VIAF

Virtual International Authority File

Search

Leader 00000nz a2200037n 45 0
001 WKP|Q79199143 (VIAF cluster) (Authority/Source Record)
003 WKP
005 20241121000331.0
008 241121nneanz||abbn n and d
035 ‎‡a (WKP)Q79199143‏
024 ‎‡a 0000-0002-6732-2499‏ ‎‡2 orcid‏
035 ‎‡a (OCoLC)Q79199143‏
100 0 ‎‡a Xiaohong Zhang‏ ‎‡c researcher ORCID ID=0000-0002-6732-2499‏ ‎‡9 en‏
670 ‎‡a Author's 6,12-Dihydro-6,12-diboradibenzo[def,mno]chrysene: A Doubly Boron-Doped Polycyclic Aromatic Hydrocarbon for Organic Light Emitting Diodes by a One-Pot Synthesis‏
670 ‎‡a Author's A bipolar transporter as an efficient green fluorescent emitter and host for red phosphors in multi- and single-layer organic light-emitting diodes.‏
670 ‎‡a Author's A Microchannel-Confined Crystallization Strategy Enables Blade Coating of Perovskite Single Crystal Arrays for Device Integration‏
670 ‎‡a Author's A multifunctional phosphine oxide-diphenylamine hybrid compound as a high performance deep-blue fluorescent emitter and green phosphorescent host‏
670 ‎‡a Author's A novel colorimetric and fluorescent anion chemosensor based on the flavone quasi-crown ether-metal complex.‏
670 ‎‡a Author's A silicon/zinc 2,9,16,23-tetraaminophthalocyanine coaxial core–shell nanowire array as an efficient solar hydrogen generation photocatalyst‏
670 ‎‡a Author's Achieving highly efficient simple-emission layer fluorescence/phosphorescence hybrid white organic light-emitting devices via effective confinement of triplets‏
670 ‎‡a Author's Ambient Electrosynthesis of Ammonia: Electrode Porosity and Composition Engineering‏
670 ‎‡a Author's An efficient chloride-selective fluorescent chemosensor based on 2,9-bis(4'-hydroxyphenyl)phenanthroline Cu(II) complex‏
670 ‎‡a Author's An organic nanowire-metal nanoparticle hybrid for the highly enhanced fluorescence detection of dopamine‏
670 ‎‡a Author's Avoiding Energy Loss on TADF Emitters: Controlling the Dual Conformations of D-A Structure Molecules Based on the Pseudoplanar Segments.‏
670 ‎‡a Author's Biodegradable π-Conjugated Oligomer Nanoparticles with High Photothermal Conversion Efficiency for Cancer Theranostics‏
670 ‎‡a Author's Bulk preparation of Si-SiOx hierarchical structures: high-density radially oriented amorphous silica nanowires on a single-crystal silicon nanocore‏
670 ‎‡a Author's Centimeter-Long Single-Crystalline Si Nanowires.‏
670 ‎‡a Author's Control of Dual Conformations: Developing Thermally Activated Delayed Fluorescence Emitters for Highly Efficient Single-Emitter White Organic Light-Emitting Diodes‏
670 ‎‡a Author's Controlled synthesis of oriented 1D ZnO nanostructures on transparent conductive substrates‏
670 ‎‡a Author's Coumarin-Based Thermally Activated Delayed Fluorescence Emitters with High External Quantum Efficiency and Low Efficiency Roll-off in the Devices.‏
670 ‎‡a Author's Direct evidence of molecular aggregation and degradation mechanism of organic light-emitting diodes under joule heating: an STM and photoluminescence study‏
670 ‎‡a Author's Dual-Band, High-Performance Phototransistors from Hybrid Perovskite and Organic Crystal Array for Secure Communication Applications‏
670 ‎‡a Author's Dual-Targeted Multifunctional Nanoparticles for Magnetic Resonance Imaging Guided Cancer Diagnosis and Therapy‏
670 ‎‡a Author's Efficient Orange-Red Thermally Activated Delayed Fluorescence Emitters Feasible for Both Thermal Evaporation and Solution Process‏
