VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q7560559 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241120235933.0
008 241120nneanz||abbn n and d
035 ‎‡a (WKP)Q7560559‏
024 ‎‡a 0000-0002-6977-3445‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q7560559‏
043 ‎‡c US‏
100 0 ‎‡a SonBinh Nguyen‏ ‎‡c chemistry researcher, academic‏ ‎‡9 en‏
375 ‎‡a 1‏ ‎‡2 iso5218‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c kimiko merikano‏ ‎‡9 pap‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c chimiste américain‏ ‎‡9 fr‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c Amerikaans scheikundige‏ ‎‡9 nl‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c amerikansk kjemikar‏ ‎‡9 nn‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c químicu estauxunidense‏ ‎‡9 ast‏
400 0 ‎‡a Nguyễn Sơn Bình‏ ‎‡9 vi‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c amerikansk kemist‏ ‎‡9 sv‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c amerikansk kemiker‏ ‎‡9 da‏
400 0 ‎‡a SonBinh Nguyen‏ ‎‡c amerikansk kjemiker‏ ‎‡9 nb‏
670 ‎‡a Author's A catalytically active, permanently microporous MOF with metalloporphyrin struts‏
670 ‎‡a Author's A computational study of the mechanism of the [‏
670 ‎‡a Author's A computational study of the mechanism of the [(salen)Cr + DMAP]-catalyzed formation of cyclic carbonates from CO2 and epoxide.‏
670 ‎‡a Author's A convergent coordination chemistry-based approach to dissymmetric macrocyclic cofacial porphyrin complexes‏
670 ‎‡a Author's A general high-yield route to bis‏
670 ‎‡a Author's A general high-yield route to bis(salicylaldimine) zinc(II) complexes: application to the synthesis of pyridine-modified salen-type zinc(II) complexes‏
670 ‎‡a Author's A highly modular and convergent approach for the synthesis of stimulant-responsive heteroligated cofacial porphyrin tweezer complexes‏
670 ‎‡a Author's A mechanistic investigation of the asymmetric Meerwein-Schmidt-Ponndorf-Verley reduction catalyzed by BINOL/AlMe(3)-structure, kinetics, and enantioselectivity‏
670 ‎‡a Author's A metal–organic framework material that functions as an enantioselective catalyst for olefin epoxidation‏
670 ‎‡a Author's A Zn-based, pillared paddlewheel MOF containing free carboxylic acids via covalent post-synthesis elaboration‏
670 ‎‡a Author's Acid-degradable polymer-caged lipoplex‏
670 ‎‡a Author's Acid-degradable polymer-caged lipoplex (PCL) platform for siRNA delivery: facile cellular triggered release of siRNA‏
670 ‎‡a Author's Active-site-accessible, porphyrinic metal-organic framework materials‏
670 ‎‡a Author's Allosterically regulated supramolecular catalysis of acyl transfer reactions for signal amplification and detection of small molecules‏
670 ‎‡a Author's Amphiphilic Porphyrin Nanocrystals: Morphology Tuning and Hierarchical Assembly‏
670 ‎‡a Author's An efficient and highly enantio- and diastereoselective cyclopropanation of olefins catalyzed by Schiff-base ruthenium‏
670 ‎‡a Author's An efficient and highly enantio- and diastereoselective cyclopropanation of olefins catalyzed by Schiff-base ruthenium(II) complexes‏
670 ‎‡a Author's Anthracene-induced turnover enhancement in the manganese porphyrin-catalyzed epoxidation of olefins‏
670 ‎‡a Author's Artificial Enzymes Formed through Directed Assembly of Molecular Square Encapsulated Epoxidation Catalysts‏
670 ‎‡a Author's Assembly of Short-Chain Amphiphilic Homopolymers into Well-Defined Particles‏
670 ‎‡a Author's Axial ligand effects: utilization of chiral sulfoxide additives for the induction of asymmetry in‏
670 ‎‡a Author's Axial ligand effects: utilization of chiral sulfoxide additives for the induction of asymmetry in (salen)ruthenium(II) olefin cyclopropanation catalysts‏
670 ‎‡a Author's Behavior of gradient copolymers at liquid/liquid interfaces‏
670 ‎‡a Author's Bio-inspired borate cross-linking in ultra-stiff graphene oxide thin films‏
670 ‎‡a Author's Bio-inspired carbon nanotube-polymer composite yarns with hydrogen bond-mediated lateral interactions.‏
670 ‎‡a Author's Biological evaluation of pH-responsive polymer-caged nanobins for breast cancer therapy‏
670 ‎‡a Author's [Bis(catechol)salen]MnIII Coordination Polymers as Support-Free Heterogeneous Asymmetric Catalysts for Epoxidation‏
670 ‎‡a Author's Building conjugated organic structures on Si‏
670 ‎‡a Author's Building conjugated organic structures on Si(111) surfaces via microwave-assisted Sonogashira coupling‏
670 ‎‡a Author's Carboxylic Acid- and Ester-Functionalized Siloxane Scaffolds on Glass Studied by Broadband Sum Frequency Generation‏
670 ‎‡a Author's Catalytic Meerwein−Pondorf−Verley Reduction by Simple Aluminum Complexes‏
670 ‎‡a Author's Catalytic, three-component assembly reaction for the synthesis of pyrrolidines‏
670 ‎‡a Author's Cavity-Tailored, Self-Sorting Supramolecular Catalytic Boxes for Selective Oxidation‏
670 ‎‡a Author's Characterization and Purification of Supramolecular Metal Complexes Using Gel-Permeation Chromatography‏
670 ‎‡a Author's Chemical CO‏
670 ‎‡a Author's Chemical CO(2) fixation: Cr(III) salen complexes as highly efficient catalysts for the coupling of CO(2) and epoxides‏
670 ‎‡a Author's Chemically active reduced graphene oxide with tunable C/O ratios‏
670 ‎‡a Author's Chiral (salen)Co(III) catalyst for the synthesis of cyclic carbonates‏
670 ‎‡a Author's "Clickable" polymer nanoparticles: a modular scaffold for surface functionalization.‏
670 ‎‡a Author's Comparative X-ray standing wave analysis of metal-phosphonate multilayer films of dodecane and porphyrin molecular square‏
670 ‎‡a Author's Computational Study of Propylene and Propane Binding in Metal–Organic Frameworks Containing Highly Exposed Cu+ or Ag+ Cations‏
670 ‎‡a Author's Control of carboxylic acid and ester groups on chromium (VI) binding to functionalized silica/water interfaces studied by second harmonic generation‏
670 ‎‡a Author's Cooperative melting in caged dimers of rigid small molecule-DNA hybrids‏
670 ‎‡a Author's Cooperative melting in caged dimers with only two DNA duplexes‏
670 ‎‡a Author's Coordinative Self-Assembly and Solution-Phase X-ray Structural Characterization of Cavity-Tailored Porphyrin Boxes‏
670 ‎‡a Author's Covalent surface modification of a metal-organic framework: selective surface engineering via Cu‏
670 ‎‡a Author's Covalent surface modification of a metal-organic framework: selective surface engineering via Cu(I)-catalyzed Huisgen cycloaddition‏
670 ‎‡a Author's Cross-Linked Micellar Spherical Nucleic Acids from Thermoresponsive Templates.‏
670 ‎‡a Author's Crumpled graphene nanosheets as highly effective barrier property enhancers‏
670 ‎‡a Author's Cyclic metalloporphyrin dimers and tetramers: tunable shape-selective hosts for fullerenes‏
670 ‎‡a Author's De novo synthesis of a metal-organic framework material featuring ultrahigh surface area and gas storage capacities‏
670 ‎‡a Author's Dendronized protein polymers: synthesis and self-assembly of monodisperse cylindrical macromolecules.‏
670 ‎‡a Author's Designing higher surface area metal-organic frameworks: are triple bonds better than phenyls?‏
670 ‎‡a Author's Directed Assembly of Transition-Metal-Coordinated Molecular Loops and Squares from Salen-Type Components. Examples of Metalation-Controlled Structural Conversion‏
670 ‎‡a Author's Discovery of highly selective alkyne semihydrogenation catalysts based on first-row transition-metallated porous organic polymers‏
670 ‎‡a Author's DNA at aqueous/solid interfaces: chirality-based detection via second harmonic generation activity‏
670 ‎‡a Author's DNA-block copolymer conjugates‏
