VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q58249075 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000334.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q58249075‏
024 ‎‡a 0000-0003-3134-7392‏ ‎‡2 orcid‏
024 ‎‡a 16157934400‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q58249075‏
100 0 ‎‡a Rafael Moreno Rojas‏ ‎‡c researcher, ORCID id # 0000-0003-3134-7392‏ ‎‡9 en‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a Rafael Moreno Rojas‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's Analysis of the Acid Detergent Fibre Content in Turnip Greens and Turnip Tops (Brassica rapa L. Subsp. rapa) by Means of Near-Infrared Reflectance‏
670 ‎‡a Author's ASSESSMENT OF THE FOOD PATTERNS OF IMMIGRANT ECUADORIAN POPULATION IN SOUTHERN SPAIN BASED ON A 24-H FOOD RECALL SURVEY.‏
670 ‎‡a Author's Assessment risk to children's health due to consumption of cow's milk in polluted areas in Puebla and Tlaxcala, Mexico‏
670 ‎‡a Author's Bases for standardization and nutritional assessment of salmorejo cordobés: Research about salmorejo in catering establishments of Cordoba‏
670 ‎‡a Author's Bioaccessibility of Bioactive Compounds of 'Fresh Garlic' and 'Black Garlic' through In Vitro Gastrointestinal Digestion‏
670 ‎‡a Author's Cadmium content in infant formulas. Toxicological evaluation‏
670 ‎‡a Author's Changes in the antioxidant activity and metabolite profile of three onion varieties during the elaboration of 'black onion'‏
670 ‎‡a Author's Characterization and prediction by near-infrared reflectance of mineral composition of rocket‏
670 ‎‡a Author's Characterization and prediction by near-infrared reflectance of mineral composition of rocket (Eruca vesicaria subsp. sativa and Eruca vesicaria subsp. vesicaria)‏
670 ‎‡a Author's [Consensus document on the prevention of exposure to methylmercury in Spain]‏
670 ‎‡a Author's Cytotoxic and genotoxic effects of metal‏
670 ‎‡a Author's Cytotoxic and genotoxic effects of metal(oid)s bioactivated in rocket leaves (Eruca vesicaria subsp. sativa Miller)‏
670 ‎‡a Author's Detection and quantification ofEscherichia coliandPseudomonas aeruginosain cow milk by near-infrared spectroscopy‏
670 ‎‡a Author's Effect of an mHealth Intervention Using a Pedometer App With Full In-Person Counseling on Body Composition of Overweight Adults: Randomized Weight Loss Trial‏
670 ‎‡a Author's [Effect of consumption of bread with amaranth (Amaranthus dubius Mart. ex Thell.) on glycemic response and biochemical parameters in Sprague dawley rats]‏
670 ‎‡a Author's Estimation of the daily nutrients distribution in the Spanish standard diet‏
670 ‎‡a Author's Evaluation of haematological, serum biochemical and histopathological parameters of growing rabbits fed Amaranthus dubius.‏
670 ‎‡a Author's Evolution of some physicochemical and antioxidant properties of black garlic whole bulbs and peeled cloves‏
