | ||
| 996 | ‡2 CAOONL|ncf10562024 | ||
| 996 | ‡2 PLWABN|9810551615605606 | ||
| 996 | ‡2 NUKAT|n 97008394 | ||
| 996 | ‡2 ISNI|0000000069958736 | ||
| 996 | ‡2 ISNI|0000000117761322 | ||
| 996 | ‡2 LIH|LNB:V-138426;=BK | ||
| 996 | ‡2 BNF|16982959 | ||
| 996 | ‡2 NUKAT|n 2006092263 | ||
| 996 | ‡2 NUKAT|n 2017027251 | ||
| 996 | ‡2 LC|nb2023003104 | ||
| 996 | ‡2 LC|nb2006002582 | ||
| 996 | ‡2 SUDOC|143198211 | ||
| 996 | ‡2 BIBSYS|90936943 | ||
| 996 | ‡2 DBC|87097969201288 | ||
| 996 | ‡2 ISNI|0000000081179110 | ||
| 996 | ‡2 NUKAT|n 99028647 | ||
| 996 | ‡2 LC|no2014142912 | ||
| 996 | ‡2 LC|nb2014005756 | ||
| 996 | ‡2 RERO|A027360864 | ||
| 996 | ‡2 ISNI|0000000499604823 | ||
| 996 | ‡2 LC|nb2012023426 | ||
| 996 | ‡2 LC|nb2009001420 | ||
| 996 | ‡2 LC|n 88678295 | ||
| 996 | ‡2 LC|n 77004104 | ||
| 996 | ‡2 J9U|987007334786305171 | ||
| 996 | ‡2 J9U|987007350772905171 | ||
| 996 | ‡2 ISNI|0000000075913956 | ||
| 996 | ‡2 ISNI|000000004331481X | ||
| 996 | ‡2 BIBSYS|90721594 | ||
| 996 | ‡2 CAOONL|ncf11391674 | ||
| 996 | ‡2 NUKAT|n 2018143053 | ||
| 996 | ‡2 BIBSYS|90097981 | ||
| 996 | ‡2 NLA|000035252146 | ||
| 996 | ‡2 ISNI|0000000511731770 | ||
| 996 | ‡2 ISNI|0000000409409267 | ||
| 996 | ‡2 DBC|87097969538592 | ||
| 996 | ‡2 DBC|87097938981129 | ||
| 996 | ‡2 DNB|118196677 | ||
| 996 | ‡2 ISNI|0000000061900900 | ||
| 996 | ‡2 DNB|134737385 | ||
| 996 | ‡2 J9U|987007443536605171 | ||
| 996 | ‡2 ISNI|0000000502613721 | ||
| 996 | ‡2 ISNI|0000000041686505 | ||
| 996 | ‡2 LC|nr 98026088 | ||
| 996 | ‡2 ISNI|0000000443554337 | ||
| 996 | ‡2 NUKAT|n 2015188387 | ||
| 996 | ‡2 BIBSYS|90245189 | ||
| 996 | ‡2 BIBSYS|1669188157488 | ||
| 996 | ‡2 ISNI|000000004841078X | ||
| 996 | ‡2 BNF|13592379 | ||
| 996 | ‡2 ISNI|0000000109280078 | ||
| 996 | ‡2 SUDOC|075437244 | ||
| 996 | ‡2 BIBSYS|97012274 | ||
| 996 | ‡2 BNF|12266853 | ||
| 996 | ‡2 BIBSYS|1498562807783 | ||
| 996 | ‡2 VLACC|000032961 | ||
| 996 | ‡2 VLACC|000032962 | ||
| 996 | ‡2 CAOONL|ncf11629086 | ||
| 996 | ‡2 DNB|135505429 | ||
| 996 | ‡2 ISNI|0000000139860647 | ||
| 996 | ‡2 SUDOC|028448723 | ||
| 996 | ‡2 ISNI|0000000114624058 | ||
| 996 | ‡2 BIBSYS|90909862 | ||
| 996 | ‡2 NKC|ntk2018983672 | ||
| 996 | ‡2 PLWABN|9810641858805606 | ||
| 996 | ‡2 NII|DA0868441X | ||
| 996 | ‡2 NUKAT|n 2013050550 | ||
| 996 | ‡2 ISNI|0000000120260166 | ||
| 996 | ‡2 LC|n 2014071209 | ||
| 996 | ‡2 RERO|A003429636 | ||
| 996 | ‡2 RERO|A003429637 | ||
| 996 | ‡2 RERO|A003429638 | ||
| 996 | ‡2 RERO|A003429639 | ||
| 996 | ‡2 CAOONL|ncf10478114 | ||
| 996 | ‡2 NUKAT|n 01105193 | ||
| 996 | ‡2 BNC|981058612617406706 | ||
| 996 | ‡2 LC|n 82090320 | ||
| 996 | ‡2 N6I|vtls000069468 | ||