670 ‎‡a Author's Drug-Loaded Polymeric Spherical Nucleic Acids: Enhancing Colloidal Stability and Cellular Uptake of Polymeric Nanoparticles through DNA Surface-Functionalization.‏
670 ‎‡a Author's Effect of secondary substituent on the physical properties, crystal structures, and nanoparticle morphologies of (porphyrin)Sn(OH)2: diversity enabled via synthetic manipulations‏
670 ‎‡a Author's Electrically conductive "alkylated" graphene paper via chemical reduction of amine-functionalized graphene oxide paper‏
670 ‎‡a Author's Enantioselective MSPV Reduction of Ketimines Using 2-Propanol and‏
670 ‎‡a Author's Enantioselective MSPV Reduction of Ketimines Using 2-Propanol and (BINOL)AlIII‏
670 ‎‡a Author's Enhanced activity of enantioselective‏
670 ‎‡a Author's Enhanced activity of enantioselective (salen)Mn(III) epoxidation catalysts through supramolecular complexation‏
670 ‎‡a Author's Enhanced activity of manganese‏
670 ‎‡a Author's Enhanced activity of manganese(III) porphyrin epoxidation catalysts through supramolecular complexation‏
670 ‎‡a Author's Enhanced catalytic activity through the tuning of micropore environment and supercritical CO2 processing: Al‏
670 ‎‡a Author's Enhanced catalytic activity through the tuning of micropore environment and supercritical CO2 processing: Al(porphyrin)-based porous organic polymers for the degradation of a nerve agent simulant‏
670 ‎‡a Author's Enhanced catalytic decomposition of a phosphate triester by modularly accessible bimetallic porphyrin dyads and dimers‏
670 ‎‡a Author's Enhancing the melting properties of small molecule-DNA hybrids through designed hydrophobic interactions: an experimental-computational study.‏
670 ‎‡a Author's Enhancing the Stability and Immunomodulatory Activity of Liposomal Spherical Nucleic Acids through Lipid-Tail DNA Modifications.‏
670 ‎‡a Author's Evolution of order during vacuum-assisted self-assembly of graphene oxide paper and associated polymer nanocomposites‏
670 ‎‡a Author's Exfoliation and reassembly of cobalt oxide nanosheets into a reversible lithium-ion battery cathode‏
670 ‎‡a Author's Experimental-computational study of shear interactions within double-walled carbon nanotube bundles‏
670 ‎‡a Author's Extraordinary improvement of the graphitic structure of continuous carbon nanofibers templated with double wall carbon nanotubes.‏
670 ‎‡a Author's Facile one-step solid-phase synthesis of multitopic organic–DNA hybrids via “click” chemistry‏
670 ‎‡a Author's Functionalized graphene sheets for polymer nanocomposites‏
670 ‎‡a Author's Gas-Phase Dimerization of Ethylene under Mild Conditions Catalyzed by MOF Materials Containing‏
670 ‎‡a Author's Gas-Phase Dimerization of Ethylene under Mild Conditions Catalyzed by MOF Materials Containing (bpy)NiII Complexes‏
670 ‎‡a Author's Graphene-based composite materials‏
670 ‎‡a Author's Graphene oxide, highly reduced graphene oxide, and graphene: versatile building blocks for carbon-based materials.‏
670 ‎‡a Author's Graphene oxide papers modified by divalent ions-enhancing mechanical properties via chemical cross-linking‏
670 ‎‡a Author's Graphene Oxide Sheets Chemically Cross-Linked by Polyallylamine‏
670 ‎‡a Author's Growth of Narrowly Dispersed Porphyrin Nanowires and Their Hierarchical Assembly into Macroscopic Columns‏
670 ‎‡a Author's Hierarchically porous organic polymers: highly enhanced gas uptake and transport through templated synthesis‏
670 ‎‡a Author's High-density doxorubicin-conjugated polymeric nanoparticles via ring-opening metathesis polymerization‏
670 ‎‡a Author's High propene/propane selectivity in isostructural metal-organic frameworks with high densities of open metal sites‏
670 ‎‡a Author's Highly Stable, Ultra-Small Polymer-Grafted Nanobins (usPGNs) with Stimuli-Responsive Capability.‏
670 ‎‡a Author's Hollow porphyrin prisms: modular formation of permanent, torsionally rigid nanostructures via templated olefin metathesis‏
670 ‎‡a Author's Hydrophobic organic linkers in the self-assembly of small molecule-DNA hybrid dimers: a computational-experimental study of the role of linkage direction in product distributions and stabilities.‏
670 ‎‡a Author's Imidazolinium salts as catalysts for the ring-opening alkylation of meso epoxides by alkylaluminum complexes.‏
670 ‎‡a Author's Importance of the DNA "bond" in programmable nanoparticle crystallization‏
670 ‎‡a Author's Improved anti-proliferative effect of doxorubicin-containing polymer nanoparticles upon surface modification with cationic groups‏
670 ‎‡a Author's Interfacial Acidities, Charge Densities, Potentials, and Energies of Carboxylic Acid-Functionalized Silica/Water Interfaces Determined by Second Harmonic Generation‏
670 ‎‡a Author's Intramolecular ring-opening from a CO2-derived nucleophile as the origin of selectivity for 5-substituted oxazolidinone from the‏
670 ‎‡a Author's Intramolecular ring-opening from a CO2-derived nucleophile as the origin of selectivity for 5-substituted oxazolidinone from the (salen)Cr-catalyzed [aziridine + CO2] coupling.‏
670 ‎‡a Author's Key factors limiting carbon nanotube yarn strength: exploring processing-structure-property relationships.‏
670 ‎‡a Author's Ligand-elaboration as a strategy for engendering structural diversity in porous metal–organic framework compounds‏
670 ‎‡a Author's Light-harvesting metal-organic frameworks (MOFs): efficient strut-to-strut energy transfer in bodipy and porphyrin-based MOFs‏
670 ‎‡a Author's Liposomal spherical nucleic acids‏
670 ‎‡a Author's Luminescent infinite coordination polymer materials from metal-terpyridine ligation‏
670 ‎‡a Author's Making “Sense” of DNA‏
670 ‎‡a Author's Metal-organic framework materials as catalysts‏
670 ‎‡a Author's Metal-organic framework materials with ultrahigh surface areas: is the sky the limit?‏
670 ‎‡a Author's Molecular Sieving and Thin Film Transport by Molecular Materials Featuring Large Component Cavities‏
670 ‎‡a Author's Multifunctional polymeric nanoparticles from diverse bioactive agents.‏
670 ‎‡a Author's Nanoscale toughening of ultrathin graphene oxide-polymer composites: mechanochemical insights into hydrogen-bonding/van der Waals interactions, polymer chain alignment, and steric parameters‏
670 ‎‡a Author's One-pot synthesis of Mo(0) dinitrogen complexes possessing monodentate and multidentate phosphine ligands‏
670 ‎‡a Author's Organic Photovoltaics Interdigitated on the Molecular Scale‏
670 ‎‡a Author's pH-Responsive Theranostic Polymer-Caged Nanobins‏
670 ‎‡a Author's pH-Responsive Theranostic Polymer-Caged Nanobins (PCNs): Enhanced Cytotoxicity and T1 MRI Contrast by Her2-Targeting.‏
670 ‎‡a Author's Photophysical and Energy-Transfer Properties of‏
670 ‎‡a Author's Photophysical and Energy-Transfer Properties of (Salen)zinc Complexes and Supramolecular Assemblies‏
670 ‎‡a Author's Polymer Blend Compatibilization by Gradient Copolymer Addition during Melt Processing: Stabilization of Dispersed Phase to Static Coarsening‏
670 ‎‡a Author's Polymer-caged lipsomes: a pH-responsive delivery system with high stability‏
670 ‎‡a Author's Polymer-Caged Nanobins for Synergistic Cisplatin−Doxorubicin Combination Chemotherapy‏
670 ‎‡a Author's Polymer-DNA hybrids as electrochemical probes for the detection of DNA.‏
670 ‎‡a Author's Post-synthesis modification of a metal-organic framework to form metallosalen-containing MOF materials‏
670 ‎‡a Author's Preparation and characterization of graphene oxide paper‏
670 ‎‡a Author's Probing Exciton Localization/Delocalization: Transient dc Photoconductivity Studies of Excited States of Symmetrical Porphyrin Monomers, Oligomers, and Supramolecular Assemblies‏
