VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q64005972 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241221010850.0
008 241221nneanz||abbn n and d
035 ‎‡a (WKP)Q64005972‏
024 ‎‡a 0000-0003-0292-0946‏ ‎‡2 orcid‏
024 ‎‡a 7005720156‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q64005972‏
100 0 ‎‡a Lidwien AM Smit‏ ‎‡9 sq‏ ‎‡9 es‏ ‎‡9 ast‏
375 ‎‡a 2‏ ‎‡2 iso5218‏
400 0 ‎‡a Lidwien AM Smit‏ ‎‡c Dutch scholar‏ ‎‡9 en‏
400 0 ‎‡a Lidwien Smit‏ ‎‡c wetenschapper‏ ‎‡9 nl‏
670 ‎‡a Author's 17q21 variants modify the association between early respiratory infections and asthma‏
670 ‎‡a Author's A cross-sectional study of lung function and respiratory symptoms among chemical workers producing diacetyl for food flavourings‏
670 ‎‡a Author's Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏
670 ‎‡a Author's Abundance and diversity of the fecal resistome in slaughter pigs and broilers in nine European countries‏
670 ‎‡a Author's Acute respiratory effects of livestock-related air pollution in a panel of COPD patients‏
670 ‎‡a Author's Agricultural seed dust as a potential cause of organic dust toxic syndrome‏
670 ‎‡a Author's Air pollution from livestock farms, and asthma, allergic rhinitis and COPD among neighbouring residents‏
670 ‎‡a Author's Air Pollution from Livestock Farms is Associated with Airway Obstruction in Neighboring Residents‏
670 ‎‡a Author's Association of antimicrobial usage with faecal abundance of aph(3')-III, ermB, sul2 and tetW resistance genes in veal calves in three European countries‏
670 ‎‡a Author's Associations between antimicrobial use and the faecal resistome on broiler farms from nine European countries‏
670 ‎‡a Author's Associations between pneumonia and residential distance to livestock farms over a five-year period in a large population-based study‏
670 ‎‡a Author's Associations between proximity to livestock farms, primary health care visits and self-reported symptoms‏
670 ‎‡a Author's Atopy and new-onset asthma in young Danish farmers and CD14, TLR2, and TLR4 genetic polymorphisms: a nested case-control study.‏
670 ‎‡a Author's Attitude toward livestock farming does not influence the earlier observed association between proximity to goat farms and self-reported pneumonia‏
670 ‎‡a Author's Author Correction: Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏
670 ‎‡a Author's Bronchiolitis obliterans syndrome in chemical workers producing diacetyl for food flavorings.‏
670 ‎‡a Author's CD14and Toll-like Receptor Gene Polymorphisms, Country Living, and Asthma in Adults‏
670 ‎‡a Author's Clinical and Pathological Findings in SARS-CoV-2 Disease Outbreaks in Farmed Mink (Neovison vison)‏
670 ‎‡a Author's Comorbidity and coexisting symptoms and infections presented in general practice by COPD patients: Does livestock density in the residential environment play a role?‏
670 ‎‡a Author's Contact dermatitis in the construction industry: the role of filaggrin loss-of-function mutations.‏
670 ‎‡a Author's Contact dermatitis is an unrecognized problem in the construction industry: Comparison of four different assessment methods‏
670 ‎‡a Author's Description and determinants of the faecal resistome and microbiome of farmers and slaughterhouse workers: A metagenome-wide cross-sectional study‏
670 ‎‡a Author's Detection of Coxiella burnetii in Ambient Air after a Large Q Fever Outbreak‏
670 ‎‡a Author's Determinants of epoxy allergy in the construction industry: a case-control study‏
670 ‎‡a Author's Do young adults with childhood asthma avoid occupational exposures at first hire?‏
670 ‎‡a Author's Doctor-diagnosed health problems in a region with a high density of concentrated animal feeding operations: a cross-sectional study‏
670 ‎‡a Author's Endotoxin and particulate matter emitted by livestock farms and respiratory health effects in neighboring residents‏
670 ‎‡a Author's Endotoxin exposure and symptoms in wastewater treatment workers‏
670 ‎‡a Author's Endotoxin exposure, CD14 and wheeze among farmers: a gene--environment interaction‏
670 ‎‡a Author's Endotoxin exposure in sewage treatment workers: investigation of exposure variability and comparison of analytical techniques‏
670 ‎‡a Author's Evaluation of Patients with Community-Acquired Pneumonia Caused by Zoonotic Pathogens in an Area with a High Density of Animal Farms‏
670 ‎‡a Author's Ex vivo cytokine release reflects sensitivity to occupational endotoxin exposure.‏
670 ‎‡a Author's Exhaled nitric oxide in endotoxin-exposed adults: effect modification by smoking and atopy‏