670 ‎‡a Author's FOOD CONSUMPTION PATTERN AT A FAMILY LEVEL OF URBAN AREAS OF ANZOÁTEGUI, VENEZUELA‏
670 ‎‡a Author's Game meat consumption by hunters and their relatives: a probabilistic approach‏
670 ‎‡a Author's Health risks in rural populations due to heavy metals found in agricultural soils irrigated with wastewater in the Alto Balsas sub-basin in Tlaxcala and Puebla, Mexico.‏
670 ‎‡a Author's Heavy metal levels in Spanish cheeses: influence of manufacturing conditions‏
670 ‎‡a Author's Heavy metals in cow's milk and cheese produced in areas irrigated with waste water in Puebla, Mexico.‏
670 ‎‡a Author's Ibero⁻American Consensus on Low- and No-Calorie Sweeteners: Safety, Nutritional Aspects and Benefits in Food and Beverages‏
670 ‎‡a Author's Importance of eating habits and sample size in the estimation of environmental mercury contamination using biological indicators‏
670 ‎‡a Author's Influence of vegetative cycle of asparagus (Asparagus officinalis L.) on copper, iron, zinc and manganese content‏
670 ‎‡a Author's Lead content in Spanish market infant formulas and toxicological contribution.‏
670 ‎‡a Author's [Methylmercury: existing recommendations; methods of analysing and interpreting the results; economic evaluation]‏
670 ‎‡a Author's Nutritional content of foods offered and consumed in a Spanish university canteen‏
670 ‎‡a Author's Preliminary nutritional assessment of the Ecuadorian diet based on a 24-h food recall survey in Ecuador.‏
670 ‎‡a Author's Probabilistic assessment of the intake of trace elements by consumption of weaning foods in Spain.‏
670 ‎‡a Author's Probabilistic risk analysis of mercury intake via food consumption in Spain.‏
670 ‎‡a Author's Push Notifications From a Mobile App to Improve the Body Composition of Overweight or Obese Women: Randomized Controlled Trial‏
670 ‎‡a Author's Risk assessment of the lead intake by consumption of red deer and wild boar meat in Southern Spain‏
670 ‎‡a Author's [SNACK HIGH WHEY PROTEIN IMPROVES THE LEVEL OF SATIETY AND REDUCES APPETITE HEALTHY WOMEN]‏
670 ‎‡a Author's Study on the mortality in Ecuador related to dietary factors‏
670 ‎‡a Author's The FINDRISC questionnaire capacity to predict diabetes mellitus II, arterial hypertension and comorbidity in women from low-and-middle-income countries‏
670 ‎‡a Author's Trends and nutritional significance of mineral content in fresh white asparagus spears‏
670 ‎‡a Author's Validation of a Scale to Assess Household Food Insecurity in One Rural and One Periurban Area of Ecuador, with a High Percentage of Migrants‏
670 ‎‡a Author's Valoración nutricional de los platos más frecuentemente consumidos en un barrio marginal de Iquitos, Amazonía Peruana‏
670 ‎‡a Author's Wild mushroom consumption by pickers in the south of Spain: a probabilistic approach‏
909 ‎‡a (scopus) 16157934400‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000331347392‏ ‎‡9 1‏