670 ‎‡a Author's Prospects for nanoporous metal-organic materials in advanced separations processes‏
670 ‎‡a Author's Removal of airborne toxic chemicals by porous organic polymers containing metal-catecholates‏
670 ‎‡a Author's Rendering High Surface Area, Mesoporous Metal-Organic Frameworks Electronically Conductive.‏
670 ‎‡a Author's Reversibly addressing an allosteric catalyst in situ: catalytic molecular tweezers‏
670 ‎‡a Author's Ring-opening metathesis copolymerization employing ruthenium-based metathesis catalysts‏
670 ‎‡a Author's [(Salcen)Cr(III) + Lewis base]-catalyzed synthesis of N-aryl-substituted oxazolidinones from epoxides and aryl isocyanates‏
670 ‎‡a Author's (Salen)chromium(III)/DMAP: an efficient catalyst system for the selective synthesis of 5-substituted oxazolidinones from carbon dioxide and aziridines‏
670 ‎‡a Author's Sc(OTf)(3)-catalyzed condensation of 2-alkyl-N-tosylaziridine with aldehydes or ketones: an efficient synthesis of 5-alkyl-1,3-oxazolidines‏
670 ‎‡a Author's Selective Bifunctional Modification of a Non-catenated Metal−Organic Framework Material via “Click” Chemistry‏
670 ‎‡a Author's Selective surface and near-surface modification of a noncatenated, catalytically active metal-organic framework material based on Mn(salen) struts‏
670 ‎‡a Author's Sharp melting of polymer-DNA hybrids: an associative phase separation approach.‏
670 ‎‡a Author's Sharp Melting Transitions in DNA Hybrids without Aggregate Dissolution: Proof of Neighboring-Duplex Cooperativity‏
670 ‎‡a Author's Signal amplification and detection via a supramolecular allosteric catalyst‏
670 ‎‡a Author's Simple and compelling biomimetic metal-organic framework catalyst for the degradation of nerve agent simulants‏
670 ‎‡a Author's Smart Nanoscale Drug Delivery Platforms from Stimuli-Responsive Polymers and Liposomes.‏
670 ‎‡a Author's Stable aqueous dispersions of graphitic nanoplatelets via the reduction of exfoliated graphite oxide in the presence of poly‏
670 ‎‡a Author's Stable aqueous dispersions of graphitic nanoplatelets via the reduction of exfoliated graphite oxide in the presence of poly(sodium 4-styrenesulfonate)‏
670 ‎‡a Author's Stiffening of graphene oxide films by soft porous sheets‏
670 ‎‡a Author's Substrate encapsulation: an efficient strategy for the RCM synthesis of unsaturated epsilon-lactones.‏
670 ‎‡a Author's Successful stabilization of graphene oxide in electrolyte solutions: enhancement of biofunctionalization and cellular uptake‏
670 ‎‡a Author's Supramolecular Assembly of High-Density Lipoprotein Mimetic Nanoparticles Using Lipid-Conjugated Core Scaffolds‏
670 ‎‡a Author's Supramolecular chemistry: functional structures on the mesoscale.‏
670 ‎‡a Author's Supramolecular porphyrinic prisms: coordinative assembly and solution phase X-ray structural characterization‏
670 ‎‡a Author's Synthesis and characterization of Rhodium‏
670 ‎‡a Author's Synthesis and characterization of Rhodium(III) dichloro complexes with unsymmetrically bound salen-type ligands‏
670 ‎‡a Author's Synthesis and exfoliation of isocyanate-treated graphene oxide nanoplatelets‏
670 ‎‡a Author's Synthesis and In vitro activity of ROMP-based polymer nanoparticles.‏
670 ‎‡a Author's Synthesis of graphene-based nanosheets via chemical reduction of exfoliated graphite oxide‏
670 ‎‡a Author's The asymmetric Meerwein-Schmidt-Ponndorf-Verley reduction of prochiral ketones with iPrOH catalyzed by Al catalysts‏
670 ‎‡a Author's The competing effects of core rigidity and linker flexibility in the nanoassembly of trivalent small molecule-DNA hybrids‏
670 ‎‡a Author's The competing effects of core rigidity and linker flexibility in the nanoassembly of trivalent small molecule-DNA hybrids (SMDH3s)-a synergistic experimental-modeling study.‏
670 ‎‡a Author's The dual capture of AsV and AsIII by UiO-66 and analogues‏
670 ‎‡a Author's The role of viscosity on polymer ink transport in dip-pen nanolithography‏
670 ‎‡a Author's The Role of Water in Mediating Interfacial Adhesion and Shear Strength in Graphene Oxide‏
670 ‎‡a Author's Thermal Conductivity of ZIF-8 Thin-Film under Ambient Gas Pressure.‏
670 ‎‡a Author's trans-Cyclopropyl beta-amino acid derivatives via asymmetric cyclopropanation using a (Salen)Ru(II) catalyst‏
670 ‎‡a Author's Triblock peptide-oligonucleotide chimeras‏
670 ‎‡a Author's Triblock peptide-oligonucleotide chimeras (POCs): programmable biomolecules for the assembly of morphologically tunable and responsive hybrid materials.‏
670 ‎‡a Author's Triggered release of pharmacophores from [Ni(HAsO₃)]-loaded polymer-caged nanobin enhances pro-apoptotic activity: a combined experimental and theoretical study.‏
670 ‎‡a Author's Tuning the mechanical properties of graphene oxide paper and its associated polymer nanocomposites by controlling cooperative intersheet hydrogen bonding.‏
670 ‎‡a Author's Utility of a Ruthenium Metathesis Catalyst for the Preparation of End-Functionalized Polybutadiene‏
670 ‎‡a Author's Vapor-phase metalation by atomic layer deposition in a metal-organic framework‏
670 ‎‡a Author's Walljet Electrochemistry: Quantifying Molecular Transport through Metallopolymeric and Zirconium Phosphonate Assembled Porphyrin Square Thin Films‏
670 ‎‡a Author's X-ray nanoscale profiling of layer-by-layer assembled metal/organophosphonate films.‏
670 ‎‡a Author's X-ray studies of self-assembled organic monolayers grown on hydrogen-terminated Si‏
670 ‎‡a Author's X-ray studies of self-assembled organic monolayers grown on hydrogen-terminated Si(111).‏
670 ‎‡a wikidata site links‏ ‎‡u https://vi.wikipedia.org/wiki/Nguyễn_Sơn_Bình‏
670 ‎‡a wikidata site links‏ ‎‡u https://en.wikipedia.org/wiki/SonBinh_Nguyen‏
909 ‎‡a (orcid) 0000000269773445‏ ‎‡9 1‏
919 ‎‡a synthesisandinvitroactivityofrompbasedpolymernanoparticles‏ ‎‡A Synthesis and In vitro activity of ROMP-based polymer nanoparticles.‏ ‎‡9 1‏
919 ‎‡a synthesisofgraphenebasednanosheetsviachemicalreductionofexfoliatedgraphiteoxide‏ ‎‡A Synthesis of graphene-based nanosheets via chemical reduction of exfoliated graphite oxide‏ ‎‡9 1‏
919 ‎‡a asymmetricmeerweinschmidtponndorfverleyreductionofprochiralketoneswithiprohcatalyzedbyalcatalysts‏ ‎‡A The asymmetric Meerwein-Schmidt-Ponndorf-Verley reduction of prochiral ketones with iPrOH catalyzed by Al catalysts‏ ‎‡9 1‏
919 ‎‡a supramolecularchemistryfunctionalstructuresonthemesoscale‏ ‎‡A Supramolecular chemistry: functional structures on the mesoscale.‏ ‎‡9 1‏
919 ‎‡a competingeffectsofcorerigidityandlinkerflexibilityinthenanoassemblyoftrivalentsmallmoleculednahybrids‏ ‎‡A The competing effects of core rigidity and linker flexibility in the nanoassembly of trivalent small molecule-DNA hybrids‏ ‎‡9 1‏
919 ‎‡a competingeffectsofcorerigidityandlinkerflexibilityinthenanoassemblyoftrivalentsmallmoleculednahybridssmdh3sasynergisticexperimentalmodelingstudy‏ ‎‡A The competing effects of core rigidity and linker flexibility in the nanoassembly of trivalent small molecule-DNA hybrids (SMDH3s)-a synergistic experimental-modeling study.‏ ‎‡9 1‏
919 ‎‡a dualcaptureofasvandasiiibyuio66andanalogues‏ ‎‡A The dual capture of AsV and AsIII by UiO-66 and analogues‏ ‎‡9 1‏
919 ‎‡a supramolecularassemblyofhighdensitylipoproteinmimeticnanoparticlesusinglipidconjugatedcorescaffolds‏ ‎‡A Supramolecular Assembly of High-Density Lipoprotein Mimetic Nanoparticles Using Lipid-Conjugated Core Scaffolds‏ ‎‡9 1‏
919 ‎‡a roleofviscosityonpolymerinktransportindippennanolithography‏ ‎‡A The role of viscosity on polymer ink transport in dip-pen nanolithography‏ ‎‡9 1‏