670 ‎‡a Author's Exposure-response analysis of allergy and respiratory symptoms in endotoxin-exposed adults.‏
670 ‎‡a Author's Extended-spectrum β-lactamase- and pAmpC-producing Enterobacteriaceae among the general population in a livestock-dense area.‏
670 ‎‡a Author's Farm dust resistomes and bacterial microbiomes in European poultry and pig farms‏
670 ‎‡a Author's Farmers' knowledge and expectations of antimicrobial use and resistance are strongly related to usage in Dutch livestock sectors‏
670 ‎‡a Author's Fecal Carriage of Extended-Spectrum-β-Lactamase/AmpC-Producing Escherichia coli in Horses‏
670 ‎‡a Author's Gender differences in lung function recovery after cessation of occupational endotoxin exposure: a complex story‏
670 ‎‡a Author's Gene-environment interactions in the study of asthma in the postgenomewide association studies era.‏
670 ‎‡a Author's Genetic and environmental factors of asthma and allergy: Results of the EGEA study‏
670 ‎‡a Author's Go slow to go fast: A plea for sustained scientific rigor in air pollution research during the COVID-19 pandemic‏
670 ‎‡a Author's Hay fever and asthma symptoms in conventional and organic farmers in The Netherlands‏
670 ‎‡a Author's Health conditions in rural areas with high livestock density: Analysis of seven consecutive years‏
670 ‎‡a Author's Health effects of occupational endotoxin exposure: a review and relevance to veterinary practice‏
670 ‎‡a Author's Healthcare utilisation prior to the diagnosis of inflammatory bowel diseases and the influence of livestock exposure: A longitudinal case-control study.‏
670 ‎‡a Author's Healthy worker survivor analysis in an occupational cohort study of Dutch agricultural workers‏
670 ‎‡a Author's Hepatitis E virus seroprevalence among the general population in a livestock-dense area in the Netherlands: a cross-sectional population-based serological survey‏
670 ‎‡a Author's Home Assessment of Indoor Microbiome (HAIM) in Relation to Lower Respiratory Tract Infections among Under-Five Children in Ibadan, Nigeria: The Study Protocol‏
670 ‎‡a Author's Human leukocyte antigen class II variants and adult-onset asthma: does occupational allergen exposure play a role?‏
670 ‎‡a Author's IgG to various beta-glucans in a human adult population‏
670 ‎‡a Author's Impacts of Intensive Livestock Production on Human Health in Densely Populated Regions‏
670 ‎‡a Author's Increased respiratory symptoms in COPD patients living in the vicinity of livestock farms‏
670 ‎‡a Author's Increased risk of pneumonia in residents living near poultry farms: does the upper respiratory tract microbiota play a role?‏
670 ‎‡a Author's Influence of different cleaning practices on endotoxin exposure at sewage treatment plants‏
670 ‎‡a Author's Lack of a Distinct Gradient in Biomarker Responses in Small Mammals Collected at Different Distances from a Highway‏
670 ‎‡a Author's Livestock-associated risk factors for pneumonia in an area of intensive animal farming in the Netherlands‏
670 ‎‡a Author's Long-term carriage of extended-spectrum β-lactamase-producing Escherichia coli and Klebsiella pneumoniae in the general population in the Netherlands‏
670 ‎‡a Author's Loss of function of transient receptor potential vanilloid 1 (TRPV1) genetic variant is associated with lower risk of active childhood asthma‏
670 ‎‡a Author's Mobility assessment of a rural population in the Netherlands using GPS measurements‏
670 ‎‡a Author's Morbidity Rates in an Area with High Livestock Density: A Registry-Based Study Including Different Groups of Patients with Respiratory Health Problems‏
670 ‎‡a Author's MRSA in persons not living or working on a farm in a livestock-dense area: prevalence and risk factors‏
670 ‎‡a Author's Neurological symptoms among Sri Lankan farmers occupationally exposed to acetylcholinesterase-inhibiting insecticides.‏
670 ‎‡a Author's Occupational and environmental exposure to SARS-CoV-2 in and around infected mink farms‏
670 ‎‡a Author's Occupational endotoxin exposure in association with atopic sensitization and respiratory health in adults: Results of a 5-year follow-up‏
670 ‎‡a Author's Occupational endotoxin exposure reduces the risk of atopic sensitization but increases the risk of bronchial hyperresponsiveness‏
670 ‎‡a Author's Occupational Exposure and Carriage of Antimicrobial Resistance Genes (tetW, ermB) in Pig Slaughterhouse Workers‏
670 ‎‡a Author's Occupational exposure to indoor air pollution among bakery workers in Ethiopia; A comparison of electric and biomass cookstoves.‏