670 ‎‡a Author's Efficient visible light photocatalyst fabricated by depositing plasmonic Ag nanoparticles on conductive polymer-protected Si nanowire arrays for photoelectrochemical hydrogen generation.‏
670 ‎‡a Author's EQE Climbing Over 6% at High Brightness of 14350 cd/m2 in Deep-Blue OLEDs Based on Hybridized Local and Charge-Transfer Fluorescence.‏
670 ‎‡a Author's Excellent photocatalysis of HF-treated silicon nanowires‏
670 ‎‡a Author's Fabrication and structure characterization of te butterfly nanostructures‏
670 ‎‡a Author's Fluorescence turn on of coumarin derivatives by metal cations: a new signaling mechanism based on C=N isomerization.‏
670 ‎‡a Author's High-Performance, Simplified Fluorescence and Phosphorescence Hybrid White Organic Light-Emitting Devices Allowing Complete Triplet Harvesting.‏
670 ‎‡a Author's Highly efficient and stable Si nanowires array embedded into transparent polymer for visible light photoelectrochemical cell.‏
670 ‎‡a Author's Highly Efficient Photoelectrochemical Water Splitting from Hierarchical WO3/BiVO4 Nanoporous Sphere Arrays.‏
670 ‎‡a Author's Intermolecular Charge-Transfer Transition Emitter Showing Thermally Activated Delayed Fluorescence for Efficient Non-Doped OLEDs‏
670 ‎‡a Author's Iodine-Doped-Poly(3,4-Ethylenedioxythiophene)-Modified Si Nanowire 1D Core-Shell Arrays as an Efficient Photocatalyst for Solar Hydrogen Generation‏
670 ‎‡a Author's Isomeric Thermally Activated Delayed Fluorescence Emitters for Color Purity-Improved Emission in Organic Light-Emitting Devices.‏
670 ‎‡a Author's L-Type Ligand-Assisted Acid-Free Synthesis of CsPbBr3 Nanocrystals with Near-Unity Photoluminescence Quantum Yield and High Stability‏
670 ‎‡a Author's Large-scale fabrication and characterization of Cd-doped ZnO nanocantilever arrays‏
670 ‎‡a Author's Large-Scale Fabrication of Silicon Nanowires for Solar Energy Applications.‏
670 ‎‡a Author's Lithium intercalation and diffusion in TiO2 nanotubes: a first-principles investigation‏
670 ‎‡a Author's Low-cost solar cell based on a composite of silicon nanowires and a highly conductive nonphotoactive polymer.‏
670 ‎‡a Author's Management of singlet and triplet excitons in a single emission layer: a simple approach for a high-efficiency fluorescence/phosphorescence hybrid white organic light-emitting device.‏
670 ‎‡a Author's Memory phototransistors based on exponential-association photoelectric conversion law‏
670 ‎‡a Author's Mitochondrial-Targeting Lonidamine-Doxorubicin Nanoparticles for Synergistic Chemotherapy to Conquer Drug Resistance.‏
670 ‎‡a Author's MoO3 Nanodots Decorated CdS Nanoribbons for High-Performance, Homojunction Photovoltaic Devices on Flexible Substrates.‏
670 ‎‡a Author's New fluorescent chemosensor based on exciplex signaling mechanism‏
670 ‎‡a Author's Novel Carbazol-Pyridine-Carbonitrile Derivative as Excellent Blue Thermally Activated Delayed Fluorescence Emitter for Highly Efficient Organic Light-Emitting Devices‏
670 ‎‡a Author's Prediction and design of efficient exciplex emitters for high-efficiency, thermally activated delayed-fluorescence organic light-emitting diodes.‏
670 ‎‡a Author's Rapid-releasing of HI-6 via brain-targeted mesoporous silica nanoparticles for nerve agent detoxification.‏
670 ‎‡a Author's Red Organic Light-Emitting Diode with External Quantum Efficiency beyond 20% Based on a Novel Thermally Activated Delayed Fluorescence Emitter‏
670 ‎‡a Author's Saturated Vapor-Assisted Growth of Single-Crystalline Organic-Inorganic Hybrid Perovskite Nanowires for High-Performance Photodetectors with Robust Stability.‏