919 ‎‡a roleofwaterinmediatinginterfacialadhesionandshearstrengthingrapheneoxide‏ ‎‡A The Role of Water in Mediating Interfacial Adhesion and Shear Strength in Graphene Oxide‏ ‎‡9 1‏
919 ‎‡a thermalconductivityofzif8thinfilmunderambientgaspressure‏ ‎‡A Thermal Conductivity of ZIF-8 Thin-Film under Ambient Gas Pressure.‏ ‎‡9 1‏
919 ‎‡a successfulstabilizationofgrapheneoxideinelectrolytesolutionsenhancementofbiofunctionalizationandcellularuptake‏ ‎‡A Successful stabilization of graphene oxide in electrolyte solutions: enhancement of biofunctionalization and cellular uptake‏ ‎‡9 1‏
919 ‎‡a transcyclopropylbetaaminoacidderivativesviaasymmetriccyclopropanationusingasalenru2catalyst‏ ‎‡A trans-Cyclopropyl beta-amino acid derivatives via asymmetric cyclopropanation using a (Salen)Ru(II) catalyst‏ ‎‡9 1‏
919 ‎‡a triblockpeptideoligonucleotidechimeras‏ ‎‡A Triblock peptide-oligonucleotide chimeras‏ ‎‡9 1‏
919 ‎‡a triblockpeptideoligonucleotidechimeraspocsprogrammablebiomoleculesfortheassemblyofmorphologicallytunableandresponsivehybridmaterials‏ ‎‡A Triblock peptide-oligonucleotide chimeras (POCs): programmable biomolecules for the assembly of morphologically tunable and responsive hybrid materials.‏ ‎‡9 1‏
919 ‎‡a substrateencapsulationanefficientstrategyforthercmsynthesisofunsaturatedepsilonlactones‏ ‎‡A Substrate encapsulation: an efficient strategy for the RCM synthesis of unsaturated epsilon-lactones.‏ ‎‡9 1‏
919 ‎‡a triggeredreleaseofpharmacophoresfromloadedpolymercagednanobinenhancesproapoptoticactivityacombinedexperimentalandtheoreticalstudy‏ ‎‡A Triggered release of pharmacophores from [Ni(HAsO₃)]-loaded polymer-caged nanobin enhances pro-apoptotic activity: a combined experimental and theoretical study.‏ ‎‡9 1‏
919 ‎‡a tuningthemechanicalpropertiesofgrapheneoxidepaperanditsassociatedpolymernanocompositesbycontrollingcooperativeintersheethydrogenbonding‏ ‎‡A Tuning the mechanical properties of graphene oxide paper and its associated polymer nanocomposites by controlling cooperative intersheet hydrogen bonding.‏ ‎‡9 1‏
919 ‎‡a utilityofarutheniummetathesiscatalystforthepreparationofendfunctionalizedpolybutadiene‏ ‎‡A Utility of a Ruthenium Metathesis Catalyst for the Preparation of End-Functionalized Polybutadiene‏ ‎‡9 1‏
919 ‎‡a stiffeningofgrapheneoxidefilmsbysoftporoussheets‏ ‎‡A Stiffening of graphene oxide films by soft porous sheets‏ ‎‡9 1‏
919 ‎‡a vaporphasemetalationbyatomiclayerdepositioninametalorganicframework‏ ‎‡A Vapor-phase metalation by atomic layer deposition in a metal-organic framework‏ ‎‡9 1‏
919 ‎‡a walljetelectrochemistryquantifyingmoleculartransportthroughmetallopolymericandzirconiumphosphonateassembledporphyrinsquarethinfilms‏ ‎‡A Walljet Electrochemistry: Quantifying Molecular Transport through Metallopolymeric and Zirconium Phosphonate Assembled Porphyrin Square Thin Films‏ ‎‡9 1‏
919 ‎‡a 10raynanoscaleprofilingoflayerbylayerassembledmetalorganophosphonatefilms‏ ‎‡A X-ray nanoscale profiling of layer-by-layer assembled metal/organophosphonate films.‏ ‎‡9 1‏
919 ‎‡a stableaqueousdispersionsofgraphiticnanoplateletsviathereductionofexfoliatedgraphiteoxideinthepresenceofpolysodium4styrenesulfonate‏ ‎‡A Stable aqueous dispersions of graphitic nanoplatelets via the reduction of exfoliated graphite oxide in the presence of poly(sodium 4-styrenesulfonate)‏ ‎‡9 1‏
919 ‎‡a 10raystudiesofselfassembledorganicmonolayersgrownonhydrogenterminatedsi‏ ‎‡A X-ray studies of self-assembled organic monolayers grown on hydrogen-terminated Si‏ ‎‡9 1‏
919 ‎‡a 10raystudiesofselfassembledorganicmonolayersgrownonhydrogenterminatedsi111‏ ‎‡A X-ray studies of self-assembled organic monolayers grown on hydrogen-terminated Si(111).‏ ‎‡9 1‏
919 ‎‡a stableaqueousdispersionsofgraphiticnanoplateletsviathereductionofexfoliatedgraphiteoxideinthepresenceofpoly‏ ‎‡A Stable aqueous dispersions of graphitic nanoplatelets via the reduction of exfoliated graphite oxide in the presence of poly‏ ‎‡9 1‏
919 ‎‡a smartnanoscaledrugdeliveryplatformsfromstimuliresponsivepolymersandliposomes‏ ‎‡A Smart Nanoscale Drug Delivery Platforms from Stimuli-Responsive Polymers and Liposomes.‏ ‎‡9 1‏
919 ‎‡a simpleandcompellingbiomimeticmetalorganicframeworkcatalystforthedegradationofnerveagentsimulants‏ ‎‡A Simple and compelling biomimetic metal-organic framework catalyst for the degradation of nerve agent simulants‏ ‎‡9 1‏
919 ‎‡a signalamplificationanddetectionviaasupramolecularallostericcatalyst‏ ‎‡A Signal amplification and detection via a supramolecular allosteric catalyst‏ ‎‡9 1‏
919 ‎‡a sharpmeltingtransitionsindnahybridswithoutaggregatedissolutionproofofneighboringduplexcooperativity‏ ‎‡A Sharp Melting Transitions in DNA Hybrids without Aggregate Dissolution: Proof of Neighboring-Duplex Cooperativity‏ ‎‡9 1‏
919 ‎‡a sharpmeltingofpolymerdnahybridsanassociativephaseseparationapproach‏ ‎‡A Sharp melting of polymer-DNA hybrids: an associative phase separation approach.‏ ‎‡9 1‏
919 ‎‡a selectivesurfaceandnearsurfacemodificationofanoncatenatedcatalyticallyactivemetalorganicframeworkmaterialbasedonmnsalenstruts‏ ‎‡A Selective surface and near-surface modification of a noncatenated, catalytically active metal-organic framework material based on Mn(salen) struts‏ ‎‡9 1‏
919 ‎‡a selectivebifunctionalmodificationofanoncatenatedmetalorganicframeworkmaterialviaclickchemistry‏ ‎‡A Selective Bifunctional Modification of a Non-catenated Metal−Organic Framework Material via “Click” Chemistry‏ ‎‡9 1‏
919 ‎‡a scotf3catalyzedcondensationof2alkylntosylaziridinewithaldehydesorketonesanefficientsynthesisof5alkyl13oxazolidines‏ ‎‡A Sc(OTf)(3)-catalyzed condensation of 2-alkyl-N-tosylaziridine with aldehydes or ketones: an efficient synthesis of 5-alkyl-1,3-oxazolidines‏ ‎‡9 1‏
919 ‎‡a salenchromium3dmapanefficientcatalystsystemfortheselectivesynthesisof5substitutedoxazolidinonesfromcarbondioxideandaziridines‏ ‎‡A (Salen)chromium(III)/DMAP: an efficient catalyst system for the selective synthesis of 5-substituted oxazolidinones from carbon dioxide and aziridines‏ ‎‡9 1‏
919 ‎‡a catalyzedsynthesisofnarylsubstitutedoxazolidinonesfromepoxidesandarylisocyanates‏ ‎‡A [(Salcen)Cr(III) + Lewis base]-catalyzed synthesis of N-aryl-substituted oxazolidinones from epoxides and aryl isocyanates‏ ‎‡9 1‏
919 ‎‡a ringopeningmetathesiscopolymerizationemployingrutheniumbasedmetathesiscatalysts‏ ‎‡A Ring-opening metathesis copolymerization employing ruthenium-based metathesis catalysts‏ ‎‡9 1‏
919 ‎‡a reversiblyaddressinganallostericcatalystinsitucatalyticmoleculartweezers‏ ‎‡A Reversibly addressing an allosteric catalyst in situ: catalytic molecular tweezers‏ ‎‡9 1‏
919 ‎‡a renderinghighsurfaceareamesoporousmetalorganicframeworkselectronicallyconductive‏ ‎‡A Rendering High Surface Area, Mesoporous Metal-Organic Frameworks Electronically Conductive.‏ ‎‡9 1‏
919 ‎‡a removalofairbornetoxicchemicalsbyporousorganicpolymerscontainingmetalcatecholates‏ ‎‡A Removal of airborne toxic chemicals by porous organic polymers containing metal-catecholates‏ ‎‡9 1‏
919 ‎‡a prospectsfornanoporousmetalorganicmaterialsinadvancedseparationsprocesses‏ ‎‡A Prospects for nanoporous metal-organic materials in advanced separations processes‏ ‎‡9 1‏
919 ‎‡a probingexcitonlocalizationdelocalizationtransient600photoconductivitystudiesofexcitedstatesofsymmetricalporphyrinmonomersoligomersandsupramolecularassemblies‏ ‎‡A Probing Exciton Localization/Delocalization: Transient dc Photoconductivity Studies of Excited States of Symmetrical Porphyrin Monomers, Oligomers, and Supramolecular Assemblies‏ ‎‡9 1‏
919 ‎‡a preparationandcharacterizationofgrapheneoxidepaper‏ ‎‡A Preparation and characterization of graphene oxide paper‏ ‎‡9 1‏