670 ‎‡a Author's Odour annoyance in the neighbourhood of livestock farming - perceived health and health care seeking behaviour‏
670 ‎‡a Author's P-396: Partial Least Squares Regression of Serum Levels of Environmental Contaminants and Reproductive Markers in Males from Greenland, Poland and Ukraine‏
670 ‎‡a Author's Panel studies of air pollution in patients with COPD: Systematic review and meta-analysis‏
670 ‎‡a Author's Patients with overlapping diagnoses of asthma and COPD: is livestock exposure a risk factor for comorbidity and coexisting symptoms and infections?‏
670 ‎‡a Author's Pesticide poisoning in the developing world--a minimum pesticides list‏
670 ‎‡a Author's Phthalates, perfluoroalkyl acids, metals and organochlorines and reproductive function: a multipollutant assessment in Greenlandic, Polish and Ukrainian men.‏
670 ‎‡a Author's Pneumonia risk of people living close to goat and poultry farms – Taking GPS derived mobility patterns into account‏
670 ‎‡a Author's Prenatal exposure to environmental chemical contaminants and asthma and eczema in school-age children.‏
670 ‎‡a Author's Prevalence and risk factors for colonization of Clostridium difficile among adults living near livestock farms in the Netherlands‏
670 ‎‡a Author's Prevalence of non-specific health symptoms in livestock dense areas: Looking beyond respiratory conditions‏
670 ‎‡a Author's Proximity to livestock farms and exposure to livestock-related particulate matter are associated with lower probability of medication dispensing for obstructive airway diseases‏
670 ‎‡a Author's Q fever and pneumonia in an area with a high livestock density: a large population-based study‏
670 ‎‡a Author's Remarkable spatial variation in the seroprevalence of Coxiella burnetii after a large Q fever epidemic‏
670 ‎‡a Author's Residential proximity to livestock farms is associated with a lower prevalence of atopy.‏
670 ‎‡a Author's Respiratory health effects in agricultural workers: are some more susceptible than others?‏
670 ‎‡a Author's Respiratory health effects of exposure to low levels of airborne endotoxin - a systematic review‏
670 ‎‡a Author's Risk Factors for Antimicrobial Resistance in Turkey Farms: A Cross-Sectional Study in Three European Countries‏
670 ‎‡a Author's Risk of exacerbations in COPD and asthma patients living in the neighbourhood of livestock farms: Observational study using longitudinal data‏
670 ‎‡a Author's Risk of pneumonia among residents living near goat and poultry farms during 2014-2016‏
670 ‎‡a Author's Sensitisation to common allergens and respiratory symptoms in endotoxin exposed workers: a pooled analysis.‏
670 ‎‡a Author's Serologic Screening of Severe Acute Respiratory Syndrome Coronavirus 2 Infection in Cats and Dogs during First Coronavirus Disease Wave, the Netherlands‏
670 ‎‡a Author's Serum concentrations of polybrominated diphenyl ethers (PBDEs) and a polybrominated biphenyl (PBB) in men from Greenland, Poland and Ukraine‏
670 ‎‡a Author's Skin symptoms in the construction industry: occurrence and determinants‏
670 ‎‡a Author's Spirometry, questionnaire and electronic medical record based COPD in a population survey: Comparing prevalence, level of agreement and associations with potential risk factors‏
670 ‎‡a Author's Stability of individual LPS-induced ex vivo cytokine release in a whole blood assay over a five-year interval‏
670 ‎‡a Author's The antimicrobial resistome in relation to antimicrobial use and biosecurity in pig farming, a metagenome-wide association study in nine European countries‏
670 ‎‡a Author's The relation between modeled odor exposure from livestock farming and odor annoyance among neighboring residents.‏
670 ‎‡a Author's Transient receptor potential genes, smoking, occupational exposures and cough in adults‏
670 ‎‡a Author's Transmission of SARS-CoV-2 on mink farms between humans and mink and back to humans‏
670 ‎‡a Author's Validation of a questionnaire on hand hygiene in the construction industry.‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/processed/NTA|311470882‏
670 ‎‡a wikidata authority control‏ ‎‡u https://viaf.org/viaf/284969857‏
909 ‎‡a (scopus) 7005720156‏ ‎‡9 1‏
909 ‎‡a (orcid) 0000000302920946‏ ‎‡9 1‏
919 ‎‡a fecalcarriageofextendedspectrumβlactamaseampcproducingescherichiacoliinhorses‏ ‎‡A Fecal Carriage of Extended-Spectrum-β-Lactamase/AmpC-Producing Escherichia coli in Horses‏ ‎‡9 1‏
919 ‎‡a geneenvironmentinteractionsinthestudyofasthmainthepostgenomewideassociationstudiesera‏ ‎‡A Gene-environment interactions in the study of asthma in the postgenomewide association studies era.‏ ‎‡9 1‏