670 ‎‡a Author's Self-assembly of ZnO/SiO2 hierarchical nanostructures array on metal substrate‏
670 ‎‡a Author's Si nanowire directly grown on a liquid metal substrate--towards wafer scale transferable nanowire arrays with improved visible-light sterilization.‏
670 ‎‡a Author's Si/poly-CuTAPC coaxial core–shell nanowire array as enhanced visible-light photocatalyst for hydrogen production‏
670 ‎‡a Author's Silicon nanowire based single-molecule SERS sensor‏
670 ‎‡a Author's Silicon nanowire-based surface-enhanced raman spectroscopy endoscope for intracellular pH detection‏
670 ‎‡a Author's Silicon Nanowire/Polymer Hybrid Solar Cell-Supercapacitor: A Self-Charging Power Unit with a Total Efficiency of 10.5.‏
670 ‎‡a Author's Silicon/Organic Heterojunction for Photoelectrochemical Energy Conversion Photoanode with a Record Photovoltage‏
670 ‎‡a Author's Strategies for Preparing Albumin-based Nanoparticles for Multifunctional Bioimaging and Drug Delivery‏
670 ‎‡a Author's Synthesis of Hollow Silica Spheres with Hierarchical Shell Structure by the Dual Action of Liquid Indium Microbeads in Vapor–Liquid–Solid Growth‏
670 ‎‡a Author's Synthesis, Structure, and Photophysical Properties of Two Four-Coordinate Cu(I)-NHC Complexes with Efficient Delayed Fluorescence.‏
670 ‎‡a Author's Ternary organic solar cells with a phase-modulated surface distribution via the addition of a small molecular luminescent dye to obtain a high efficiency over 10.5.‏
670 ‎‡a Author's Theoretical investigation of the singlet-triplet splittings for carbazole-based thermally activated delayed fluorescence emitters‏
670 ‎‡a Author's Theoretical Studies of Bipolar Transport in CnBTBT-FmTCNQ Donor-Acceptor Cocrystals‏
670 ‎‡a Author's Thermally Activated Delayed Fluorescence Carbonyl Derivatives for Organic Light-Emitting Diodes with Extremely Narrow Full Width at Half-Maximum‏
670 ‎‡a Author's TiO2-Photoanode-Assisted Direct-Solar-Energy Harvesting and Storage in a Solar-Powered Redox Cell Using Halides as Active Materials‏
670 ‎‡a Author's Transmission electron microscopy investigation of Sb-doped ZnO nanoribbons and Zn7Sb2O12 branched ZnO nanoribbon structure‏
670 ‎‡a Author's Ultraminiaturized Stretchable Strain Sensors Based on Single Silicon Nanowires for Imperceptible Electronic Skins‏
670 ‎‡a Author's Wafer-Scale Synthesis of Single-Crystal Zigzag Silicon Nanowire Arrays with Controlled Turning Angles‏
670 ‎‡a Author's π-π stacking induced high current density and improved efficiency in ternary organic solar cells‏
909 ‎‡a (orcid) 0000000267322499‏ ‎‡9 1‏
919 ‎‡a directevidenceofmolecularaggregationanddegradationmechanismoforganiclightemittingdiodesunderjouleheatinganstmandphotoluminescencestudy‏ ‎‡A Direct evidence of molecular aggregation and degradation mechanism of organic light-emitting diodes under joule heating: an STM and photoluminescence study‏ ‎‡9 1‏
919 ‎‡a dualtargetedmultifunctionalnanoparticlesformagneticresonanceimagingguidedcancerdiagnosisandtherapy‏ ‎‡A Dual-Targeted Multifunctional Nanoparticles for Magnetic Resonance Imaging Guided Cancer Diagnosis and Therapy‏ ‎‡9 1‏
919 ‎‡a efficientorangeredthermallyactivateddelayedfluorescenceemittersfeasibleforboththermalevaporationandsolutionprocess‏ ‎‡A Efficient Orange-Red Thermally Activated Delayed Fluorescence Emitters Feasible for Both Thermal Evaporation and Solution Process‏ ‎‡9 1‏