919 ‎‡a postsynthesismodificationofametalorganicframeworktoformmetallosalencontainingmofmaterials‏ ‎‡A Post-synthesis modification of a metal-organic framework to form metallosalen-containing MOF materials‏ ‎‡9 1‏
919 ‎‡a polymerdnahybridsaselectrochemicalprobesforthedetectionofdna‏ ‎‡A Polymer-DNA hybrids as electrochemical probes for the detection of DNA.‏ ‎‡9 1‏
919 ‎‡a polymercagednanobinsforsynergisticcisplatindoxorubicincombinationchemotherapy‏ ‎‡A Polymer-Caged Nanobins for Synergistic Cisplatin−Doxorubicin Combination Chemotherapy‏ ‎‡9 1‏
919 ‎‡a polymercagedlipsomesaphresponsivedeliverysystemwithhighstability‏ ‎‡A Polymer-caged lipsomes: a pH-responsive delivery system with high stability‏ ‎‡9 1‏
919 ‎‡a polymerblendcompatibilizationbygradientcopolymeradditionduringmeltprocessingstabilizationofdispersedphasetostaticcoarsening‏ ‎‡A Polymer Blend Compatibilization by Gradient Copolymer Addition during Melt Processing: Stabilization of Dispersed Phase to Static Coarsening‏ ‎‡9 1‏
919 ‎‡a photophysicalandenergytransferpropertiesofsalenzinccomplexesandsupramolecularassemblies‏ ‎‡A Photophysical and Energy-Transfer Properties of (Salen)zinc Complexes and Supramolecular Assemblies‏ ‎‡9 1‏
919 ‎‡a photophysicalandenergytransferpropertiesof‏ ‎‡A Photophysical and Energy-Transfer Properties of‏ ‎‡9 1‏
919 ‎‡a phresponsivetheranosticpolymercagednanobinspcnsenhancedcytotoxicityandt1mricontrastbyher2targeting‏ ‎‡A pH-Responsive Theranostic Polymer-Caged Nanobins (PCNs): Enhanced Cytotoxicity and T1 MRI Contrast by Her2-Targeting.‏ ‎‡9 1‏
919 ‎‡a phresponsivetheranosticpolymercagednanobins‏ ‎‡A pH-Responsive Theranostic Polymer-Caged Nanobins‏ ‎‡9 1‏
919 ‎‡a organicphotovoltaicsinterdigitatedonthemolecularscale‏ ‎‡A Organic Photovoltaics Interdigitated on the Molecular Scale‏ ‎‡9 1‏
919 ‎‡a 1potsynthesisofmo0dinitrogencomplexespossessingmonodentateandmultidentatephosphineligands‏ ‎‡A One-pot synthesis of Mo(0) dinitrogen complexes possessing monodentate and multidentate phosphine ligands‏ ‎‡9 1‏
919 ‎‡a nanoscaletougheningofultrathingrapheneoxidepolymercompositesmechanochemicalinsightsintohydrogenbondingvanderwaalsinteractionspolymerchainalignmentandstericparameters‏ ‎‡A Nanoscale toughening of ultrathin graphene oxide-polymer composites: mechanochemical insights into hydrogen-bonding/van der Waals interactions, polymer chain alignment, and steric parameters‏ ‎‡9 1‏
919 ‎‡a multifunctionalpolymericnanoparticlesfromdiversebioactiveagents‏ ‎‡A Multifunctional polymeric nanoparticles from diverse bioactive agents.‏ ‎‡9 1‏
919 ‎‡a molecularsievingandthinfilmtransportbymolecularmaterialsfeaturinglargecomponentcavities‏ ‎‡A Molecular Sieving and Thin Film Transport by Molecular Materials Featuring Large Component Cavities‏ ‎‡9 1‏
919 ‎‡a metalorganicframeworkmaterialswithultrahighsurfaceareasistheskythelimit‏ ‎‡A Metal-organic framework materials with ultrahigh surface areas: is the sky the limit?‏ ‎‡9 1‏
919 ‎‡a metalorganicframeworkmaterialsascatalysts‏ ‎‡A Metal-organic framework materials as catalysts‏ ‎‡9 1‏
919 ‎‡a makingsenseofdna‏ ‎‡A Making “Sense” of DNA‏ ‎‡9 1‏
919 ‎‡a luminescentinfinitecoordinationpolymermaterialsfrommetalterpyridineligation‏ ‎‡A Luminescent infinite coordination polymer materials from metal-terpyridine ligation‏ ‎‡9 1‏
919 ‎‡a liposomalsphericalnucleicacids‏ ‎‡A Liposomal spherical nucleic acids‏ ‎‡9 1‏
919 ‎‡a lightharvestingmetalorganicframeworksmofsefficientstruttostrutenergytransferinbodipyandporphyrinbasedmofs‏ ‎‡A Light-harvesting metal-organic frameworks (MOFs): efficient strut-to-strut energy transfer in bodipy and porphyrin-based MOFs‏ ‎‡9 1‏
919 ‎‡a ligandelaborationasastrategyforengenderingstructuraldiversityinporousmetalorganicframeworkcompounds‏ ‎‡A Ligand-elaboration as a strategy for engendering structural diversity in porous metal–organic framework compounds‏ ‎‡9 1‏
919 ‎‡a keyfactorslimitingcarbonnanotubeyarnstrengthexploringprocessingstructurepropertyrelationships‏ ‎‡A Key factors limiting carbon nanotube yarn strength: exploring processing-structure-property relationships.‏ ‎‡9 1‏
919 ‎‡a intramolecularringopeningfromaco2derivednucleophileastheoriginofselectivityfor5substitutedoxazolidinonefromthesalencrcatalyzedcoupling‏ ‎‡A Intramolecular ring-opening from a CO2-derived nucleophile as the origin of selectivity for 5-substituted oxazolidinone from the (salen)Cr-catalyzed [aziridine + CO2] coupling.‏ ‎‡9 1‏
919 ‎‡a intramolecularringopeningfromaco2derivednucleophileastheoriginofselectivityfor5substitutedoxazolidinonefromthe‏ ‎‡A Intramolecular ring-opening from a CO2-derived nucleophile as the origin of selectivity for 5-substituted oxazolidinone from the‏ ‎‡9 1‏
919 ‎‡a interfacialaciditieschargedensitiespotentialsandenergiesofcarboxylicacidfunctionalizedsilicawaterinterfacesdeterminedby2harmonicgeneration‏ ‎‡A Interfacial Acidities, Charge Densities, Potentials, and Energies of Carboxylic Acid-Functionalized Silica/Water Interfaces Determined by Second Harmonic Generation‏ ‎‡9 1‏
919 ‎‡a improvedantiproliferativeeffectofdoxorubicincontainingpolymernanoparticlesuponsurfacemodificationwithcationicgroups‏ ‎‡A Improved anti-proliferative effect of doxorubicin-containing polymer nanoparticles upon surface modification with cationic groups‏ ‎‡9 1‏
919 ‎‡a importanceofthednabondinprogrammablenanoparticlecrystallization‏ ‎‡A Importance of the DNA "bond" in programmable nanoparticle crystallization‏ ‎‡9 1‏
919 ‎‡a imidazoliniumsaltsascatalystsfortheringopeningalkylationofmesoepoxidesbyalkylaluminumcomplexes‏ ‎‡A Imidazolinium salts as catalysts for the ring-opening alkylation of meso epoxides by alkylaluminum complexes.‏ ‎‡9 1‏
919 ‎‡a hydrophobicorganiclinkersintheselfassemblyofsmallmoleculednahybriddimersacomputationalexperimentalstudyoftheroleoflinkagedirectioninproductdistributionsandstabilities‏ ‎‡A Hydrophobic organic linkers in the self-assembly of small molecule-DNA hybrid dimers: a computational-experimental study of the role of linkage direction in product distributions and stabilities.‏ ‎‡9 1‏
919 ‎‡a hollowporphyrinprismsmodularformationofpermanenttorsionallyrigidnanostructuresviatemplatedolefinmetathesis‏ ‎‡A Hollow porphyrin prisms: modular formation of permanent, torsionally rigid nanostructures via templated olefin metathesis‏ ‎‡9 1‏
919 ‎‡a highlystableultrasmallpolymergraftednanobinsuspgnswithstimuliresponsivecapability‏ ‎‡A Highly Stable, Ultra-Small Polymer-Grafted Nanobins (usPGNs) with Stimuli-Responsive Capability.‏ ‎‡9 1‏
919 ‎‡a highpropenepropaneselectivityinisostructuralmetalorganicframeworkswithhighdensitiesofopenmetalsites‏ ‎‡A High propene/propane selectivity in isostructural metal-organic frameworks with high densities of open metal sites‏ ‎‡9 1‏
919 ‎‡a highdensitydoxorubicinconjugatedpolymericnanoparticlesviaringopeningmetathesispolymerization‏ ‎‡A High-density doxorubicin-conjugated polymeric nanoparticles via ring-opening metathesis polymerization‏ ‎‡9 1‏
919 ‎‡a hierarchicallyporousorganicpolymershighlyenhancedgasuptakeandtransportthroughtemplatedsynthesis‏ ‎‡A Hierarchically porous organic polymers: highly enhanced gas uptake and transport through templated synthesis‏ ‎‡9 1‏
919 ‎‡a growthofnarrowlydispersedporphyrinnanowiresandtheirhierarchicalassemblyintomacroscopiccolumns‏ ‎‡A Growth of Narrowly Dispersed Porphyrin Nanowires and Their Hierarchical Assembly into Macroscopic Columns‏ ‎‡9 1‏
919 ‎‡a grapheneoxidesheetschemicallycrosslinkedbypolyallylamine‏ ‎‡A Graphene Oxide Sheets Chemically Cross-Linked by Polyallylamine‏ ‎‡9 1‏