919 ‎‡a geneticandenvironmentalfactorsofasthmaandallergyresultsoftheegeastudy‏ ‎‡A Genetic and environmental factors of asthma and allergy: Results of the EGEA study‏ ‎‡9 1‏
919 ‎‡a 5slowto5fastapleaforsustainedscientificrigorinairpollutionresearchduringthecovid19pandemic‏ ‎‡A Go slow to go fast: A plea for sustained scientific rigor in air pollution research during the COVID-19 pandemic‏ ‎‡9 1‏
919 ‎‡a hayfeverandasthmasymptomsinconventionalandorganicfarmersinthenetherlands‏ ‎‡A Hay fever and asthma symptoms in conventional and organic farmers in The Netherlands‏ ‎‡9 1‏
919 ‎‡a healthconditionsinruralareaswithhighlivestockdensityanalysisof7consecutiveyears‏ ‎‡A Health conditions in rural areas with high livestock density: Analysis of seven consecutive years‏ ‎‡9 1‏
919 ‎‡a healtheffectsofoccupationalendotoxinexposureareviewandrelevancetoveterinarypractice‏ ‎‡A Health effects of occupational endotoxin exposure: a review and relevance to veterinary practice‏ ‎‡9 1‏
919 ‎‡a healthcareutilisationpriortothediagnosisofinflammatoryboweldiseasesandtheinfluenceoflivestockexposurealongitudinalcasecontrolstudy‏ ‎‡A Healthcare utilisation prior to the diagnosis of inflammatory bowel diseases and the influence of livestock exposure: A longitudinal case-control study.‏ ‎‡9 1‏
919 ‎‡a healthyworkersurvivoranalysisinanoccupationalcohortstudyofdutchagriculturalworkers‏ ‎‡A Healthy worker survivor analysis in an occupational cohort study of Dutch agricultural workers‏ ‎‡9 1‏
919 ‎‡a hepatitisevirusseroprevalenceamongthegeneralpopulationinalivestockdenseareainthenetherlandsacrosssectionalpopulationbasedserologicalsurvey‏ ‎‡A Hepatitis E virus seroprevalence among the general population in a livestock-dense area in the Netherlands: a cross-sectional population-based serological survey‏ ‎‡9 1‏
919 ‎‡a homeassessmentofindoormicrobiomehaiminrelationtolowerrespiratorytractinfectionsamongunder5childreninibadannigeriathestudyprotocol‏ ‎‡A Home Assessment of Indoor Microbiome (HAIM) in Relation to Lower Respiratory Tract Infections among Under-Five Children in Ibadan, Nigeria: The Study Protocol‏ ‎‡9 1‏
919 ‎‡a humanleukocyteantigenclass2variantsandadultonsetasthmadoesoccupationalallergenexposureplayarole‏ ‎‡A Human leukocyte antigen class II variants and adult-onset asthma: does occupational allergen exposure play a role?‏ ‎‡9 1‏
919 ‎‡a iggtovariousbetaglucansinahumanadultpopulation‏ ‎‡A IgG to various beta-glucans in a human adult population‏ ‎‡9 1‏
919 ‎‡a impactsofintensivelivestockproductiononhumanhealthindenselypopulatedregions‏ ‎‡A Impacts of Intensive Livestock Production on Human Health in Densely Populated Regions‏ ‎‡9 1‏
919 ‎‡a increasedrespiratorysymptomsincopdpatientslivinginthevicinityoflivestockfarms‏ ‎‡A Increased respiratory symptoms in COPD patients living in the vicinity of livestock farms‏ ‎‡9 1‏
919 ‎‡a increasedriskofpneumoniainresidentslivingnearpoultryfarmsdoestheupperrespiratorytractmicrobiotaplayarole‏ ‎‡A Increased risk of pneumonia in residents living near poultry farms: does the upper respiratory tract microbiota play a role?‏ ‎‡9 1‏
919 ‎‡a influenceofdifferentcleaningpracticesonendotoxinexposureatsewagetreatmentplants‏ ‎‡A Influence of different cleaning practices on endotoxin exposure at sewage treatment plants‏ ‎‡9 1‏
919 ‎‡a lackofadistinctgradientinbiomarkerresponsesinsmallmammalscollectedatdifferentdistancesfromahighway‏ ‎‡A Lack of a Distinct Gradient in Biomarker Responses in Small Mammals Collected at Different Distances from a Highway‏ ‎‡9 1‏
919 ‎‡a livestockassociatedriskfactorsforpneumoniainanareaofintensiveanimalfarminginthenetherlands‏ ‎‡A Livestock-associated risk factors for pneumonia in an area of intensive animal farming in the Netherlands‏ ‎‡9 1‏
919 ‎‡a longtermcarriageofextendedspectrumβlactamaseproducingescherichiacoliandklebsiellapneumoniaeinthegeneralpopulationinthenetherlands‏ ‎‡A Long-term carriage of extended-spectrum β-lactamase-producing Escherichia coli and Klebsiella pneumoniae in the general population in the Netherlands‏ ‎‡9 1‏
919 ‎‡a lossoffunctionoftransientreceptorpotentialvanilloid1trpv1geneticvariantisassociatedwithlowerriskofactivechildhoodasthma‏ ‎‡A Loss of function of transient receptor potential vanilloid 1 (TRPV1) genetic variant is associated with lower risk of active childhood asthma‏ ‎‡9 1‏
919 ‎‡a mobilityassessmentofaruralpopulationinthenetherlandsusinggpsmeasurements‏ ‎‡A Mobility assessment of a rural population in the Netherlands using GPS measurements‏ ‎‡9 1‏