919 ‎‡a efficientvisiblelightphotocatalystfabricatedbydepositingplasmonicagnanoparticlesonconductivepolymerprotectedsinanowirearraysforphotoelectrochemicalhydrogengeneration‏ ‎‡A Efficient visible light photocatalyst fabricated by depositing plasmonic Ag nanoparticles on conductive polymer-protected Si nanowire arrays for photoelectrochemical hydrogen generation.‏ ‎‡9 1‏
919 ‎‡a eqeclimbingover6athighbrightnessof14350400m2indeepblueoledsbasedonhybridizedlocalandchargetransferfluorescence‏ ‎‡A EQE Climbing Over 6% at High Brightness of 14350 cd/m2 in Deep-Blue OLEDs Based on Hybridized Local and Charge-Transfer Fluorescence.‏ ‎‡9 1‏
919 ‎‡a excellentphotocatalysisofhftreatedsiliconnanowires‏ ‎‡A Excellent photocatalysis of HF-treated silicon nanowires‏ ‎‡9 1‏
919 ‎‡a fabricationandstructurecharacterizationoftebutterflynanostructures‏ ‎‡A Fabrication and structure characterization of te butterfly nanostructures‏ ‎‡9 1‏
919 ‎‡a fluorescenceturnonofcoumarinderivativesbymetalcationsanewsignalingmechanismbasedon100nisomerization‏ ‎‡A Fluorescence turn on of coumarin derivatives by metal cations: a new signaling mechanism based on C=N isomerization.‏ ‎‡9 1‏
919 ‎‡a highperformancesimplifiedfluorescenceandphosphorescencehybridwhiteorganiclightemittingdevicesallowingcompletetripletharvesting‏ ‎‡A High-Performance, Simplified Fluorescence and Phosphorescence Hybrid White Organic Light-Emitting Devices Allowing Complete Triplet Harvesting.‏ ‎‡9 1‏
919 ‎‡a highlyefficientandstablesinanowiresarrayembeddedintotransparentpolymerforvisiblelightphotoelectrochemicalcell‏ ‎‡A Highly efficient and stable Si nanowires array embedded into transparent polymer for visible light photoelectrochemical cell.‏ ‎‡9 1‏
919 ‎‡a highlyefficientphotoelectrochemicalwatersplittingfromhierarchicalwo3bivo4nanoporousspherearrays‏ ‎‡A Highly Efficient Photoelectrochemical Water Splitting from Hierarchical WO3/BiVO4 Nanoporous Sphere Arrays.‏ ‎‡9 1‏
919 ‎‡a intermolecularchargetransfertransitionemittershowingthermallyactivateddelayedfluorescenceforefficientnondopedoleds‏ ‎‡A Intermolecular Charge-Transfer Transition Emitter Showing Thermally Activated Delayed Fluorescence for Efficient Non-Doped OLEDs‏ ‎‡9 1‏
919 ‎‡a iodinedopedpoly34ethylenedioxythiophenemodifiedsinanowire1dcoreshellarraysasanefficientphotocatalystforsolarhydrogengeneration‏ ‎‡A Iodine-Doped-Poly(3,4-Ethylenedioxythiophene)-Modified Si Nanowire 1D Core-Shell Arrays as an Efficient Photocatalyst for Solar Hydrogen Generation‏ ‎‡9 1‏
919 ‎‡a isomericthermallyactivateddelayedfluorescenceemittersforcolorpurityimprovedemissioninorganiclightemittingdevices‏ ‎‡A Isomeric Thermally Activated Delayed Fluorescence Emitters for Color Purity-Improved Emission in Organic Light-Emitting Devices.‏ ‎‡9 1‏
919 ‎‡a typeligandassistedacidfreesynthesisofcspbbr3nanocrystalswithnearunityphotoluminescencequantumyieldandhighstability‏ ‎‡A L-Type Ligand-Assisted Acid-Free Synthesis of CsPbBr3 Nanocrystals with Near-Unity Photoluminescence Quantum Yield and High Stability‏ ‎‡9 1‏
919 ‎‡a largescalefabricationandcharacterizationof400dopedznonanocantileverarrays‏ ‎‡A Large-scale fabrication and characterization of Cd-doped ZnO nanocantilever arrays‏ ‎‡9 1‏
919 ‎‡a largescalefabricationofsiliconnanowiresforsolarenergyapplications‏ ‎‡A Large-Scale Fabrication of Silicon Nanowires for Solar Energy Applications.‏ ‎‡9 1‏
919 ‎‡a lithiumintercalationanddiffusionintio2nanotubesa1principlesinvestigation‏ ‎‡A Lithium intercalation and diffusion in TiO2 nanotubes: a first-principles investigation‏ ‎‡9 1‏