919 ‎‡a grapheneoxidepapersmodifiedbydivalentionsenhancingmechanicalpropertiesviachemicalcrosslinking‏ ‎‡A Graphene oxide papers modified by divalent ions-enhancing mechanical properties via chemical cross-linking‏ ‎‡9 1‏
919 ‎‡a grapheneoxidehighlyreducedgrapheneoxideandgrapheneversatilebuildingblocksforcarbonbasedmaterials‏ ‎‡A Graphene oxide, highly reduced graphene oxide, and graphene: versatile building blocks for carbon-based materials.‏ ‎‡9 1‏
919 ‎‡a graphenebasedcompositematerials‏ ‎‡A Graphene-based composite materials‏ ‎‡9 1‏
919 ‎‡a gasphasedimerizationofethyleneundermildconditionscatalyzedbymofmaterialscontainingbpyniiicomplexes‏ ‎‡A Gas-Phase Dimerization of Ethylene under Mild Conditions Catalyzed by MOF Materials Containing (bpy)NiII Complexes‏ ‎‡9 1‏
919 ‎‡a gasphasedimerizationofethyleneundermildconditionscatalyzedbymofmaterialscontaining‏ ‎‡A Gas-Phase Dimerization of Ethylene under Mild Conditions Catalyzed by MOF Materials Containing‏ ‎‡9 1‏
919 ‎‡a functionalizedgraphenesheetsforpolymernanocomposites‏ ‎‡A Functionalized graphene sheets for polymer nanocomposites‏ ‎‡9 1‏
919 ‎‡a facile1stepsolidphasesynthesisofmultitopicorganicdnahybridsviaclickchemistry‏ ‎‡A Facile one-step solid-phase synthesis of multitopic organic–DNA hybrids via “click” chemistry‏ ‎‡9 1‏
919 ‎‡a extraordinaryimprovementofthegraphiticstructureofcontinuouscarbonnanofiberstemplatedwithdoublewallcarbonnanotubes‏ ‎‡A Extraordinary improvement of the graphitic structure of continuous carbon nanofibers templated with double wall carbon nanotubes.‏ ‎‡9 1‏
919 ‎‡a experimentalcomputationalstudyofshearinteractionswithindoublewalledcarbonnanotubebundles‏ ‎‡A Experimental-computational study of shear interactions within double-walled carbon nanotube bundles‏ ‎‡9 1‏
919 ‎‡a exfoliationandreassemblyofcobaltoxidenanosheetsintoareversiblelithiumionbatterycathode‏ ‎‡A Exfoliation and reassembly of cobalt oxide nanosheets into a reversible lithium-ion battery cathode‏ ‎‡9 1‏
919 ‎‡a evolutionoforderduringvacuumassistedselfassemblyofgrapheneoxidepaperandassociatedpolymernanocomposites‏ ‎‡A Evolution of order during vacuum-assisted self-assembly of graphene oxide paper and associated polymer nanocomposites‏ ‎‡9 1‏
919 ‎‡a enhancingthestabilityandimmunomodulatoryactivityofliposomalsphericalnucleicacidsthroughlipidtaildnamodifications‏ ‎‡A Enhancing the Stability and Immunomodulatory Activity of Liposomal Spherical Nucleic Acids through Lipid-Tail DNA Modifications.‏ ‎‡9 1‏
919 ‎‡a enhancingthemeltingpropertiesofsmallmoleculednahybridsthroughdesignedhydrophobicinteractionsanexperimentalcomputationalstudy‏ ‎‡A Enhancing the melting properties of small molecule-DNA hybrids through designed hydrophobic interactions: an experimental-computational study.‏ ‎‡9 1‏
919 ‎‡a enhancedcatalyticdecompositionofaphosphatetriesterbymodularlyaccessiblebimetallicporphyrindyadsanddimers‏ ‎‡A Enhanced catalytic decomposition of a phosphate triester by modularly accessible bimetallic porphyrin dyads and dimers‏ ‎‡9 1‏
919 ‎‡a enhancedcatalyticactivitythroughthetuningofmicroporeenvironmentandsupercriticalco2processingalporphyrinbasedporousorganicpolymersforthedegradationofanerveagentsimulant‏ ‎‡A Enhanced catalytic activity through the tuning of micropore environment and supercritical CO2 processing: Al(porphyrin)-based porous organic polymers for the degradation of a nerve agent simulant‏ ‎‡9 1‏
919 ‎‡a enhancedcatalyticactivitythroughthetuningofmicroporeenvironmentandsupercriticalco2processingal‏ ‎‡A Enhanced catalytic activity through the tuning of micropore environment and supercritical CO2 processing: Al‏ ‎‡9 1‏
919 ‎‡a enhancedactivityofmanganese3porphyrinepoxidationcatalyststhroughsupramolecularcomplexation‏ ‎‡A Enhanced activity of manganese(III) porphyrin epoxidation catalysts through supramolecular complexation‏ ‎‡9 1‏
919 ‎‡a enhancedactivityofmanganese‏ ‎‡A Enhanced activity of manganese‏ ‎‡9 1‏
919 ‎‡a enhancedactivityofenantioselectivesalenmn3epoxidationcatalyststhroughsupramolecularcomplexation‏ ‎‡A Enhanced activity of enantioselective (salen)Mn(III) epoxidation catalysts through supramolecular complexation‏ ‎‡9 1‏
919 ‎‡a enhancedactivityofenantioselective‏ ‎‡A Enhanced activity of enantioselective‏ ‎‡9 1‏
919 ‎‡a enantioselectivemspvreductionofketiminesusing2propanolandbinolaliii‏ ‎‡A Enantioselective MSPV Reduction of Ketimines Using 2-Propanol and (BINOL)AlIII‏ ‎‡9 1‏
919 ‎‡a enantioselectivemspvreductionofketiminesusing2propanoland‏ ‎‡A Enantioselective MSPV Reduction of Ketimines Using 2-Propanol and‏ ‎‡9 1‏
919 ‎‡a electricallyconductivealkylatedgraphenepaperviachemicalreductionofaminefunctionalizedgrapheneoxidepaper‏ ‎‡A Electrically conductive "alkylated" graphene paper via chemical reduction of amine-functionalized graphene oxide paper‏ ‎‡9 1‏
919 ‎‡a effectofsecondarysubstituentonthephysicalpropertiescrystalstructuresandnanoparticlemorphologiesofporphyrinsn52diversityenabledviasyntheticmanipulations‏ ‎‡A Effect of secondary substituent on the physical properties, crystal structures, and nanoparticle morphologies of (porphyrin)Sn(OH)2: diversity enabled via synthetic manipulations‏ ‎‡9 1‏
919 ‎‡a drugloadedpolymericsphericalnucleicacidsenhancingcolloidalstabilityandcellularuptakeofpolymericnanoparticlesthroughdnasurfacefunctionalization‏ ‎‡A Drug-Loaded Polymeric Spherical Nucleic Acids: Enhancing Colloidal Stability and Cellular Uptake of Polymeric Nanoparticles through DNA Surface-Functionalization.‏ ‎‡9 1‏
919 ‎‡a dnablockcopolymerconjugates‏ ‎‡A DNA-block copolymer conjugates‏ ‎‡9 1‏
919 ‎‡a dnaataqueoussolidinterfaceschiralitybaseddetectionvia2harmonicgenerationactivity‏ ‎‡A DNA at aqueous/solid interfaces: chirality-based detection via second harmonic generation activity‏ ‎‡9 1‏
919 ‎‡a discoveryofhighlyselectivealkynesemihydrogenationcatalystsbasedon1rowtransitionmetallatedporousorganicpolymers‏ ‎‡A Discovery of highly selective alkyne semihydrogenation catalysts based on first-row transition-metallated porous organic polymers‏ ‎‡9 1‏
919 ‎‡a directedassemblyoftransitionmetalcoordinatedmolecularloopsandsquaresfromsalentypecomponentsexamplesofmetalationcontrolledstructuralconversion‏ ‎‡A Directed Assembly of Transition-Metal-Coordinated Molecular Loops and Squares from Salen-Type Components. Examples of Metalation-Controlled Structural Conversion‏ ‎‡9 1‏
919 ‎‡a designinghighersurfaceareametalorganicframeworksaretriplebondsbetterthanphenyls‏ ‎‡A Designing higher surface area metal-organic frameworks: are triple bonds better than phenyls?‏ ‎‡9 1‏
919 ‎‡a dendronizedproteinpolymerssynthesisandselfassemblyofmonodispersecylindricalmacromolecules‏ ‎‡A Dendronized protein polymers: synthesis and self-assembly of monodisperse cylindrical macromolecules.‏ ‎‡9 1‏
919 ‎‡a novosynthesisofametalorganicframeworkmaterialfeaturingultrahighsurfaceareaandgasstoragecapacities‏ ‎‡A De novo synthesis of a metal-organic framework material featuring ultrahigh surface area and gas storage capacities‏ ‎‡9 1‏
919 ‎‡a cyclicmetalloporphyrindimersandtetramerstunableshapeselectivehostsforfullerenes‏ ‎‡A Cyclic metalloporphyrin dimers and tetramers: tunable shape-selective hosts for fullerenes‏ ‎‡9 1‏
919 ‎‡a crumpledgraphenenanosheetsashighlyeffectivebarrierpropertyenhancers‏ ‎‡A Crumpled graphene nanosheets as highly effective barrier property enhancers‏ ‎‡9 1‏
919 ‎‡a crosslinkedmicellarsphericalnucleicacidsfromthermoresponsivetemplates‏ ‎‡A Cross-Linked Micellar Spherical Nucleic Acids from Thermoresponsive Templates.‏ ‎‡9 1‏
919 ‎‡a covalentsurfacemodificationofametalorganicframeworkselectivesurfaceengineeringviacu1catalyzedhuisgencycloaddition‏ ‎‡A Covalent surface modification of a metal-organic framework: selective surface engineering via Cu(I)-catalyzed Huisgen cycloaddition‏ ‎‡9 1‏