919 ‎‡a morbidityratesinanareawithhighlivestockdensityaregistrybasedstudyincludingdifferentgroupsofpatientswithrespiratoryhealthproblems‏ ‎‡A Morbidity Rates in an Area with High Livestock Density: A Registry-Based Study Including Different Groups of Patients with Respiratory Health Problems‏ ‎‡9 1‏
919 ‎‡a mrsainpersonsnotlivingorworkingonafarminalivestockdenseareaprevalenceandriskfactors‏ ‎‡A MRSA in persons not living or working on a farm in a livestock-dense area: prevalence and risk factors‏ ‎‡9 1‏
919 ‎‡a neurologicalsymptomsamongsrilankanfarmersoccupationallyexposedtoacetylcholinesteraseinhibitinginsecticides‏ ‎‡A Neurological symptoms among Sri Lankan farmers occupationally exposed to acetylcholinesterase-inhibiting insecticides.‏ ‎‡9 1‏
919 ‎‡a occupationalandenvironmentalexposuretosarscov2inandaroundinfectedminkfarms‏ ‎‡A Occupational and environmental exposure to SARS-CoV-2 in and around infected mink farms‏ ‎‡9 1‏
919 ‎‡a occupationalendotoxinexposureinassociationwithatopicsensitizationandrespiratoryhealthinadultsresultsofa5yearfollowup‏ ‎‡A Occupational endotoxin exposure in association with atopic sensitization and respiratory health in adults: Results of a 5-year follow-up‏ ‎‡9 1‏
919 ‎‡a associationsbetweenpneumoniaandresidentialdistancetolivestockfarmsovera5yearperiodinalargepopulationbasedstudy‏ ‎‡A Associations between pneumonia and residential distance to livestock farms over a five-year period in a large population-based study‏ ‎‡9 1‏
919 ‎‡a occupationalendotoxinexposurereducestheriskofatopicsensitizationbutincreasestheriskofbronchialhyperresponsiveness‏ ‎‡A Occupational endotoxin exposure reduces the risk of atopic sensitization but increases the risk of bronchial hyperresponsiveness‏ ‎‡9 1‏
919 ‎‡a occupationalexposureandcarriageofantimicrobialresistancegenestetwermbinpigslaughterhouseworkers‏ ‎‡A Occupational Exposure and Carriage of Antimicrobial Resistance Genes (tetW, ermB) in Pig Slaughterhouse Workers‏ ‎‡9 1‏
919 ‎‡a associationsbetweenantimicrobialuseandthefaecalresistomeonbroilerfarmsfrom9europeancountries‏ ‎‡A Associations between antimicrobial use and the faecal resistome on broiler farms from nine European countries‏ ‎‡9 1‏
919 ‎‡a occupationalexposuretoindoorairpollutionamongbakeryworkersinethiopiaacomparisonofelectricandbiomasscookstoves‏ ‎‡A Occupational exposure to indoor air pollution among bakery workers in Ethiopia; A comparison of electric and biomass cookstoves.‏ ‎‡9 1‏
919 ‎‡a odourannoyanceintheneighbourhoodoflivestockfarmingperceivedhealthandhealthcareseekingbehaviour‏ ‎‡A Odour annoyance in the neighbourhood of livestock farming - perceived health and health care seeking behaviour‏ ‎‡9 1‏
919 ‎‡a associationofantimicrobialusagewithfaecalabundanceofaph33ermbsul2andtetwresistancegenesinvealcalvesin3europeancountries‏ ‎‡A Association of antimicrobial usage with faecal abundance of aph(3')-III, ermB, sul2 and tetW resistance genes in veal calves in three European countries‏ ‎‡9 1‏
919 ‎‡a p396partialleastsquaresregressionofserumlevelsofenvironmentalcontaminantsandreproductivemarkersinmalesfromgreenlandpolandandukraine‏ ‎‡A P-396: Partial Least Squares Regression of Serum Levels of Environmental Contaminants and Reproductive Markers in Males from Greenland, Poland and Ukraine‏ ‎‡9 1‏
919 ‎‡a panelstudiesofairpollutioninpatientswithcopdsystematicreviewandmetaanalysis‏ ‎‡A Panel studies of air pollution in patients with COPD: Systematic review and meta-analysis‏ ‎‡9 1‏
919 ‎‡a airpollutionfromlivestockfarmsisassociatedwithairwayobstructioninneighboringresidents‏ ‎‡A Air Pollution from Livestock Farms is Associated with Airway Obstruction in Neighboring Residents‏ ‎‡9 1‏
919 ‎‡a patientswithoverlappingdiagnosesofasthmaandcopdislivestockexposureariskfactorforcomorbidityandcoexistingsymptomsandinfections‏ ‎‡A Patients with overlapping diagnoses of asthma and COPD: is livestock exposure a risk factor for comorbidity and coexisting symptoms and infections?‏ ‎‡9 1‏
919 ‎‡a pesticidepoisoninginthedevelopingworldaminimumpesticideslist‏ ‎‡A Pesticide poisoning in the developing world--a minimum pesticides list‏ ‎‡9 1‏
919 ‎‡a airpollutionfromlivestockfarmsandasthmaallergicrhinitisandcopdamongneighbouringresidents‏ ‎‡A Air pollution from livestock farms, and asthma, allergic rhinitis and COPD among neighbouring residents‏ ‎‡9 1‏
919 ‎‡a phthalatesperfluoroalkylacidsmetalsandorganochlorinesandreproductivefunctionamultipollutantassessmentingreenlandicpolishandukrainianmen‏ ‎‡A Phthalates, perfluoroalkyl acids, metals and organochlorines and reproductive function: a multipollutant assessment in Greenlandic, Polish and Ukrainian men.‏ ‎‡9 1‏