919 ‎‡a lowcostsolarcellbasedonacompositeofsiliconnanowiresandahighlyconductivenonphotoactivepolymer‏ ‎‡A Low-cost solar cell based on a composite of silicon nanowires and a highly conductive nonphotoactive polymer.‏ ‎‡9 1‏
919 ‎‡a managementofsingletandtripletexcitonsinasingleemissionlayerasimpleapproachforahighefficiencyfluorescencephosphorescencehybridwhiteorganiclightemittingdevice‏ ‎‡A Management of singlet and triplet excitons in a single emission layer: a simple approach for a high-efficiency fluorescence/phosphorescence hybrid white organic light-emitting device.‏ ‎‡9 1‏
919 ‎‡a memoryphototransistorsbasedonexponentialassociationphotoelectricconversionlaw‏ ‎‡A Memory phototransistors based on exponential-association photoelectric conversion law‏ ‎‡9 1‏
919 ‎‡a mitochondrialtargetinglonidaminedoxorubicinnanoparticlesforsynergisticchemotherapytoconquerdrugresistance‏ ‎‡A Mitochondrial-Targeting Lonidamine-Doxorubicin Nanoparticles for Synergistic Chemotherapy to Conquer Drug Resistance.‏ ‎‡9 1‏
919 ‎‡a moo3nanodotsdecoratedcdsnanoribbonsforhighperformancehomojunctionphotovoltaicdevicesonflexiblesubstrates‏ ‎‡A MoO3 Nanodots Decorated CdS Nanoribbons for High-Performance, Homojunction Photovoltaic Devices on Flexible Substrates.‏ ‎‡9 1‏
919 ‎‡a newfluorescentchemosensorbasedonexciplexsignalingmechanism‏ ‎‡A New fluorescent chemosensor based on exciplex signaling mechanism‏ ‎‡9 1‏
919 ‎‡a novelcarbazolpyridinecarbonitrilederivativeasexcellentbluethermallyactivateddelayedfluorescenceemitterforhighlyefficientorganiclightemittingdevices‏ ‎‡A Novel Carbazol-Pyridine-Carbonitrile Derivative as Excellent Blue Thermally Activated Delayed Fluorescence Emitter for Highly Efficient Organic Light-Emitting Devices‏ ‎‡9 1‏
919 ‎‡a predictionanddesignofefficientexciplexemittersforhighefficiencythermallyactivateddelayedfluorescenceorganiclightemittingdiodes‏ ‎‡A Prediction and design of efficient exciplex emitters for high-efficiency, thermally activated delayed-fluorescence organic light-emitting diodes.‏ ‎‡9 1‏
919 ‎‡a rapidreleasingofhi6viabraintargetedmesoporoussilicananoparticlesfornerveagentdetoxification‏ ‎‡A Rapid-releasing of HI-6 via brain-targeted mesoporous silica nanoparticles for nerve agent detoxification.‏ ‎‡9 1‏
919 ‎‡a redorganiclightemittingdiodewithexternalquantumefficiencybeyond20basedonanovelthermallyactivateddelayedfluorescenceemitter‏ ‎‡A Red Organic Light-Emitting Diode with External Quantum Efficiency beyond 20% Based on a Novel Thermally Activated Delayed Fluorescence Emitter‏ ‎‡9 1‏
919 ‎‡a saturatedvaporassistedgrowthofsinglecrystallineorganicinorganichybridperovskitenanowiresforhighperformancephotodetectorswithrobuststability‏ ‎‡A Saturated Vapor-Assisted Growth of Single-Crystalline Organic-Inorganic Hybrid Perovskite Nanowires for High-Performance Photodetectors with Robust Stability.‏ ‎‡9 1‏
919 ‎‡a selfassemblyofznosio2hierarchicalnanostructuresarrayonmetalsubstrate‏ ‎‡A Self-assembly of ZnO/SiO2 hierarchical nanostructures array on metal substrate‏ ‎‡9 1‏
919 ‎‡a sinanowiredirectlygrownonaliquidmetalsubstratetowardswaferscaletransferablenanowirearrayswithimprovedvisiblelightsterilization‏ ‎‡A Si nanowire directly grown on a liquid metal substrate--towards wafer scale transferable nanowire arrays with improved visible-light sterilization.‏ ‎‡9 1‏
919 ‎‡a sipolycutapccoaxialcoreshellnanowirearrayasenhancedvisiblelightphotocatalystforhydrogenproduction‏ ‎‡A Si/poly-CuTAPC coaxial core–shell nanowire array as enhanced visible-light photocatalyst for hydrogen production‏ ‎‡9 1‏
919 ‎‡a siliconnanowirebasedsinglemoleculeserssensor‏ ‎‡A Silicon nanowire based single-molecule SERS sensor‏ ‎‡9 1‏