919 ‎‡a covalentsurfacemodificationofametalorganicframeworkselectivesurfaceengineeringviacu‏ ‎‡A Covalent surface modification of a metal-organic framework: selective surface engineering via Cu‏ ‎‡9 1‏
919 ‎‡a coordinativeselfassemblyandsolutionphase10raystructuralcharacterizationofcavitytailoredporphyrinboxes‏ ‎‡A Coordinative Self-Assembly and Solution-Phase X-ray Structural Characterization of Cavity-Tailored Porphyrin Boxes‏ ‎‡9 1‏
919 ‎‡a cooperativemeltingincageddimerswithonly2dnaduplexes‏ ‎‡A Cooperative melting in caged dimers with only two DNA duplexes‏ ‎‡9 1‏
919 ‎‡a cooperativemeltingincageddimersofrigidsmallmoleculednahybrids‏ ‎‡A Cooperative melting in caged dimers of rigid small molecule-DNA hybrids‏ ‎‡9 1‏
919 ‎‡a controlofcarboxylicacidandestergroupsonchromium6bindingtofunctionalizedsilicawaterinterfacesstudiedby2harmonicgeneration‏ ‎‡A Control of carboxylic acid and ester groups on chromium (VI) binding to functionalized silica/water interfaces studied by second harmonic generation‏ ‎‡9 1‏
919 ‎‡a computationalstudyofpropyleneandpropanebindinginmetalorganicframeworkscontaininghighlyexposedcu+orag+cations‏ ‎‡A Computational Study of Propylene and Propane Binding in Metal–Organic Frameworks Containing Highly Exposed Cu+ or Ag+ Cations‏ ‎‡9 1‏
919 ‎‡a comparative10raystandingwaveanalysisofmetalphosphonatemultilayerfilmsofdodecaneandporphyrinmolecularsquare‏ ‎‡A Comparative X-ray standing wave analysis of metal-phosphonate multilayer films of dodecane and porphyrin molecular square‏ ‎‡9 1‏
919 ‎‡a clickablepolymernanoparticlesamodularscaffoldforsurfacefunctionalization‏ ‎‡A "Clickable" polymer nanoparticles: a modular scaffold for surface functionalization.‏ ‎‡9 1‏
919 ‎‡a chiralsalenco3catalystforthesynthesisofcycliccarbonates‏ ‎‡A Chiral (salen)Co(III) catalyst for the synthesis of cyclic carbonates‏ ‎‡9 1‏
919 ‎‡a chemicallyactivereducedgrapheneoxidewithtunable100oratios‏ ‎‡A Chemically active reduced graphene oxide with tunable C/O ratios‏ ‎‡9 1‏
919 ‎‡a chemicalco2fixationcr3salencomplexesashighlyefficientcatalystsforthecouplingofco2andepoxides‏ ‎‡A Chemical CO(2) fixation: Cr(III) salen complexes as highly efficient catalysts for the coupling of CO(2) and epoxides‏ ‎‡9 1‏
919 ‎‡a chemicalco‏ ‎‡A Chemical CO‏ ‎‡9 1‏
919 ‎‡a characterizationandpurificationofsupramolecularmetalcomplexesusinggelpermeationchromatography‏ ‎‡A Characterization and Purification of Supramolecular Metal Complexes Using Gel-Permeation Chromatography‏ ‎‡9 1‏
919 ‎‡a cavitytailoredselfsortingsupramolecularcatalyticboxesforselectiveoxidation‏ ‎‡A Cavity-Tailored, Self-Sorting Supramolecular Catalytic Boxes for Selective Oxidation‏ ‎‡9 1‏
919 ‎‡a catalytic3componentassemblyreactionforthesynthesisofpyrrolidines‏ ‎‡A Catalytic, three-component assembly reaction for the synthesis of pyrrolidines‏ ‎‡9 1‏
919 ‎‡a catalyticmeerweinpondorfverleyreductionbysimplealuminumcomplexes‏ ‎‡A Catalytic Meerwein−Pondorf−Verley Reduction by Simple Aluminum Complexes‏ ‎‡9 1‏
919 ‎‡a carboxylicacidandesterfunctionalizedsiloxanescaffoldsonglassstudiedbybroadbandsumfrequencygeneration‏ ‎‡A Carboxylic Acid- and Ester-Functionalized Siloxane Scaffolds on Glass Studied by Broadband Sum Frequency Generation‏ ‎‡9 1‏
919 ‎‡a buildingconjugatedorganicstructuresonsi111surfacesviamicrowaveassistedsonogashiracoupling‏ ‎‡A Building conjugated organic structures on Si(111) surfaces via microwave-assisted Sonogashira coupling‏ ‎‡9 1‏
919 ‎‡a buildingconjugatedorganicstructuresonsi‏ ‎‡A Building conjugated organic structures on Si‏ ‎‡9 1‏
919 ‎‡a mniiicoordinationpolymersassupportfreeheterogeneousasymmetriccatalystsforepoxidation‏ ‎‡A [Bis(catechol)salen]MnIII Coordination Polymers as Support-Free Heterogeneous Asymmetric Catalysts for Epoxidation‏ ‎‡9 1‏
919 ‎‡a biologicalevaluationofphresponsivepolymercagednanobinsforbreastcancertherapy‏ ‎‡A Biological evaluation of pH-responsive polymer-caged nanobins for breast cancer therapy‏ ‎‡9 1‏
919 ‎‡a bioinspiredcarbonnanotubepolymercompositeyarnswithhydrogenbondmediatedlateralinteractions‏ ‎‡A Bio-inspired carbon nanotube-polymer composite yarns with hydrogen bond-mediated lateral interactions.‏ ‎‡9 1‏
919 ‎‡a bioinspiredboratecrosslinkinginultrastiffgrapheneoxidethinfilms‏ ‎‡A Bio-inspired borate cross-linking in ultra-stiff graphene oxide thin films‏ ‎‡9 1‏
919 ‎‡a behaviorofgradientcopolymersatliquidliquidinterfaces‏ ‎‡A Behavior of gradient copolymers at liquid/liquid interfaces‏ ‎‡9 1‏
919 ‎‡a axialligandeffectsutilizationofchiralsulfoxideadditivesfortheinductionofasymmetryinsalenruthenium2olefincyclopropanationcatalysts‏ ‎‡A Axial ligand effects: utilization of chiral sulfoxide additives for the induction of asymmetry in (salen)ruthenium(II) olefin cyclopropanation catalysts‏ ‎‡9 1‏
919 ‎‡a axialligandeffectsutilizationofchiralsulfoxideadditivesfortheinductionofasymmetryin‏ ‎‡A Axial ligand effects: utilization of chiral sulfoxide additives for the induction of asymmetry in‏ ‎‡9 1‏
919 ‎‡a assemblyofshortchainamphiphilichomopolymersintowelldefinedparticles‏ ‎‡A Assembly of Short-Chain Amphiphilic Homopolymers into Well-Defined Particles‏ ‎‡9 1‏
919 ‎‡a artificialenzymesformedthroughdirectedassemblyofmolecularsquareencapsulatedepoxidationcatalysts‏ ‎‡A Artificial Enzymes Formed through Directed Assembly of Molecular Square Encapsulated Epoxidation Catalysts‏ ‎‡9 1‏
919 ‎‡a anthraceneinducedturnoverenhancementinthemanganeseporphyrincatalyzedepoxidationofolefins‏ ‎‡A Anthracene-induced turnover enhancement in the manganese porphyrin-catalyzed epoxidation of olefins‏ ‎‡9 1‏
919 ‎‡a efficientandhighlyenantioanddiastereoselectivecyclopropanationofolefinscatalyzedbyschiffbaseruthenium2complexes‏ ‎‡A An efficient and highly enantio- and diastereoselective cyclopropanation of olefins catalyzed by Schiff-base ruthenium(II) complexes‏ ‎‡9 1‏
919 ‎‡a efficientandhighlyenantioanddiastereoselectivecyclopropanationofolefinscatalyzedbyschiffbaseruthenium‏ ‎‡A An efficient and highly enantio- and diastereoselective cyclopropanation of olefins catalyzed by Schiff-base ruthenium‏ ‎‡9 1‏
919 ‎‡a amphiphilicporphyrinnanocrystalsmorphologytuningandhierarchicalassembly‏ ‎‡A Amphiphilic Porphyrin Nanocrystals: Morphology Tuning and Hierarchical Assembly‏ ‎‡9 1‏
919 ‎‡a allostericallyregulatedsupramolecularcatalysisofacyltransferreactionsforsignalamplificationanddetectionofsmallmolecules‏ ‎‡A Allosterically regulated supramolecular catalysis of acyl transfer reactions for signal amplification and detection of small molecules‏ ‎‡9 1‏
919 ‎‡a activesiteaccessibleporphyrinicmetalorganicframeworkmaterials‏ ‎‡A Active-site-accessible, porphyrinic metal-organic framework materials‏ ‎‡9 1‏
919 ‎‡a aciddegradablepolymercagedlipoplexpclplatformforsirnadeliveryfacilecellulartriggeredreleaseofsirna‏ ‎‡A Acid-degradable polymer-caged lipoplex (PCL) platform for siRNA delivery: facile cellular triggered release of siRNA‏ ‎‡9 1‏
919 ‎‡a aciddegradablepolymercagedlipoplex‏ ‎‡A Acid-degradable polymer-caged lipoplex‏ ‎‡9 1‏
919 ‎‡a znbasedpillaredpaddlewheelmofcontainingfreecarboxylicacidsviacovalentpostsynthesiselaboration‏ ‎‡A A Zn-based, pillared paddlewheel MOF containing free carboxylic acids via covalent post-synthesis elaboration‏ ‎‡9 1‏
919 ‎‡a metalorganicframeworkmaterialthatfunctionsasanenantioselectivecatalystforolefinepoxidation‏ ‎‡A A metal–organic framework material that functions as an enantioselective catalyst for olefin epoxidation‏ ‎‡9 1‏