919 ‎‡a pneumoniariskofpeoplelivingclosetogoatandpoultryfarmstakinggpsderivedmobilitypatternsintoaccount‏ ‎‡A Pneumonia risk of people living close to goat and poultry farms – Taking GPS derived mobility patterns into account‏ ‎‡9 1‏
919 ‎‡a agriculturalseeddustasapotentialcauseoforganicdusttoxicsyndrome‏ ‎‡A Agricultural seed dust as a potential cause of organic dust toxic syndrome‏ ‎‡9 1‏
919 ‎‡a prenatalexposuretoenvironmentalchemicalcontaminantsandasthmaandeczemainschoolagechildren‏ ‎‡A Prenatal exposure to environmental chemical contaminants and asthma and eczema in school-age children.‏ ‎‡9 1‏
919 ‎‡a prevalenceandriskfactorsforcolonizationofclostridiumdifficileamongadultslivingnearlivestockfarmsinthenetherlands‏ ‎‡A Prevalence and risk factors for colonization of Clostridium difficile among adults living near livestock farms in the Netherlands‏ ‎‡9 1‏
919 ‎‡a acuterespiratoryeffectsoflivestockrelatedairpollutioninapanelofcopdpatients‏ ‎‡A Acute respiratory effects of livestock-related air pollution in a panel of COPD patients‏ ‎‡9 1‏
919 ‎‡a prevalenceofnonspecifichealthsymptomsinlivestockdenseareaslookingbeyondrespiratoryconditions‏ ‎‡A Prevalence of non-specific health symptoms in livestock dense areas: Looking beyond respiratory conditions‏ ‎‡9 1‏
919 ‎‡a proximitytolivestockfarmsandexposuretolivestockrelatedparticulatematterareassociatedwithlowerprobabilityofmedicationdispensingforobstructiveairwaydiseases‏ ‎‡A Proximity to livestock farms and exposure to livestock-related particulate matter are associated with lower probability of medication dispensing for obstructive airway diseases‏ ‎‡9 1‏
919 ‎‡a abundanceanddiversityofthefecalresistomeinslaughterpigsandbroilersin9europeancountries‏ ‎‡A Abundance and diversity of the fecal resistome in slaughter pigs and broilers in nine European countries‏ ‎‡9 1‏
919 ‎‡a qfeverandpneumoniainanareawithahighlivestockdensityalargepopulationbasedstudy‏ ‎‡A Q fever and pneumonia in an area with a high livestock density: a large population-based study‏ ‎‡9 1‏
919 ‎‡a remarkablespatialvariationintheseroprevalenceofcoxiellaburnetiiafteralargeqfeverepidemic‏ ‎‡A Remarkable spatial variation in the seroprevalence of Coxiella burnetii after a large Q fever epidemic‏ ‎‡9 1‏
919 ‎‡a residentialproximitytolivestockfarmsisassociatedwithalowerprevalenceofatopy‏ ‎‡A Residential proximity to livestock farms is associated with a lower prevalence of atopy.‏ ‎‡9 1‏
919 ‎‡a respiratoryhealtheffectsinagriculturalworkersaresomemoresusceptiblethanothers‏ ‎‡A Respiratory health effects in agricultural workers: are some more susceptible than others?‏ ‎‡9 1‏
919 ‎‡a respiratoryhealtheffectsofexposuretolowlevelsofairborneendotoxinasystematicreview‏ ‎‡A Respiratory health effects of exposure to low levels of airborne endotoxin - a systematic review‏ ‎‡9 1‏
919 ‎‡a riskfactorsforantimicrobialresistanceinturkeyfarmsacrosssectionalstudyin3europeancountries‏ ‎‡A Risk Factors for Antimicrobial Resistance in Turkey Farms: A Cross-Sectional Study in Three European Countries‏ ‎‡9 1‏
919 ‎‡a riskofexacerbationsincopdandasthmapatientslivingintheneighbourhoodoflivestockfarmsobservationalstudyusinglongitudinaldata‏ ‎‡A Risk of exacerbations in COPD and asthma patients living in the neighbourhood of livestock farms: Observational study using longitudinal data‏ ‎‡9 1‏
919 ‎‡a riskofpneumoniaamongresidentslivingneargoatandpoultryfarmsduring2014‏ ‎‡A Risk of pneumonia among residents living near goat and poultry farms during 2014-2016‏ ‎‡9 1‏
919 ‎‡a sensitisationtocommonallergensandrespiratorysymptomsinendotoxinexposedworkersapooledanalysis‏ ‎‡A Sensitisation to common allergens and respiratory symptoms in endotoxin exposed workers: a pooled analysis.‏ ‎‡9 1‏
919 ‎‡a serologicscreeningofsevereacuterespiratorysyndromecoronavirus2infectionincatsanddogsduring1coronavirusdiseasewavethenetherlands‏ ‎‡A Serologic Screening of Severe Acute Respiratory Syndrome Coronavirus 2 Infection in Cats and Dogs during First Coronavirus Disease Wave, the Netherlands‏ ‎‡9 1‏
919 ‎‡a serumconcentrationsofpolybrominateddiphenyletherspbdesandapolybrominatedbiphenylpbbinmenfromgreenlandpolandandukraine‏ ‎‡A Serum concentrations of polybrominated diphenyl ethers (PBDEs) and a polybrominated biphenyl (PBB) in men from Greenland, Poland and Ukraine‏ ‎‡9 1‏
919 ‎‡a skinsymptomsintheconstructionindustryoccurrenceanddeterminants‏ ‎‡A Skin symptoms in the construction industry: occurrence and determinants‏ ‎‡9 1‏