919 ‎‡a siliconnanowirebasedsurfaceenhancedramanspectroscopyendoscopeforintracellularphdetection‏ ‎‡A Silicon nanowire-based surface-enhanced raman spectroscopy endoscope for intracellular pH detection‏ ‎‡9 1‏
919 ‎‡a siliconnanowirepolymerhybridsolarcellsupercapacitoraselfchargingpowerunitwithatotalefficiencyof105‏ ‎‡A Silicon Nanowire/Polymer Hybrid Solar Cell-Supercapacitor: A Self-Charging Power Unit with a Total Efficiency of 10.5.‏ ‎‡9 1‏
919 ‎‡a siliconorganicheterojunctionforphotoelectrochemicalenergyconversionphotoanodewitharecordphotovoltage‏ ‎‡A Silicon/Organic Heterojunction for Photoelectrochemical Energy Conversion Photoanode with a Record Photovoltage‏ ‎‡9 1‏
919 ‎‡a strategiesforpreparingalbuminbasednanoparticlesformultifunctionalbioimaginganddrugdelivery‏ ‎‡A Strategies for Preparing Albumin-based Nanoparticles for Multifunctional Bioimaging and Drug Delivery‏ ‎‡9 1‏
919 ‎‡a synthesisofhollowsilicasphereswithhierarchicalshellstructurebythedualactionofliquidindiummicrobeadsinvaporliquidsolidgrowth‏ ‎‡A Synthesis of Hollow Silica Spheres with Hierarchical Shell Structure by the Dual Action of Liquid Indium Microbeads in Vapor–Liquid–Solid Growth‏ ‎‡9 1‏
919 ‎‡a synthesisstructureandphotophysicalpropertiesof24coordinatecu1nhccomplexeswithefficientdelayedfluorescence‏ ‎‡A Synthesis, Structure, and Photophysical Properties of Two Four-Coordinate Cu(I)-NHC Complexes with Efficient Delayed Fluorescence.‏ ‎‡9 1‏
919 ‎‡a ternaryorganicsolarcellswithaphasemodulatedsurfacedistributionviatheadditionofasmallmolecularluminescentdyetoobtainahighefficiencyover105‏ ‎‡A Ternary organic solar cells with a phase-modulated surface distribution via the addition of a small molecular luminescent dye to obtain a high efficiency over 10.5.‏ ‎‡9 1‏
919 ‎‡a theoreticalinvestigationofthesinglettripletsplittingsforcarbazolebasedthermallyactivateddelayedfluorescenceemitters‏ ‎‡A Theoretical investigation of the singlet-triplet splittings for carbazole-based thermally activated delayed fluorescence emitters‏ ‎‡9 1‏
919 ‎‡a theoreticalstudiesofbipolartransportincnbtbtfmtcnqdonoracceptorcocrystals‏ ‎‡A Theoretical Studies of Bipolar Transport in CnBTBT-FmTCNQ Donor-Acceptor Cocrystals‏ ‎‡9 1‏
919 ‎‡a thermallyactivateddelayedfluorescencecarbonylderivativesfororganiclightemittingdiodeswithextremelynarrowfullwidthathalfmaximum‏ ‎‡A Thermally Activated Delayed Fluorescence Carbonyl Derivatives for Organic Light-Emitting Diodes with Extremely Narrow Full Width at Half-Maximum‏ ‎‡9 1‏
919 ‎‡a tio2photoanodeassisteddirectsolarenergyharvestingandstorageinasolarpoweredredoxcellusinghalidesasactivematerials‏ ‎‡A TiO2-Photoanode-Assisted Direct-Solar-Energy Harvesting and Storage in a Solar-Powered Redox Cell Using Halides as Active Materials‏ ‎‡9 1‏
919 ‎‡a transmissionelectronmicroscopyinvestigationofsbdopedznonanoribbonsandzn7sb2o12branchedznonanoribbonstructure‏ ‎‡A Transmission electron microscopy investigation of Sb-doped ZnO nanoribbons and Zn7Sb2O12 branched ZnO nanoribbon structure‏ ‎‡9 1‏
919 ‎‡a ultraminiaturizedstretchablestrainsensorsbasedonsinglesiliconnanowiresforimperceptibleelectronicskins‏ ‎‡A Ultraminiaturized Stretchable Strain Sensors Based on Single Silicon Nanowires for Imperceptible Electronic Skins‏ ‎‡9 1‏
919 ‎‡a waferscalesynthesisofsinglecrystalzigzagsiliconnanowirearrayswithcontrolledturningangles‏ ‎‡A Wafer-Scale Synthesis of Single-Crystal Zigzag Silicon Nanowire Arrays with Controlled Turning Angles‏ ‎‡9 1‏