919 ‎‡a bioaccessibilityofbioactivecompoundsoffreshgarlicandblackgarlicthroughinvitrogastrointestinaldigestion‏ ‎‡A Bioaccessibility of Bioactive Compounds of 'Fresh Garlic' and 'Black Garlic' through In Vitro Gastrointestinal Digestion‏ ‎‡9 1‏
919 ‎‡a assessmentrisktochildrenshealthduetoconsumptionofcowsmilkinpollutedareasinpueblaandtlaxcalamexico‏ ‎‡A Assessment risk to children's health due to consumption of cow's milk in polluted areas in Puebla and Tlaxcala, Mexico‏ ‎‡9 1‏
919 ‎‡a assessmentofthefoodpatternsofimmigrantecuadorianpopulationinsouthernspainbasedona24hfoodrecallsurvey‏ ‎‡A ASSESSMENT OF THE FOOD PATTERNS OF IMMIGRANT ECUADORIAN POPULATION IN SOUTHERN SPAIN BASED ON A 24-H FOOD RECALL SURVEY.‏ ‎‡9 1‏
919 ‎‡a analysisoftheaciddetergentfibrecontentinturnipgreensandturniptopsbrassicarapa50subsprapabymeansofnearinfraredreflectance‏ ‎‡A Analysis of the Acid Detergent Fibre Content in Turnip Greens and Turnip Tops (Brassica rapa L. Subsp. rapa) by Means of Near-Infrared Reflectance‏ ‎‡9 1‏
919 ‎‡a basesforstandardizationandnutritionalassessmentofsalmorejocordobesresearchaboutsalmorejoincateringestablishmentsofcordoba‏ ‎‡A Bases for standardization and nutritional assessment of salmorejo cordobés: Research about salmorejo in catering establishments of Cordoba‏ ‎‡9 1‏
919 ‎‡a wildmushroomconsumptionbypickersinthesouthofspainaprobabilisticapproach‏ ‎‡A Wild mushroom consumption by pickers in the south of Spain: a probabilistic approach‏ ‎‡9 1‏
919 ‎‡a valoracionnutricionaldelosplatosmasfrecuentementeconsumidosen1barriomarginaldeiquitosamazoniaperuana‏ ‎‡A Valoración nutricional de los platos más frecuentemente consumidos en un barrio marginal de Iquitos, Amazonía Peruana‏ ‎‡9 1‏
919 ‎‡a validationofascaletoassesshouseholdfoodinsecurityin1ruraland1periurbanareaofecuadorwithahighpercentageofmigrants‏ ‎‡A Validation of a Scale to Assess Household Food Insecurity in One Rural and One Periurban Area of Ecuador, with a High Percentage of Migrants‏ ‎‡9 1‏
919 ‎‡a trendsandnutritionalsignificanceofmineralcontentinfreshwhiteasparagusspears‏ ‎‡A Trends and nutritional significance of mineral content in fresh white asparagus spears‏ ‎‡9 1‏
919 ‎‡a findriscquestionnairecapacitytopredictdiabetesmellitus2arterialhypertensionandcomorbidityinwomenfromlowandmiddleincomecountries‏ ‎‡A The FINDRISC questionnaire capacity to predict diabetes mellitus II, arterial hypertension and comorbidity in women from low-and-middle-income countries‏ ‎‡9 1‏
919 ‎‡a studyonthemortalityinecuadorrelatedtodietaryfactors‏ ‎‡A Study on the mortality in Ecuador related to dietary factors‏ ‎‡9 1‏
919 ‎‡a snackhighwheyproteinimprovesthelevelofsatietyandreducesappetitehealthywomen‏ ‎‡A [SNACK HIGH WHEY PROTEIN IMPROVES THE LEVEL OF SATIETY AND REDUCES APPETITE HEALTHY WOMEN]‏ ‎‡9 1‏
919 ‎‡a riskassessmentoftheleadintakebyconsumptionofreddeerandwildboarmeatinsouthernspain‏ ‎‡A Risk assessment of the lead intake by consumption of red deer and wild boar meat in Southern Spain‏ ‎‡9 1‏
