VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q73921255 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235803.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q73921255‏
024 ‎‡a 0000-0003-1612-0675‏ ‎‡2 orcid‏
024 ‎‡a 8656269300‏ ‎‡2 scopus‏
035 ‎‡a (OCoLC)Q73921255‏
100 0 ‎‡a Luis Armando Sarmiento-Franco‏ ‎‡c researcher‏ ‎‡9 en‏
400 0 ‎‡a Sarmiento-Franco L‏ ‎‡c onderzoeker‏ ‎‡9 nl‏
670 ‎‡a Author's Determination of tropical forage preferences using two offering methods in rabbits‏
670 ‎‡a Author's Effect of dietary inclusion of Leucaena leucocephala or Moringa oleifera leaf meal on performance of growing rabbits‏
670 ‎‡a Author's Effect of three protein levels and an enzyme blend on egg quality of laying hens.‏
670 ‎‡a Author's Egg production and quality under three housing systems in the tropics.‏
670 ‎‡a Author's Egg production, egg quality and crop content of Rhode Island Red hens grazing on natural tropical vegetation.‏
670 ‎‡a Author's Estimating Apparent Nutrient Digestibility of Diets Containing Leucaena leucocephala or Moringa oleifera Leaf Meals for Growing Rabbits by Two Methods‏
670 ‎‡a Author's Evaluation of the metabolizable energy value for growing lambs of the Mucuna pruriens seed and the whole pod‏
670 ‎‡a Author's Growth of Creole chickens raised under tropical conditions of Mexico.‏
670 ‎‡a Author's Length of productive life of sows in four pig farms in the tropics of Mexico.‏
670 ‎‡a Author's Male Layer Chicken’s Response to Dietary Moringa oleifera Meal in a Tropical Climate‏
670 ‎‡a Author's Nutrient Digestibility and Metabolizable Energy Content of Mucuna pruriens Whole Pods Fed to Growing Pelibuey Lambs‏
670 ‎‡a Author's Performance of broilers fed on diets containing different amounts of chaya‏
670 ‎‡a Author's Performance of broilers fed on diets containing different amounts of chaya (Cnidoscolus aconitifolius) leaf meal‏
670 ‎‡a Author's Productive performance and carcass yield of egg type male chickens raised with outdoor access in the tropics‏
670 ‎‡a Author's Productive performance of Creole chickens and their crosses raised under semi-intensive management conditions in Yucatan, Mexico‏
670 ‎‡a Author's The effect of chaya‏
670 ‎‡a Author's The effect of chaya (Cnidoscolus aconitifolius) leaf meal and of exogenous enzymes on amino acid digestibility in broilers.‏
670 ‎‡a Author's The nutritional effect of Moringa oleifera fresh leaves as feed supplement on Rhode Island Red hen egg production and quality.‏
670 ‎‡a Author's Udder Measurements and Their Relationship with Milk Yield in Pelibuey Ewes‏
670 ‎‡a Author's Utilization of Mucuna pruriens whole pods to feed lactating hair ewes.‏
909 ‎‡a (orcid) 0000000316120675‏ ‎‡9 1‏
909 ‎‡a (scopus) 8656269300‏ ‎‡9 1‏
919 ‎‡a determinationoftropicalforagepreferencesusing2offeringmethodsinrabbits‏ ‎‡A Determination of tropical forage preferences using two offering methods in rabbits‏ ‎‡9 1‏