919 ‎‡a ππstackinginducedhighcurrentdensityandimprovedefficiencyinternaryorganicsolarcells‏ ‎‡A π-π stacking induced high current density and improved efficiency in ternary organic solar cells‏ ‎‡9 1‏
919 ‎‡a dualbandhighperformancephototransistorsfromhybridperovskiteandorganiccrystalarrayforsecurecommunicationapplications‏ ‎‡A Dual-Band, High-Performance Phototransistors from Hybrid Perovskite and Organic Crystal Array for Secure Communication Applications‏ ‎‡9 1‏
919 ‎‡a 612dihydro612diboradibenzochryseneadoublyborondopedpolycyclicaromatichydrocarbonfororganiclightemittingdiodesbya1potsynthesis‏ ‎‡A 6,12-Dihydro-6,12-diboradibenzo[def,mno]chrysene: A Doubly Boron-Doped Polycyclic Aromatic Hydrocarbon for Organic Light Emitting Diodes by a One-Pot Synthesis‏ ‎‡9 1‏
919 ‎‡a bipolartransporterasanefficientgreenfluorescentemitterandhostforredphosphorsinmultiandsinglelayerorganiclightemittingdiodes‏ ‎‡A A bipolar transporter as an efficient green fluorescent emitter and host for red phosphors in multi- and single-layer organic light-emitting diodes.‏ ‎‡9 1‏
919 ‎‡a microchannelconfinedcrystallizationstrategyenablesbladecoatingofperovskitesinglecrystalarraysfordeviceintegration‏ ‎‡A A Microchannel-Confined Crystallization Strategy Enables Blade Coating of Perovskite Single Crystal Arrays for Device Integration‏ ‎‡9 1‏
919 ‎‡a multifunctionalphosphineoxidediphenylaminehybridcompoundasahighperformancedeepbluefluorescentemitterandgreenphosphorescenthost‏ ‎‡A A multifunctional phosphine oxide-diphenylamine hybrid compound as a high performance deep-blue fluorescent emitter and green phosphorescent host‏ ‎‡9 1‏
919 ‎‡a novelcolorimetricandfluorescentanionchemosensorbasedontheflavonequasicrownethermetalcomplex‏ ‎‡A A novel colorimetric and fluorescent anion chemosensor based on the flavone quasi-crown ether-metal complex.‏ ‎‡9 1‏
919 ‎‡a siliconzinc291623tetraaminophthalocyaninecoaxialcoreshellnanowirearrayasanefficientsolarhydrogengenerationphotocatalyst‏ ‎‡A A silicon/zinc 2,9,16,23-tetraaminophthalocyanine coaxial core–shell nanowire array as an efficient solar hydrogen generation photocatalyst‏ ‎‡9 1‏
919 ‎‡a achievinghighlyefficientsimpleemissionlayerfluorescencephosphorescencehybridwhiteorganiclightemittingdevicesviaeffectiveconfinementoftriplets‏ ‎‡A Achieving highly efficient simple-emission layer fluorescence/phosphorescence hybrid white organic light-emitting devices via effective confinement of triplets‏ ‎‡9 1‏
919 ‎‡a ambientelectrosynthesisofammoniaelectrodeporosityandcompositionengineering‏ ‎‡A Ambient Electrosynthesis of Ammonia: Electrode Porosity and Composition Engineering‏ ‎‡9 1‏
919 ‎‡a efficientchlorideselectivefluorescentchemosensorbasedon29bis4hydroxyphenylphenanthrolinecu2complex‏ ‎‡A An efficient chloride-selective fluorescent chemosensor based on 2,9-bis(4'-hydroxyphenyl)phenanthroline Cu(II) complex‏ ‎‡9 1‏
919 ‎‡a organicnanowiremetalnanoparticlehybridforthehighlyenhancedfluorescencedetectionofdopamine‏ ‎‡A An organic nanowire-metal nanoparticle hybrid for the highly enhanced fluorescence detection of dopamine‏ ‎‡9 1‏
919 ‎‡a avoidingenergylossontadfemitterscontrollingthedualconformationsof500astructuremoleculesbasedonthepseudoplanarsegments‏ ‎‡A Avoiding Energy Loss on TADF Emitters: Controlling the Dual Conformations of D-A Structure Molecules Based on the Pseudoplanar Segments.‏ ‎‡9 1‏
919 ‎‡a biodegradableπconjugatedoligomernanoparticleswithhighphotothermalconversionefficiencyforcancertheranostics‏ ‎‡A Biodegradable π-Conjugated Oligomer Nanoparticles with High Photothermal Conversion Efficiency for Cancer Theranostics‏ ‎‡9 1‏