919 ‎‡a pushnotificationsfromamobileapptoimprovethebodycompositionofoverweightorobesewomenrandomizedcontrolledtrial‏ ‎‡A Push Notifications From a Mobile App to Improve the Body Composition of Overweight or Obese Women: Randomized Controlled Trial‏ ‎‡9 1‏
919 ‎‡a probabilisticriskanalysisofmercuryintakeviafoodconsumptioninspain‏ ‎‡A Probabilistic risk analysis of mercury intake via food consumption in Spain.‏ ‎‡9 1‏
919 ‎‡a probabilisticassessmentoftheintakeoftraceelementsbyconsumptionofweaningfoodsinspain‏ ‎‡A Probabilistic assessment of the intake of trace elements by consumption of weaning foods in Spain.‏ ‎‡9 1‏
919 ‎‡a preliminarynutritionalassessmentoftheecuadoriandietbasedona24hfoodrecallsurveyinecuador‏ ‎‡A Preliminary nutritional assessment of the Ecuadorian diet based on a 24-h food recall survey in Ecuador.‏ ‎‡9 1‏
919 ‎‡a nutritionalcontentoffoodsofferedandconsumedinaspanishuniversitycanteen‏ ‎‡A Nutritional content of foods offered and consumed in a Spanish university canteen‏ ‎‡9 1‏
919 ‎‡a methylmercuryexistingrecommendationsmethodsofanalysingandinterpretingtheresultseconomicevaluation‏ ‎‡A [Methylmercury: existing recommendations; methods of analysing and interpreting the results; economic evaluation]‏ ‎‡9 1‏
919 ‎‡a leadcontentinspanishmarketinfantformulasandtoxicologicalcontribution‏ ‎‡A Lead content in Spanish market infant formulas and toxicological contribution.‏ ‎‡9 1‏
919 ‎‡a influenceofvegetativecycleofasparagusasparagusofficinalis50oncopperironzincandmanganesecontent‏ ‎‡A Influence of vegetative cycle of asparagus (Asparagus officinalis L.) on copper, iron, zinc and manganese content‏ ‎‡9 1‏
919 ‎‡a importanceofeatinghabitsandsamplesizeintheestimationofenvironmentalmercurycontaminationusingbiologicalindicators‏ ‎‡A Importance of eating habits and sample size in the estimation of environmental mercury contamination using biological indicators‏ ‎‡9 1‏
919 ‎‡a iberoamericanconsensusonlowandnocaloriesweetenerssafetynutritionalaspectsandbenefitsinfoodandbeverages‏ ‎‡A Ibero⁻American Consensus on Low- and No-Calorie Sweeteners: Safety, Nutritional Aspects and Benefits in Food and Beverages‏ ‎‡9 1‏
919 ‎‡a heavymetalsincowsmilkandcheeseproducedinareasirrigatedwithwastewaterinpueblamexico‏ ‎‡A Heavy metals in cow's milk and cheese produced in areas irrigated with waste water in Puebla, Mexico.‏ ‎‡9 1‏
919 ‎‡a heavymetallevelsinspanishcheesesinfluenceofmanufacturingconditions‏ ‎‡A Heavy metal levels in Spanish cheeses: influence of manufacturing conditions‏ ‎‡9 1‏
919 ‎‡a healthrisksinruralpopulationsduetoheavymetalsfoundinagriculturalsoilsirrigatedwithwastewaterinthealtobalsassubbasinintlaxcalaandpueblamexico‏ ‎‡A Health risks in rural populations due to heavy metals found in agricultural soils irrigated with wastewater in the Alto Balsas sub-basin in Tlaxcala and Puebla, Mexico.‏ ‎‡9 1‏