919 ‎‡a effectofdietaryinclusionofleucaenaleucocephalaormoringaoleiferaleafmealonperformanceofgrowingrabbits‏ ‎‡A Effect of dietary inclusion of Leucaena leucocephala or Moringa oleifera leaf meal on performance of growing rabbits‏ ‎‡9 1‏
919 ‎‡a effectof3proteinlevelsandanenzymeblendoneggqualityoflayinghens‏ ‎‡A Effect of three protein levels and an enzyme blend on egg quality of laying hens.‏ ‎‡9 1‏
919 ‎‡a eggproductionandqualityunder3housingsystemsinthetropics‏ ‎‡A Egg production and quality under three housing systems in the tropics.‏ ‎‡9 1‏
919 ‎‡a eggproductioneggqualityandcropcontentofrhodeislandredhensgrazingonnaturaltropicalvegetation‏ ‎‡A Egg production, egg quality and crop content of Rhode Island Red hens grazing on natural tropical vegetation.‏ ‎‡9 1‏
919 ‎‡a estimatingapparentnutrientdigestibilityofdietscontainingleucaenaleucocephalaormoringaoleiferaleafmealsforgrowingrabbitsby2methods‏ ‎‡A Estimating Apparent Nutrient Digestibility of Diets Containing Leucaena leucocephala or Moringa oleifera Leaf Meals for Growing Rabbits by Two Methods‏ ‎‡9 1‏
919 ‎‡a evaluationofthemetabolizableenergyvalueforgrowinglambsofthemucunapruriensseedandthewholepod‏ ‎‡A Evaluation of the metabolizable energy value for growing lambs of the Mucuna pruriens seed and the whole pod‏ ‎‡9 1‏
919 ‎‡a growthofcreolechickensraisedundertropicalconditionsofmexico‏ ‎‡A Growth of Creole chickens raised under tropical conditions of Mexico.‏ ‎‡9 1‏
919 ‎‡a lengthofproductivelifeofsowsin4pigfarmsinthetropicsofmexico‏ ‎‡A Length of productive life of sows in four pig farms in the tropics of Mexico.‏ ‎‡9 1‏
919 ‎‡a malelayerchickensresponsetodietarymoringaoleiferamealinatropicalclimate‏ ‎‡A Male Layer Chicken’s Response to Dietary Moringa oleifera Meal in a Tropical Climate‏ ‎‡9 1‏
919 ‎‡a nutrientdigestibilityandmetabolizableenergycontentofmucunaprurienswholepodsfedtogrowingpelibueylambs‏ ‎‡A Nutrient Digestibility and Metabolizable Energy Content of Mucuna pruriens Whole Pods Fed to Growing Pelibuey Lambs‏ ‎‡9 1‏
919 ‎‡a performanceofbroilersfedondietscontainingdifferentamountsofchaya‏ ‎‡A Performance of broilers fed on diets containing different amounts of chaya‏ ‎‡9 1‏
919 ‎‡a performanceofbroilersfedondietscontainingdifferentamountsofchayacnidoscolusaconitifoliusleafmeal‏ ‎‡A Performance of broilers fed on diets containing different amounts of chaya (Cnidoscolus aconitifolius) leaf meal‏ ‎‡9 1‏
919 ‎‡a productiveperformanceandcarcassyieldofeggtypemalechickensraisedwithoutdooraccessinthetropics‏ ‎‡A Productive performance and carcass yield of egg type male chickens raised with outdoor access in the tropics‏ ‎‡9 1‏
919 ‎‡a productiveperformanceofcreolechickensandtheircrossesraisedundersemiintensivemanagementconditionsinyucatanmexico‏ ‎‡A Productive performance of Creole chickens and their crosses raised under semi-intensive management conditions in Yucatan, Mexico‏ ‎‡9 1‏
919 ‎‡a effectofchaya‏ ‎‡A The effect of chaya‏ ‎‡9 1‏
919 ‎‡a effectofchayacnidoscolusaconitifoliusleafmealandofexogenousenzymesonaminoaciddigestibilityinbroilers‏ ‎‡A The effect of chaya (Cnidoscolus aconitifolius) leaf meal and of exogenous enzymes on amino acid digestibility in broilers.‏ ‎‡9 1‏