919 ‎‡a bulkpreparationofsisioxhierarchicalstructureshighdensityradiallyorientedamorphoussilicananowiresonasinglecrystalsiliconnanocore‏ ‎‡A Bulk preparation of Si-SiOx hierarchical structures: high-density radially oriented amorphous silica nanowires on a single-crystal silicon nanocore‏ ‎‡9 1‏
919 ‎‡a centimeterlongsinglecrystallinesinanowires‏ ‎‡A Centimeter-Long Single-Crystalline Si Nanowires.‏ ‎‡9 1‏
919 ‎‡a controlofdualconformationsdevelopingthermallyactivateddelayedfluorescenceemittersforhighlyefficientsingleemitterwhiteorganiclightemittingdiodes‏ ‎‡A Control of Dual Conformations: Developing Thermally Activated Delayed Fluorescence Emitters for Highly Efficient Single-Emitter White Organic Light-Emitting Diodes‏ ‎‡9 1‏
919 ‎‡a controlledsynthesisoforiented1dznonanostructuresontransparentconductivesubstrates‏ ‎‡A Controlled synthesis of oriented 1D ZnO nanostructures on transparent conductive substrates‏ ‎‡9 1‏
919 ‎‡a coumarinbasedthermallyactivateddelayedfluorescenceemitterswithhighexternalquantumefficiencyandlowefficiencyrolloffinthedevices‏ ‎‡A Coumarin-Based Thermally Activated Delayed Fluorescence Emitters with High External Quantum Efficiency and Low Efficiency Roll-off in the Devices.‏ ‎‡9 1‏
996 ‎‡2 PTBNP|1019528‏
996 ‎‡2 ISNI|0000000374382227‏
996 ‎‡2 LC|n 2012039847‏
996 ‎‡2 BIBSYS|90326798‏
996 ‎‡2 ISNI|0000000370264506‏
996 ‎‡2 SUDOC|25447229X‏
996 ‎‡2 LC|nr 92001213‏
996 ‎‡2 CAOONL|ncf11900525‏
996 ‎‡2 LC|n 2019059366‏
996 ‎‡2 PLWABN|9812615464005606‏
996 ‎‡2 LC|nb2007003074‏
996 ‎‡2 DNB|1199856622‏
996 ‎‡2 PLWABN|9811538587105606‏
996 ‎‡2 SUDOC|28037240X‏
996 ‎‡2 LC|n 2023184675‏
996 ‎‡2 PLWABN|9810637776105606‏
996 ‎‡2 ERRR|12380969‏
996 ‎‡2 NTA|32442065X‏
996 ‎‡2 LC|n 2012025052‏
996 ‎‡2 BNF|17744304‏
996 ‎‡2 DNB|111104628X‏
996 ‎‡2 BNF|15025456‏
996 ‎‡2 NTA|344685004‏
996 ‎‡2 NTA|270884696‏
996 ‎‡2 NII|DA18717898‏
996 ‎‡2 ISNI|0000000496160796‏
996 ‎‡2 ISNI|0000000387194639‏
996 ‎‡2 ISNI|000000011919363X‏
996 ‎‡2 NTA|364154292‏
996 ‎‡2 RERO|A003998486‏
996 ‎‡2 CAOONL|ncf10610914‏
996 ‎‡2 DNB|124977138‏
996 ‎‡2 LC|no2014008082‏
996 ‎‡2 NTA|339708395‏
996 ‎‡2 LC|no2007115048‏
996 ‎‡2 ISNI|0000000108370581‏
996 ‎‡2 PLWABN|9810555406205606‏
996 ‎‡2 PLWABN|9811784280405606‏
996 ‎‡2 ISNI|0000000069585386‏
996 ‎‡2 ISNI|0000000371379663‏
996 ‎‡2 NSK|000523654‏
996 ‎‡2 ISNI|0000000071322622‏
996 ‎‡2 CYT|AC000615666‏
996 ‎‡2 SUDOC|233198083‏
996 ‎‡2 LC|n 2022184983‏
996 ‎‡2 NTA|364154586‏
996 ‎‡2 BNF|15604533‏
996 ‎‡2 DNB|1155539508‏
996 ‎‡2 NKC|ola2004228896‏
996 ‎‡2 NKC|xx0279295‏
996 ‎‡2 RERO|A027272734‏
996 ‎‡2 ISNI|0000000389029143‏
996 ‎‡2 NII|DA11543697‏
996 ‎‡2 DNB|1011279460‏
996 ‎‡2 NTA|405887337‏
996 ‎‡2 LC|no2009146674‏
996 ‎‡2 ISNI|0000000392617499‏
996 ‎‡2 NSK|000735742‏
996 ‎‡2 LC|n 2015021894‏
996 ‎‡2 NDL|001276818‏
996 ‎‡2 PLWABN|9810644667805606‏
996 ‎‡2 NTA|405887248‏
996 ‎‡2 NII|DA07023365‏
996 ‎‡2 J9U|987007363715305171‏
996 ‎‡2 BIBSYS|4022357‏
996 ‎‡2 LC|no2016083950‏
996 ‎‡2 SUDOC|275035913‏
996 ‎‡2 LC|n 2010083097‏
996 ‎‡2 DNB|1246978180‏
996 ‎‡2 ISNI|0000000395579037‏
996 ‎‡2 PLWABN|9812422791005606‏
996 ‎‡2 NTA|408629371‏
996 ‎‡2 LC|n 2015022278‏
996 ‎‡2 LC|no2010109208‏
996 ‎‡2 DNB|1015021964‏
996 ‎‡2 BIBSYS|1671433161852‏
996 ‎‡2 DNB|1151167908‏
996 ‎‡2 SUDOC|132967251‏
996 ‎‡2 NTA|364154136‏
996 ‎‡2 CYT|AC000008627‏
996 ‎‡2 DNB|17377167X‏
996 ‎‡2 LC|no2022044042‏
996 ‎‡2 ISNI|0000000442803880‏
997 ‎‡a 0 0 lived 0 0‏ ‎‡9 1‏