919 ‎‡a gamemeatconsumptionbyhuntersandtheirrelativesaprobabilisticapproach‏ ‎‡A Game meat consumption by hunters and their relatives: a probabilistic approach‏ ‎‡9 1‏
919 ‎‡a foodconsumptionpatternatafamilylevelofurbanareasofanzoateguivenezuela‏ ‎‡A FOOD CONSUMPTION PATTERN AT A FAMILY LEVEL OF URBAN AREAS OF ANZOÁTEGUI, VENEZUELA‏ ‎‡9 1‏
919 ‎‡a evolutionofsomephysicochemicalandantioxidantpropertiesofblackgarlicwholebulbsandpeeledcloves‏ ‎‡A Evolution of some physicochemical and antioxidant properties of black garlic whole bulbs and peeled cloves‏ ‎‡9 1‏
919 ‎‡a evaluationofhaematologicalserumbiochemicalandhistopathologicalparametersofgrowingrabbitsfedamaranthusdubius‏ ‎‡A Evaluation of haematological, serum biochemical and histopathological parameters of growing rabbits fed Amaranthus dubius.‏ ‎‡9 1‏
919 ‎‡a estimationofthedailynutrientsdistributioninthespanishstandarddiet‏ ‎‡A Estimation of the daily nutrients distribution in the Spanish standard diet‏ ‎‡9 1‏
919 ‎‡a effectofconsumptionofbreadwithamaranthamaranthusdubiusmartexthellonglycemicresponseandbiochemicalparametersinspraguedawleyrats‏ ‎‡A [Effect of consumption of bread with amaranth (Amaranthus dubius Mart. ex Thell.) on glycemic response and biochemical parameters in Sprague dawley rats]‏ ‎‡9 1‏
919 ‎‡a effectofanmhealthinterventionusingapedometerappwithfullinpersoncounselingonbodycompositionofoverweightadultsrandomizedweightlosstrial‏ ‎‡A Effect of an mHealth Intervention Using a Pedometer App With Full In-Person Counseling on Body Composition of Overweight Adults: Randomized Weight Loss Trial‏ ‎‡9 1‏
919 ‎‡a detectionandquantificationofescherichiacoliandpseudomonasaeruginosaincowmilkbynearinfraredspectroscopy‏ ‎‡A Detection and quantification ofEscherichia coliandPseudomonas aeruginosain cow milk by near-infrared spectroscopy‏ ‎‡9 1‏
919 ‎‡a cytotoxicandgenotoxiceffectsofmetaloidsbioactivatedinrocketleaveserucavesicariasubspsativamiller‏ ‎‡A Cytotoxic and genotoxic effects of metal(oid)s bioactivated in rocket leaves (Eruca vesicaria subsp. sativa Miller)‏ ‎‡9 1‏
919 ‎‡a cytotoxicandgenotoxiceffectsofmetal‏ ‎‡A Cytotoxic and genotoxic effects of metal‏ ‎‡9 1‏
919 ‎‡a consensusdocumentonthepreventionofexposuretomethylmercuryinspain‏ ‎‡A [Consensus document on the prevention of exposure to methylmercury in Spain]‏ ‎‡9 1‏
919 ‎‡a characterizationandpredictionbynearinfraredreflectanceofmineralcompositionofrocketerucavesicariasubspsativaanderucavesicariasubspvesicaria‏ ‎‡A Characterization and prediction by near-infrared reflectance of mineral composition of rocket (Eruca vesicaria subsp. sativa and Eruca vesicaria subsp. vesicaria)‏ ‎‡9 1‏
919 ‎‡a characterizationandpredictionbynearinfraredreflectanceofmineralcompositionofrocket‏ ‎‡A Characterization and prediction by near-infrared reflectance of mineral composition of rocket‏ ‎‡9 1‏