919 ‎‡a spirometryquestionnaireandelectronicmedicalrecordbasedcopdinapopulationsurveycomparingprevalencelevelofagreementandassociationswithpotentialriskfactors‏ ‎‡A Spirometry, questionnaire and electronic medical record based COPD in a population survey: Comparing prevalence, level of agreement and associations with potential risk factors‏ ‎‡9 1‏
919 ‎‡a stabilityofindividuallpsinducedexvivocytokinereleaseinawholebloodassayovera5yearinterval‏ ‎‡A Stability of individual LPS-induced ex vivo cytokine release in a whole blood assay over a five-year interval‏ ‎‡9 1‏
919 ‎‡a antimicrobialresistomeinrelationtoantimicrobialuseandbiosecurityinpigfarmingametagenomewideassociationstudyin9europeancountries‏ ‎‡A The antimicrobial resistome in relation to antimicrobial use and biosecurity in pig farming, a metagenome-wide association study in nine European countries‏ ‎‡9 1‏
919 ‎‡a relationbetweenmodeledodorexposurefromlivestockfarmingandodorannoyanceamongneighboringresidents‏ ‎‡A The relation between modeled odor exposure from livestock farming and odor annoyance among neighboring residents.‏ ‎‡9 1‏
919 ‎‡a transientreceptorpotentialgenessmokingoccupationalexposuresandcoughinadults‏ ‎‡A Transient receptor potential genes, smoking, occupational exposures and cough in adults‏ ‎‡9 1‏
919 ‎‡a transmissionofsarscov2onminkfarmsbetweenhumansandminkandbacktohumans‏ ‎‡A Transmission of SARS-CoV-2 on mink farms between humans and mink and back to humans‏ ‎‡9 1‏
919 ‎‡a validationofaquestionnaireonhandhygieneintheconstructionindustry‏ ‎‡A Validation of a questionnaire on hand hygiene in the construction industry.‏ ‎‡9 1‏
919 ‎‡a abundanceanddiversityofthefaecalresistomeinslaughterpigsandbroilersin9europeancountries‏ ‎‡A Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏ ‎‡9 1‏
919 ‎‡a genderdifferencesinlungfunctionrecoveryaftercessationofoccupationalendotoxinexposure‏ ‎‡A Gender differences in lung function recovery after cessation of occupational endotoxin exposure: a complex story‏ ‎‡9 1‏
919 ‎‡a crosssectionalstudyoflungfunctionandrespiratorysymptomsamongchemicalworkersproducingdiacetylforfoodflavourings‏ ‎‡A A cross-sectional study of lung function and respiratory symptoms among chemical workers producing diacetyl for food flavourings‏ ‎‡9 1‏
919 ‎‡a 17q21variantsmodifytheassociationbetweenearlyrespiratoryinfectionsandasthma‏ ‎‡A 17q21 variants modify the association between early respiratory infections and asthma‏ ‎‡9 1‏
919 ‎‡a associationsbetweenproximitytolivestockfarmsprimaryhealthcarevisitsandselfreportedsymptoms‏ ‎‡A Associations between proximity to livestock farms, primary health care visits and self-reported symptoms‏ ‎‡9 1‏
919 ‎‡a atopyandnewonsetasthmainyoungdanishfarmersandcd14tlr2andtlr4geneticpolymorphismsanestedcasecontrolstudy‏ ‎‡A Atopy and new-onset asthma in young Danish farmers and CD14, TLR2, and TLR4 genetic polymorphisms: a nested case-control study.‏ ‎‡9 1‏
919 ‎‡a attitudetowardlivestockfarmingdoesnotinfluencetheearlierobservedassociationbetweenproximitytogoatfarmsandselfreportedpneumonia‏ ‎‡A Attitude toward livestock farming does not influence the earlier observed association between proximity to goat farms and self-reported pneumonia‏ ‎‡9 1‏
919 ‎‡a authorcorrectionabundanceanddiversityofthefaecalresistomeinslaughterpigsandbroilersin9europeancountries‏ ‎‡A Author Correction: Abundance and diversity of the faecal resistome in slaughter pigs and broilers in nine European countries‏ ‎‡9 1‏
919 ‎‡a bronchiolitisobliteranssyndromeinchemicalworkersproducingdiacetylforfoodflavorings‏ ‎‡A Bronchiolitis obliterans syndrome in chemical workers producing diacetyl for food flavorings.‏ ‎‡9 1‏
919 ‎‡a cd14andtolllikereceptorgenepolymorphismscountrylivingandasthmainadults‏ ‎‡A CD14and Toll-like Receptor Gene Polymorphisms, Country Living, and Asthma in Adults‏ ‎‡9 1‏
919 ‎‡a clinicalandpathologicalfindingsinsarscov2diseaseoutbreaksinfarmedminkneovisonvison‏ ‎‡A Clinical and Pathological Findings in SARS-CoV-2 Disease Outbreaks in Farmed Mink (Neovison vison)‏ ‎‡9 1‏
919 ‎‡a comorbidityandcoexistingsymptomsandinfectionspresentedingeneralpracticebycopdpatientsdoeslivestockdensityintheresidentialenvironmentplayarole‏ ‎‡A Comorbidity and coexisting symptoms and infections presented in general practice by COPD patients: Does livestock density in the residential environment play a role?‏ ‎‡9 1‏
919 ‎‡a contactdermatitisintheconstructionindustrytheroleoffilaggrinlossoffunctionmutations‏ ‎‡A Contact dermatitis in the construction industry: the role of filaggrin loss-of-function mutations.‏ ‎‡9 1‏