| 996 | ‡2 CAOONL|ncf12130684 | ||
| 996 | ‡2 BIBSYS|6042492 | ||
| 996 | ‡2 SUDOC|194985407 | ||
| 996 | ‡2 LC|n 98048238 | ||
| 996 | ‡2 NKC|pna2008456619 | ||
| 996 | ‡2 ISNI|0000000047642351 | ||
| 996 | ‡2 J9U|987007355647705171 | ||
| 996 | ‡2 ISNI|0000000449291531 | ||
| 996 | ‡2 LC|nb2014010399 | ||
| 996 | ‡2 NTA|16860860X | ||
| 996 | ‡2 LC|no2005109174 | ||
| 996 | ‡2 ISNI|0000000497837308 | ||
| 996 | ‡2 LC|n 96055417 | ||
| 996 | ‡2 NSK|000289302 | ||
| 996 | ‡2 LIH|LNB:CFV_q_;=B_m_ | ||
| 996 | ‡2 BNF|12252162 | ||
| 996 | ‡2 BNF|13337687 | ||
| 996 | ‡2 LC|n 80072528 | ||
| 996 | ‡2 ISNI|0000000052343495 | ||
| 996 | ‡2 BIBSYS|90078146 | ||
| 996 | ‡2 LC|n 00140213 | ||
| 996 | ‡2 LC|nb2009015609 | ||
| 996 | ‡2 RERO|A027360676 | ||
| 996 | ‡2 ISNI|0000000049851181 | ||
| 996 | ‡2 PLWABN|9812373195205606 | ||
| 996 | ‡2 PLWABN|9810551615505606 | ||
| 996 | ‡2 SIMACOB|29828963 | ||
| 996 | ‡2 LC|n 84221687 | ||
| 996 | ‡2 BIBSYS|90711635 | ||
| 996 | ‡2 CAOONL|ncf11481953 | ||
| 996 | ‡2 NTA|067690718 | ||
| 996 | ‡2 LC|nb 97090027 | ||
| 996 | ‡2 LC|n 99286019 | ||
| 996 | ‡2 BNF|14191139 | ||
| 996 | ‡2 ISNI|000000010883813X | ||
| 996 | ‡2 CAOONL|ncf10532286 | ||
| 996 | ‡2 LC|no2012011835 | ||
| 996 | ‡2 RERO|A008720385 | ||
| 996 | ‡2 J9U|987007575058505171 | ||
| 996 | ‡2 DNB|1261904028 | ||
| 996 | ‡2 LC|n 78083588 | ||
| 996 | ‡2 ISNI|0000000110684731 | ||
| 996 | ‡2 LC|nr 88005388 | ||
| 996 | ‡2 W2Z|13048075 | ||
| 996 | ‡2 BIBSYS|90166494 | ||
| 996 | ‡2 NKC|js20221149207 | ||
| 996 | ‡2 NUKAT|n 2012254353 | ||
| 996 | ‡2 BIBSYS|497 | ||
| 996 | ‡2 NTA|072934069 | ||
| 996 | ‡2 CAOONL|ncf11167450 | ||
| 996 | ‡2 JPG|500110457 | ||
| 996 | ‡2 JPG|500110456 | ||
| 996 | ‡2 ISNI|0000000054982426 | ||
| 996 | ‡2 CAOONL|ncf11274494 | ||
| 996 | ‡2 JPG|500112788 | ||
| 996 | ‡2 CAOONL|ncf10286059 | ||
| 996 | ‡2 NTA|079788904 | ||
| 996 | ‡2 ISNI|0000000077759518 | ||
| 996 | ‡2 BNF|16754407 | ||
| 996 | ‡2 J9U|987007452729405171 | ||
| 996 | ‡2 BIBSYS|1488830535681 | ||
| 996 | ‡2 CAOONL|ncf10392561 | ||
| 996 | ‡2 BIBSYS|1079895 | ||
| 996 | ‡2 LC|nr2006025512 | ||
| 996 | ‡2 LIH|LNB:CBR_n_;=B_b_ | ||
| 996 | ‡2 NTA|326087265 | ||
| 996 | ‡2 BIBSYS|10011066 | ||
| 996 | ‡2 LC|n 2024046866 | ||
| 996 | ‡2 LC|no2018037344 | ||
| 996 | ‡2 RERO|A009236225 | ||
| 996 | ‡2 CAOONL|ncf11331101 | ||
| 996 | ‡2 BNC|981060786232806706 | ||
| 996 | ‡2 BIBSYS|90632294 | ||
| 996 | ‡2 NTA|068209274 | ||
| 996 | ‡2 BIBSYS|90546148 | ||
| 997 | ‡a 0 0 lived 0 0 ‡9 1 | ||
| 998 | ‡a Jones, Gareth J. F. ‡2 ISNI|0000000449291531 ‡3 exact name | ||
| 998 | ‡a Gareth Jones ‡2 ISNI|0000000449291531 ‡3 exact name |