919 ‎‡a mechanisticinvestigationoftheasymmetricmeerweinschmidtponndorfverleyreductioncatalyzedbybinolalme3structurekineticsandenantioselectivity‏ ‎‡A A mechanistic investigation of the asymmetric Meerwein-Schmidt-Ponndorf-Verley reduction catalyzed by BINOL/AlMe(3)-structure, kinetics, and enantioselectivity‏ ‎‡9 1‏
919 ‎‡a highlymodularandconvergentapproachforthesynthesisofstimulantresponsiveheteroligatedcofacialporphyrintweezercomplexes‏ ‎‡A A highly modular and convergent approach for the synthesis of stimulant-responsive heteroligated cofacial porphyrin tweezer complexes‏ ‎‡9 1‏
919 ‎‡a generalhighyieldroutetobissalicylaldiminezinc2complexesapplicationtothesynthesisofpyridinemodifiedsalentypezinc2complexes‏ ‎‡A A general high-yield route to bis(salicylaldimine) zinc(II) complexes: application to the synthesis of pyridine-modified salen-type zinc(II) complexes‏ ‎‡9 1‏
919 ‎‡a generalhighyieldroutetobis‏ ‎‡A A general high-yield route to bis‏ ‎‡9 1‏
919 ‎‡a convergentcoordinationchemistrybasedapproachtodissymmetricmacrocycliccofacialporphyrincomplexes‏ ‎‡A A convergent coordination chemistry-based approach to dissymmetric macrocyclic cofacial porphyrin complexes‏ ‎‡9 1‏
919 ‎‡a computationalstudyofthemechanismofthecatalyzedformationofcycliccarbonatesfromco2andepoxide‏ ‎‡A A computational study of the mechanism of the [(salen)Cr + DMAP]-catalyzed formation of cyclic carbonates from CO2 and epoxide.‏ ‎‡9 1‏
919 ‎‡a computationalstudyofthemechanismofthe‏ ‎‡A A computational study of the mechanism of the [‏ ‎‡9 1‏
919 ‎‡a catalyticallyactivepermanentlymicroporousmofwithmetalloporphyrinstruts‏ ‎‡A A catalytically active, permanently microporous MOF with metalloporphyrin struts‏ ‎‡9 1‏
919 ‎‡a synthesisandcharacterizationofrhodium‏ ‎‡A Synthesis and characterization of Rhodium‏ ‎‡9 1‏
919 ‎‡a synthesisandcharacterizationofrhodium3dichlorocomplexeswithunsymmetricallyboundsalentypeligands‏ ‎‡A Synthesis and characterization of Rhodium(III) dichloro complexes with unsymmetrically bound salen-type ligands‏ ‎‡9 1‏
919 ‎‡a synthesisandexfoliationofisocyanatetreatedgrapheneoxidenanoplatelets‏ ‎‡A Synthesis and exfoliation of isocyanate-treated graphene oxide nanoplatelets‏ ‎‡9 1‏
919 ‎‡a supramolecularporphyrinicprismscoordinativeassemblyandsolutionphase10raystructuralcharacterization‏ ‎‡A Supramolecular porphyrinic prisms: coordinative assembly and solution phase X-ray structural characterization‏ ‎‡9 1‏
946 ‎‡a b‏ ‎‡9 1‏
947 ‎‡a US‏ ‎‡9 1‏
996 ‎‡2 ISNI|0000000001763764‏
996 ‎‡2 ISNI|0000000000897517‏
996 ‎‡2 DNB|115836024X‏
996 ‎‡2 LC|n 97041694‏
996 ‎‡2 ISNI|0000000029929914‏
996 ‎‡2 ISNI|0000000052599490‏
996 ‎‡2 DNB|137286880‏
996 ‎‡2 ISNI|0000000009299986‏
996 ‎‡2 LC|no2007141920‏
996 ‎‡2 LC|n 98065504‏
996 ‎‡2 ISNI|0000000011913658‏
996 ‎‡2 LC|n 85185014‏
996 ‎‡2 DNB|172652448‏
996 ‎‡2 DNB|1020208678‏
996 ‎‡2 DNB|1049819810‏
996 ‎‡2 BNF|16517170‏
996 ‎‡2 LC|n 88241145‏
996 ‎‡2 DNB|111276241‏
996 ‎‡2 LC|no2015105842‏
996 ‎‡2 NII|DA15587526‏
996 ‎‡2 LC|nr 99019021‏
996 ‎‡2 ISNI|000000006706865X‏
996 ‎‡2 DNB|1306920906‏
996 ‎‡2 NII|DA20034548‏
996 ‎‡2 PLWABN|9810636123405606‏
996 ‎‡2 BNF|12262730‏
996 ‎‡2 NTA|39375748X‏
996 ‎‡2 DNB|114120811‏
996 ‎‡2 ISNI|0000000399528915‏
996 ‎‡2 DNB|122774384X‏
996 ‎‡2 NDL|01182924‏
996 ‎‡2 NKC|xx0000413‏
996 ‎‡2 ISNI|0000000049949971‏
996 ‎‡2 LC|nr2001027310‏
996 ‎‡2 DNB|1136475893‏
996 ‎‡2 LC|nb2006020152‏
996 ‎‡2 NTA|216916186‏
996 ‎‡2 LC|n 98093506‏
996 ‎‡2 SUDOC|185840078‏
996 ‎‡2 CAOONL|ncf12099105‏
996 ‎‡2 DNB|1014968399‏
996 ‎‡2 ISNI|0000000436033058‏
996 ‎‡2 RERO|A013622347‏
996 ‎‡2 NII|DA15740237‏
996 ‎‡2 LC|nr 98007095‏
996 ‎‡2 BNF|12269524‏
996 ‎‡2 CAOONL|ncf10720874‏
996 ‎‡2 ISNI|000000010786810X‏
996 ‎‡2 LC|n 2015051956‏
996 ‎‡2 LC|n 97061789‏
996 ‎‡2 SUDOC|028187067‏
996 ‎‡2 ISNI|0000000108375227‏
996 ‎‡2 DNB|1043359125‏
996 ‎‡2 BNF|10507905‏
996 ‎‡2 J9U|987007280209905171‏
996 ‎‡2 ISNI|0000000011385429‏
996 ‎‡2 LC|n 2011065698‏
996 ‎‡2 LC|no2010080100‏
996 ‎‡2 BNF|15066700‏
996 ‎‡2 SUDOC|16054520X‏
996 ‎‡2 J9U|987007459964005171‏
996 ‎‡2 DNB|1283980134‏
996 ‎‡2 BNF|13018401‏
996 ‎‡2 BNE|XX1005909‏
996 ‎‡2 LC|nr 00014586‏
996 ‎‡2 ISNI|000000004100253X‏
996 ‎‡2 DNB|133557960‏
996 ‎‡2 ISNI|0000000121417698‏
996 ‎‡2 ISNI|0000000066030852‏
996 ‎‡2 DNB|1345916051‏
996 ‎‡2 BNF|17777242‏
996 ‎‡2 BNF|12376613‏
996 ‎‡2 DNB|1255073098‏
996 ‎‡2 ISNI|0000000051232005‏
996 ‎‡2 LC|n 93034519‏
996 ‎‡2 SUDOC|032231059‏
996 ‎‡2 DNB|109591006X‏
996 ‎‡2 DNB|109407938‏
996 ‎‡2 LC|no2010021786‏
996 ‎‡2 SUDOC|166002348‏
996 ‎‡2 ISNI|0000000077405648‏
996 ‎‡2 LC|n 2005012077‏
996 ‎‡2 DNB|114884846‏
996 ‎‡2 SUDOC|031407277‏
996 ‎‡2 LC|no2007130085‏
996 ‎‡2 DNB|1202467571‏
996 ‎‡2 DNB|133288633‏
996 ‎‡2 LC|n 98004782‏
996 ‎‡2 ISNI|0000000061572791‏
996 ‎‡2 DNB|173476902‏
996 ‎‡2 ISNI|000000003429065X‏
996 ‎‡2 ISNI|0000000017776906‏
996 ‎‡2 BNF|14565910‏
996 ‎‡2 SUDOC|121935779‏
996 ‎‡2 DNB|1313838489‏
996 ‎‡2 BNF|12408462‏
996 ‎‡2 LC|n 88192172‏
996 ‎‡2 ISNI|000000005224303X‏
996 ‎‡2 ISNI|0000000054783072‏
996 ‎‡2 BNF|13017498‏
996 ‎‡2 ISNI|0000000079302503‏
996 ‎‡2 SUDOC|203709098‏
996 ‎‡2 LC|n 2015246029‏
996 ‎‡2 DNB|1332851908‏
996 ‎‡2 DNB|1281047635‏
996 ‎‡2 DNB|1057972045‏
996 ‎‡2 BNF|12100596‏
996 ‎‡2 LC|n 95072522‏
996 ‎‡2 BIBSYS|90733111‏
996 ‎‡2 NLA|000035939139‏
996 ‎‡2 RERO|A009583659‏
996 ‎‡2 NLA|000035500990‏
996 ‎‡2 NII|DA1932755X‏
996 ‎‡2 ISNI|0000000040346306‏
996 ‎‡2 LC|no2012055923‏
996 ‎‡2 ISNI|000000006363102X‏
996 ‎‡2 BNF|14022252‏
996 ‎‡2 LC|n 97021064‏
996 ‎‡2 ISNI|0000000376660980‏
996 ‎‡2 ISNI|0000000081989113‏
996 ‎‡2 LC|no2009107507‏
996 ‎‡2 ISNI|0000000434905684‏
996 ‎‡2 RERO|A016429003‏
996 ‎‡2 ISNI|0000000038090145‏
996 ‎‡2 DNB|1196999694‏
996 ‎‡2 LC|n 87146037‏
996 ‎‡2 DNB|1238087221‏
996 ‎‡2 LC|n 88286951‏
996 ‎‡2 LC|nr2001051163‏
996 ‎‡2 DNB|1074369041‏
996 ‎‡2 DNB|1224695739‏
996 ‎‡2 LC|no2008021294‏
996 ‎‡2 ISNI|0000000024800804‏
996 ‎‡2 ISNI|0000000357479326‏
996 ‎‡2 LC|no2007145440‏
996 ‎‡2 BNF|13604544‏
996 ‎‡2 ISNI|0000000077311991‏
996 ‎‡2 LC|n 2007034275‏
996 ‎‡2 B2Q|0000128500‏
996 ‎‡2 ISNI|0000000050451281‏
996 ‎‡2 LC|n 00048390‏
996 ‎‡2 SUDOC|191724351‏
996 ‎‡2 DNB|171016513‏
996 ‎‡2 ISNI|0000000034066834‏
996 ‎‡2 ISNI|0000000076751733‏
996 ‎‡2 LC|no2009116721‏
996 ‎‡2 BNF|17781382‏
996 ‎‡2 LC|no2009026666‏
996 ‎‡2 SUDOC|270236228‏
996 ‎‡2 LC|n 2013209973‏
996 ‎‡2 LC|n 79047239‏
996 ‎‡2 LC|n 90628442‏
996 ‎‡2 ISNI|0000000365989836‏
996 ‎‡2 DNB|1057752061‏
996 ‎‡2 DNB|1303035200‏
996 ‎‡2 ISNI|0000000038697342‏
996 ‎‡2 ISNI|0000000052668492‏
996 ‎‡2 SUDOC|050433539‏
996 ‎‡2 NII|DA12182131‏
996 ‎‡2 BNF|17023135‏
996 ‎‡2 ISNI|0000000005477511‏
996 ‎‡2 SUDOC|264924622‏
996 ‎‡2 J9U|987011289449605171‏
996 ‎‡2 CAOONL|ncf10235891‏
996 ‎‡2 ISNI|0000000051389299‏
996 ‎‡2 CAOONL|ncf11916366‏
996 ‎‡2 LC|n 97082691‏
996 ‎‡2 ISNI|0000000006920474‏
996 ‎‡2 LC|n 79052745‏
996 ‎‡2 DNB|1231724676‏
996 ‎‡2 ISNI|000000006720384X‏
996 ‎‡2 LC|nr2001018772‏
996 ‎‡2 ISNI|0000000078305673‏
996 ‎‡2 PLWABN|9813997364505606‏
996 ‎‡2 BNF|13750926‏
996 ‎‡2 LC|n 88157432‏
996 ‎‡2 ISNI|0000000058999874‏
996 ‎‡2 BNF|13018619‏
996 ‎‡2 SUDOC|097685321‏
996 ‎‡2 DNB|13377810X‏
996 ‎‡2 DNB|1078457824‏
996 ‎‡2 BNF|12129005‏
996 ‎‡2 LC|n 2007007372‏
996 ‎‡2 SUDOC|202419347‏
996 ‎‡2 LC|n 95114076‏
996 ‎‡2 LC|n 2009034047‏
996 ‎‡2 BNF|13529616‏
996 ‎‡2 DNB|109380215‏
996 ‎‡2 BNF|13018682‏
996 ‎‡2 ISNI|0000000374483191‏
996 ‎‡2 DNB|1139664174‏
996 ‎‡2 ISNI|0000000031749146‏
996 ‎‡2 DNB|1266251278‏
996 ‎‡2 DNB|124932126‏
996 ‎‡2 ISNI|0000000454245329‏
996 ‎‡2 BNF|15553003‏
996 ‎‡2 NKC|kup19980000008055‏
996 ‎‡2 ISNI|0000000108375681‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