919 ‎‡a contactdermatitisisanunrecognizedproblemintheconstructionindustrycomparisonof4differentassessmentmethods‏ ‎‡A Contact dermatitis is an unrecognized problem in the construction industry: Comparison of four different assessment methods‏ ‎‡9 1‏
919 ‎‡a descriptionanddeterminantsofthefaecalresistomeandmicrobiomeoffarmersandslaughterhouseworkersametagenomewidecrosssectionalstudy‏ ‎‡A Description and determinants of the faecal resistome and microbiome of farmers and slaughterhouse workers: A metagenome-wide cross-sectional study‏ ‎‡9 1‏
919 ‎‡a detectionofcoxiellaburnetiiinambientairafteralargeqfeveroutbreak‏ ‎‡A Detection of Coxiella burnetii in Ambient Air after a Large Q Fever Outbreak‏ ‎‡9 1‏
919 ‎‡a determinantsofepoxyallergyintheconstructionindustryacasecontrolstudy‏ ‎‡A Determinants of epoxy allergy in the construction industry: a case-control study‏ ‎‡9 1‏
919 ‎‡a doyoungadultswithchildhoodasthmaavoidoccupationalexposuresat1hire‏ ‎‡A Do young adults with childhood asthma avoid occupational exposures at first hire?‏ ‎‡9 1‏
919 ‎‡a doctordiagnosedhealthproblemsinaregionwithahighdensityofconcentratedanimalfeedingoperationsacrosssectionalstudy‏ ‎‡A Doctor-diagnosed health problems in a region with a high density of concentrated animal feeding operations: a cross-sectional study‏ ‎‡9 1‏
919 ‎‡a endotoxinandparticulatematteremittedbylivestockfarmsandrespiratoryhealtheffectsinneighboringresidents‏ ‎‡A Endotoxin and particulate matter emitted by livestock farms and respiratory health effects in neighboring residents‏ ‎‡9 1‏
919 ‎‡a endotoxinexposureandsymptomsinwastewatertreatmentworkers‏ ‎‡A Endotoxin exposure and symptoms in wastewater treatment workers‏ ‎‡9 1‏
919 ‎‡a endotoxinexposurecd14andwheezeamongfarmersageneenvironmentinteraction‏ ‎‡A Endotoxin exposure, CD14 and wheeze among farmers: a gene--environment interaction‏ ‎‡9 1‏
919 ‎‡a endotoxinexposureinsewagetreatmentworkersinvestigationofexposurevariabilityandcomparisonofanalyticaltechniques‏ ‎‡A Endotoxin exposure in sewage treatment workers: investigation of exposure variability and comparison of analytical techniques‏ ‎‡9 1‏
919 ‎‡a evaluationofpatientswithcommunityacquiredpneumoniacausedbyzoonoticpathogensinanareawithahighdensityofanimalfarms‏ ‎‡A Evaluation of Patients with Community-Acquired Pneumonia Caused by Zoonotic Pathogens in an Area with a High Density of Animal Farms‏ ‎‡9 1‏
919 ‎‡a exvivocytokinereleasereflectssensitivitytooccupationalendotoxinexposure‏ ‎‡A Ex vivo cytokine release reflects sensitivity to occupational endotoxin exposure.‏ ‎‡9 1‏
919 ‎‡a exhalednitricoxideinendotoxinexposedadultseffectmodificationbysmokingandatopy‏ ‎‡A Exhaled nitric oxide in endotoxin-exposed adults: effect modification by smoking and atopy‏ ‎‡9 1‏
919 ‎‡a exposureresponseanalysisofallergyandrespiratorysymptomsinendotoxinexposedadults‏ ‎‡A Exposure-response analysis of allergy and respiratory symptoms in endotoxin-exposed adults.‏ ‎‡9 1‏
919 ‎‡a extendedspectrumβlactamaseandpampcproducingenterobacteriaceaeamongthegeneralpopulationinalivestockdensearea‏ ‎‡A Extended-spectrum β-lactamase- and pAmpC-producing Enterobacteriaceae among the general population in a livestock-dense area.‏ ‎‡9 1‏
919 ‎‡a farmdustresistomesandbacterialmicrobiomesineuropeanpoultryandpigfarms‏ ‎‡A Farm dust resistomes and bacterial microbiomes in European poultry and pig farms‏ ‎‡9 1‏
919 ‎‡a farmersknowledgeandexpectationsofantimicrobialuseandresistancearestronglyrelatedtousageindutchlivestocksectors‏ ‎‡A Farmers' knowledge and expectations of antimicrobial use and resistance are strongly related to usage in Dutch livestock sectors‏ ‎‡9 1‏
943 ‎‡a 201x‏ ‎‡A 2016‏ ‎‡9 1‏
946 ‎‡a a‏ ‎‡9 1‏
996 ‎‡2 NTA|298298295‏
996 ‎‡2 NTA|408557737‏
996 ‎‡2 ISNI|000000039394458X‏
996 ‎‡2 NTA|181583372‏
996 ‎‡2 ISNI|0000000388945422‏
996 ‎‡2 ISNI|0000000396394202‏
996 ‎‡2 NTA|323265170‏
996 ‎‡2 NTA|073512559‏
996 ‎‡2 ISNI|0000000394122641‏
996 ‎‡2 NTA|325852405‏
996 ‎‡2 NTA|068183453‏
996 ‎‡2 NTA|421551690‏
996 ‎‡2 NTA|190184078‏
996 ‎‡2 NTA|175175608‏
996 ‎‡2 NTA|298678578‏
996 ‎‡2 NTA|117355232‏
996 ‎‡2 NTA|074487337‏
996 ‎‡2 NTA|12439535X‏
996 ‎‡2 ISNI|0000000392446503‏
996 ‎‡2 ISNI|0000000392614917‏
996 ‎‡2 ISNI|0000000394007467‏
996 ‎‡2 ISNI|0000000387785105‏
996 ‎‡2 ISNI|0000000389535548‏
996 ‎‡2 ISNI|0000000390106433‏
996 ‎‡2 NTA|073745235‏
996 ‎‡2 ISNI|0000000390764831‏
996 ‎‡2 ISNI|000000039546546X‏
996 ‎‡2 NTA|241724333‏
996 ‎‡2 NTA|068791119‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏
998 ‎‡a Smit, Lidwien‏ ‎‡q (Lidwientje Anne-Marie),‏ ‎‡2 NTA|311470882‏ ‎‡3 suggested‏