919 ‎‡a nutritionaleffectofmoringaoleiferafreshleavesasfeedsupplementonrhodeislandredheneggproductionandquality‏ ‎‡A The nutritional effect of Moringa oleifera fresh leaves as feed supplement on Rhode Island Red hen egg production and quality.‏ ‎‡9 1‏
919 ‎‡a uddermeasurementsandtheirrelationshipwithmilkyieldinpelibueyewes‏ ‎‡A Udder Measurements and Their Relationship with Milk Yield in Pelibuey Ewes‏ ‎‡9 1‏
919 ‎‡a utilizationofmucunaprurienswholepodstofeedlactatinghairewes‏ ‎‡A Utilization of Mucuna pruriens whole pods to feed lactating hair ewes.‏ ‎‡9 1‏
996 ‎‡2 SUDOC|188054669
996 ‎‡2 LC|no 95036333
996 ‎‡2 BNE|XX1273955
996 ‎‡2 BLBNB|000530025
996 ‎‡2 LC|n 79137348
996 ‎‡2 ISNI|0000000069693619
996 ‎‡2 LC|n 2010030848
996 ‎‡2 LC|n 83328245
996 ‎‡2 DNB|141037571
996 ‎‡2 ISNI|0000000044723199
996 ‎‡2 ISNI|0000000028864864
996 ‎‡2 SUDOC|160678307
996 ‎‡2 DNB|1056254432
996 ‎‡2 SUDOC|026653478
996 ‎‡2 BLBNB|000209561
996 ‎‡2 LC|n 2012050034
996 ‎‡2 BNC|981058522539306706
996 ‎‡2 PLWABN|9810697621605606
996 ‎‡2 BLBNB|000253440
996 ‎‡2 SUDOC|077370430
996 ‎‡2 BNE|XX1536647
996 ‎‡2 BNE|XX4940006
996 ‎‡2 DNB|1135590974
996 ‎‡2 LC|n 82075423
996 ‎‡2 NII|DA11909584
996 ‎‡2 LC|ns2016002389
996 ‎‡2 LC|n 2015237769
996 ‎‡2 BNF|14593280
996 ‎‡2 CAOONL|ncf11944602
996 ‎‡2 DNB|1146728220
996 ‎‡2 BNCHL|10000000000000000124511
996 ‎‡2 DNB|1057633712
996 ‎‡2 DNB|140109730
996 ‎‡2 J9U|987007324664005171
996 ‎‡2 ICCU|CFIV271323
996 ‎‡2 NTA|382038800
996 ‎‡2 SUDOC|204097541
996 ‎‡2 BNC|981058527716706706
996 ‎‡2 BLBNB|000209559
996 ‎‡2 BLBNB|000209555
996 ‎‡2 BLBNB|000209556
996 ‎‡2 SUDOC|09429996X
996 ‎‡2 BLBNB|000209553
996 ‎‡2 LC|no2003102616
996 ‎‡2 LC|n 2019252014
996 ‎‡2 J9U|987007500958505171
996 ‎‡2 ISNI|0000000024902923
996 ‎‡2 LC|no2004078228
996 ‎‡2 ISNI|0000000025195917
996 ‎‡2 ISNI|0000000070127454
996 ‎‡2 BNF|12020622
996 ‎‡2 SUDOC|136091911
996 ‎‡2 ISNI|000000003431106X
996 ‎‡2 DNB|1058080598
996 ‎‡2 NUKAT|n 2003042198
996 ‎‡2 BNE|XX1273995
996 ‎‡2 ARBABN|000036414
996 ‎‡2 ISNI|0000000109657517
996 ‎‡2 DNB|1056379405
996 ‎‡2 PTBNP|1839598
996 ‎‡2 LC|no2010193831
996 ‎‡2 ISNI|0000000109373610
996 ‎‡2 ISNI|0000000059650084
996 ‎‡2 LC|n 2001100739
996 ‎‡2 BNF|16218331
996 ‎‡2 ISNI|0000000028544131
996 ‎‡2 NTA|073823597
996 ‎‡2 JPG|500036193
996 ‎‡2 NUKAT|n 2004071405
996 ‎‡2 J9U|987007342412705171
996 ‎‡2 ISNI|0000000109298665
996 ‎‡2 N6I|vtls000055274
996 ‎‡2 ISNI|0000000045550250
996 ‎‡2 LC|nr 97025622
996 ‎‡2 PTBNP|1718660
996 ‎‡2 PTBNP|1866738
996 ‎‡2 ISNI|0000000079288211
996 ‎‡2 NTA|073888966
996 ‎‡2 PLWABN|9810547548605606
996 ‎‡2 BNCHL|10000000000000000124338
996 ‎‡2 BLBNB|000403712
996 ‎‡2 ISNI|0000000409766221
996 ‎‡2 BAV|495_97665
996 ‎‡2 DNB|1047618699
996 ‎‡2 PTBNP|42318
996 ‎‡2 CAOONL|ncf11888088
996 ‎‡2 ISNI|0000000060454144
996 ‎‡2 NTA|190522674
996 ‎‡2 ISNI|0000000033867349
996 ‎‡2 SUDOC|11104040X
996 ‎‡2 SUDOC|095293108