919 ‎‡a changesintheantioxidantactivityandmetaboliteprofileof3onionvarietiesduringtheelaborationofblackonion‏ ‎‡A Changes in the antioxidant activity and metabolite profile of three onion varieties during the elaboration of 'black onion'‏ ‎‡9 1‏
919 ‎‡a cadmiumcontentininfantformulastoxicologicalevaluation‏ ‎‡A Cadmium content in infant formulas. Toxicological evaluation‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
996 ‎‡2 LC|n 88276476‏
996 ‎‡2 ISNI|0000000060603752‏
996 ‎‡2 ISNI|000000005946349X‏
996 ‎‡2 BNE|XX1524122‏
996 ‎‡2 J9U|987007289293805171‏
996 ‎‡2 RERO|A006495775‏
996 ‎‡2 DNB|119188597‏
996 ‎‡2 BIBSYS|6051845‏
996 ‎‡2 ISNI|0000000045858773‏
996 ‎‡2 NII|DA13463872‏
996 ‎‡2 SUDOC|258497084‏
996 ‎‡2 BNF|15584221‏
996 ‎‡2 BNCHL|10000000000000000142751‏
996 ‎‡2 LC|no2006009823‏
996 ‎‡2 DNB|1056730404‏
996 ‎‡2 BNE|XX4663952‏
996 ‎‡2 BNE|XX879980‏
996 ‎‡2 BNCHL|10000000000000000118654‏
996 ‎‡2 ISNI|0000000035650143‏
996 ‎‡2 LC|n 2001108444‏
996 ‎‡2 ISNI|0000000021932617‏
996 ‎‡2 BNCHL|10000000000000000186260‏
996 ‎‡2 LC|n 2013022485‏
996 ‎‡2 DNB|1035844354‏
996 ‎‡2 DBC|870979134904712‏
996 ‎‡2 LC|n 79008485‏
996 ‎‡2 DNB|1057093866‏
996 ‎‡2 LC|n 94028538‏
996 ‎‡2 LC|n 88600063‏
996 ‎‡2 LC|nb 99135287‏
996 ‎‡2 DNB|1056450193‏
996 ‎‡2 NUKAT|n 2013181327‏
996 ‎‡2 LC|no2010042097‏
996 ‎‡2 DNB|1057296139‏
996 ‎‡2 BNCHL|10000000000000000849213‏
996 ‎‡2 ISNI|000000007991549X‏
996 ‎‡2 BNF|15028741‏
996 ‎‡2 ISNI|0000000035077228‏
996 ‎‡2 ISNI|0000000368403351‏
996 ‎‡2 NUKAT|n 2007007868‏
996 ‎‡2 CAOONL|ncf11548707‏
996 ‎‡2 LC|no2023092956‏
996 ‎‡2 DNB|1190662647‏
996 ‎‡2 BNE|XX1173704‏
996 ‎‡2 ISNI|0000000108580343‏
996 ‎‡2 DNB|127941967‏
996 ‎‡2 DNB|105736620X‏
996 ‎‡2 LC|no2023098922‏
996 ‎‡2 BNF|18021469‏
996 ‎‡2 DNB|137795815‏
996 ‎‡2 ISNI|0000000087222298‏
996 ‎‡2 ISNI|0000000066373097‏
996 ‎‡2 NII|DA12801007‏
996 ‎‡2 RERO|A003756529‏
996 ‎‡2 BNCHL|10000000000000000286436‏
996 ‎‡2 DNB|1243282045‏
996 ‎‡2 LC|no 98086607‏
996 ‎‡2 SUDOC|060315776‏
996 ‎‡2 LC|no2022079653‏
996 ‎‡2 BNE|XX4922629‏
996 ‎‡2 BNE|XX1225849‏
996 ‎‡2 LC|n 84190420‏
996 ‎‡2 NYNYRILM|133329‏
996 ‎‡2 BNC|981058612715506706‏
996 ‎‡2 DNB|1204880409‏
996 ‎‡2 NTA|191390399‏
996 ‎‡2 BNE|XX1794090‏
996 ‎‡2 SUDOC|168522470‏
996 ‎‡2 LC|no2009153334‏
996 ‎‡2 LC|n 50078910‏
996 ‎‡2 LC|no2001027213‏
996 ‎‡2 NYNYRILM|32410‏
996 ‎‡2 DNB|171100034‏
996 ‎‡2 BNCHL|10000000000000000837257‏
996 ‎‡2 BNE|XX6349276‏
996 ‎‡2 BNF|13973342‏
996 ‎‡2 BNE|XX1035504‏
996 ‎‡2 ISNI|0000000071225531‏
996 ‎‡2 J9U|987007279074905171‏
996 ‎‡2 LC|no 94026724‏
996 ‎‡2 BNCHL|10000000000000000179852‏
996 ‎‡2 BNCHL|10000000000000000101299‏
996 ‎‡2 RERO|A008608969‏
996 ‎‡2 NTA|156667134‏
996 ‎‡2 BNCHL|10000000000000000840224‏
996 ‎‡2 ISNI|0000000043545183‏
996 ‎‡2 JPG|500009713‏
996 ‎‡2 DNB|1056200413‏
996 ‎‡2 LC|n 2002108233‏
996 ‎‡2 BNCHL|10000000000000000862057‏
996 ‎‡2 CAOONL|ncf11163949‏
996 ‎‡2 LC|no2012050252‏
996 ‎‡2 LC|no 96062577‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