996 ‎‡2 LC|n 86048821
996 ‎‡2 LC|no2020149880
996 ‎‡2 ISNI|0000000440130774
996 ‎‡2 NII|DA19473992
996 ‎‡2 LC|n 79066676
996 ‎‡2 RERO|A003259141
996 ‎‡2 ISNI|0000000080583576
996 ‎‡2 RERO|A003259142
996 ‎‡2 BLBNB|000176467
996 ‎‡2 ISNI|0000000117932988
996 ‎‡2 ISNI|0000000428310609
996 ‎‡2 DNB|1158204078
996 ‎‡2 PTBNP|1861578
996 ‎‡2 RERO|A000112779
996 ‎‡2 BNF|17926589
996 ‎‡2 LC|no2014146536
996 ‎‡2 PLWABN|9810540717105606
996 ‎‡2 ISNI|0000000501452161
996 ‎‡2 NUKAT|n 2006139910
996 ‎‡2 SUDOC|22128141X
996 ‎‡2 ISNI|0000000025323421
996 ‎‡2 BLBNB|000263681
996 ‎‡2 PLWABN|9810653924705606
996 ‎‡2 LC|n 81046369
996 ‎‡2 SUDOC|242448690
996 ‎‡2 LC|n 2022250722
996 ‎‡2 PTBNP|42324
996 ‎‡2 BNE|XX1758703
996 ‎‡2 DNB|105720031X
996 ‎‡2 ISNI|0000000456935155
996 ‎‡2 LC|n 85333173
996 ‎‡2 BIBSYS|90848911
996 ‎‡2 BLBNB|000225238
996 ‎‡2 LC|n 86078456
996 ‎‡2 DNB|1182462596
996 ‎‡2 LC|no2010170886
996 ‎‡2 DNB|131583913
996 ‎‡2 ISNI|0000000048255433
996 ‎‡2 LC|n 98067731
996 ‎‡2 DNB|109513101X
996 ‎‡2 PTBNP|1489885
996 ‎‡2 CAOONL|ncf11309938
996 ‎‡2 BNE|XX4725894
996 ‎‡2 RERO|A026439346
996 ‎‡2 LC|no2018148890
996 ‎‡2 LC|no2016050398
996 ‎‡2 JPG|500229012
996 ‎‡2 DNB|12437431X
996 ‎‡2 BNF|17131083
996 ‎‡2 SUDOC|075018217
996 ‎‡2 DNB|128971150
996 ‎‡2 PTBNP|494248
996 ‎‡2 DNB|1337937223
996 ‎‡2 BLBNB|000490714
996 ‎‡2 ISNI|0000000078737759
996 ‎‡2 NII|DA08312801
996 ‎‡2 PTBNP|122416
996 ‎‡2 NTA|071746323
996 ‎‡2 NTA|140518010
996 ‎‡2 BIBSYS|99070962
996 ‎‡2 PTBNP|1345578
996 ‎‡2 ISNI|0000000071774442
996 ‎‡2 LC|no2002011743
996 ‎‡2 BNE|XX1273948
996 ‎‡2 PLWABN|9811523359605606
996 ‎‡2 ISNI|0000000396913017
996 ‎‡2 ISNI|0000000068806263
996 ‎‡2 NKC|jn20031009015
996 ‎‡2 PTBNP|1529629
996 ‎‡2 PLWABN|9812802048205606
996 ‎‡2 BNCHL|10000000000000000294496
996 ‎‡2 LC|no 99081037
996 ‎‡2 SUDOC|057595917
996 ‎‡2 DNB|117515802X
996 ‎‡2 LC|n 94065293
996 ‎‡2 LC|no2003105922
996 ‎‡2 LC|n 86013203
996 ‎‡2 SUDOC|028353331
996 ‎‡2 ISNI|0000000496567385
996 ‎‡2 PTBNP|216492
996 ‎‡2 LC|n 99018558
996 ‎‡2 BNCHL|10000000000000000086924
996 ‎‡2 NUKAT|n 2005003568
996 ‎‡2 BNF|11886083
996 ‎‡2 RERO|A003159886
996 ‎‡2 BAV|495_317827
996 ‎‡2 ISNI|0000000499822177
996 ‎‡2 PTBNP|120363
996 ‎‡2 ISNI|0000000067783186
996 ‎‡2 ISNI|0000000048913029
996 ‎‡2 ISNI|0000000079953891
996 ‎‡2 ISNI|0000000021268357
996 ‎‡2 ISNI|0000000023244746
996 ‎‡2 BNE|XX1225831
996 ‎‡2 ISNI|0000000028422011
996 ‎‡2 LC|no2006051411
996 ‎‡2 ISNI|0000000079866923
996 ‎‡2 NII|DA08088027
996 ‎‡2 DNB|1056468637
996 ‎‡2 DNB|124374328
996 ‎‡2 NUKAT|n 01015731
996 ‎‡2 LC|n 85198072
996 ‎‡2 LC|no2005086052
996 ‎‡2 JPG|500284518
996 ‎‡2 BNE|XX947156
996 ‎‡2 BNE|XX1523879
996 ‎‡2 ISNI|0000000081815738
996 ‎‡2 BNE|XX1405401
996 ‎‡2 ISNI|0000000051203765
996 ‎‡2 DNB|170384934
996 ‎‡2 LC|n 85089282
996 ‎‡2 ISNI|0000000070128043
996 ‎‡2 LC|n 2020184885
996 ‎‡2 J9U|987007271073005171
996 ‎‡2 RERO|A003177643
996 ‎‡2 NLA|000035850396
996 ‎‡2 BNC|981058526186406706
996 ‎‡2 BAV|495_111779
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